Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J004106.30ON1201206244e-85
Kpol_1037.216.30ON1201205603e-75
TDEL0G043906.30ON1221205482e-73
ZYRO0C07502g6.30ON1221205473e-73
Suva_15.1696.30ON1221205413e-72
Skud_15.1576.30ON1221205413e-72
Smik_15.1656.30ON1201205378e-72
YOL005C (RPB11)6.30ON1201205378e-72
KAFR0A051106.30ON1221205371e-71
NCAS0D021206.30ON1221195333e-71
NDAI0C026706.30ON1221205317e-71
TBLA0E031506.30ON1181185309e-71
ACL005C6.30ON1221205282e-70
KNAG0F029106.30ON1221205264e-70
CAGL0E02453g6.30ON1201205264e-70
SAKL0E01562g6.30ON1221205125e-68
KLLA0C06160g6.30ON1211185091e-67
KLTH0C10934g6.30ON1221205041e-66
Kwal_56.224726.30ON1221205031e-66
TBLA0B012902.163ON102861182e-08
TPHA0B029202.163ON1301011192e-08
CAGL0L03872g2.163ON137921193e-08
YNL113W (RPC19)2.163ON1421021174e-08
Smik_14.2142.163ON1421021166e-08
Skud_14.2182.163ON1561041123e-07
Suva_14.2252.163ON1421041114e-07
NCAS0G025502.163ON1501021107e-07
KNAG0I020602.163ON134941097e-07
KAFR0B045702.163ON1311011071e-06
Kpol_165.22.163ON128921052e-06
Ecym_54232.163ON127941052e-06
NDAI0F027502.163ON149901053e-06
AFL220C2.163ON135941043e-06
TDEL0F011802.163ON1291021027e-06
ZYRO0B09878g2.163ON1301041001e-05
SAKL0E10692g2.163ON131102992e-05
KLLA0F23760g2.163ON12794992e-05
KLTH0D09350g2.163ON14662974e-05
Kwal_26.84732.163ON15043941e-04
Kwal_23.58927.257ON67859780.030
NCAS0C058604.15ON1868109661.3
YPR196WsingletonON47050652.0
YBR297W (MAL33)na 1ON46852652.0
Ecym_83557.114ON45326623.8
ZYRO0C01320g5.9ON81941633.8
NCAS0D022805.9ON80846624.2
KLLA0E11309gna 2ON36032615.4
TPHA0C008808.312ON22239599.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00410
         (120 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   244   4e-85
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   220   3e-75
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   215   2e-73
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   215   3e-73
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   213   3e-72
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   213   3e-72
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   211   8e-72
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   211   8e-72
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   211   1e-71
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   209   3e-71
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   209   7e-71
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   208   9e-71
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   207   2e-70
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   207   4e-70
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   207   4e-70
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   201   5e-68
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   200   1e-67
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   198   1e-66
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   198   1e-66
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    50   2e-08
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    50   2e-08
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    50   3e-08
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    50   4e-08
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    49   6e-08
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    48   3e-07
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    47   4e-07
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    47   7e-07
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    47   7e-07
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    46   1e-06
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    45   2e-06
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    45   2e-06
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    45   3e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    45   3e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    44   7e-06
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    43   1e-05
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    43   2e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    43   2e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    42   4e-05
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    41   1e-04
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    35   0.030
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    30   1.3  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    30   2.0  
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    30   2.0  
Ecym_8355 Chr8 complement(709850..711211) [1362 bp, 453 aa] {ON}...    28   3.8  
ZYRO0C01320g Chr3 (89149..91608) [2460 bp, 819 aa] {ON} similar ...    29   3.8  
NCAS0D02280 Chr4 complement(427826..430252) [2427 bp, 808 aa] {O...    28   4.2  
KLLA0E11309g Chr5 complement(993416..994498) [1083 bp, 360 aa] {...    28   5.4  
TPHA0C00880 Chr3 complement(186826..187494) [669 bp, 222 aa] {ON...    27   9.9  

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  244 bits (624), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  220 bits (560), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPD+FELFLL EG+SKL IE DTKA NAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFARFKLRIQT ENYDPKDALK ACNNIINKLGILKTNF+TEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  215 bits (548), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 104/120 (86%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKA NAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFARFK+RIQT E YDPKDALK ACN IINKL +LKTNF+TEWNLQTLASDDN+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  215 bits (547), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+++ DTKA NA+V+TFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFARFK+RIQT E YDPKDALK ACN IINKLG+LKTNF+TEWNLQTLASDDNF
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 104/120 (86%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKA NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN+IINKLG LKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 104/120 (86%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKA NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN+IINKLG LKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  211 bits (537), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+I+ DTKA NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN+IINKLG LKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  211 bits (537), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+I+ DTKA NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN+IINKLG LKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  211 bits (537), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+I+ DTK+ NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLR+QT E YDPK+ALK ACN+IINKLGILKTNF+TEWNLQTLASD+NF
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  209 bits (533), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKLQI+ DTKA NAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDN 119
           YKVEHP FARFKLRIQT E YDPKDALK ACN+II+KLG+LK NF+TEWNLQTLA+D+N
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADEN 119

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  209 bits (531), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL I+ DTKA NAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FA FKLRIQT E YDPK ALK ACNNIINKLGILKTNF+TEWNLQTLASD+NF
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  208 bits (530), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 100/118 (84%), Positives = 108/118 (91%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFE FLL EG+SKLQIE DTKA N VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDD 118
           YKVEHPLFARFK+RIQT E YDPKDAL+ ACN+II KLGILKTNF+TEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  207 bits (528), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 110/120 (91%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKAANAV+ITFEKEDHTLGN+IR ELL DE+VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFARF++RIQT E YDPK+ALK ACN+IINKL  LK+NF+TEWNLQTLAS+D F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  207 bits (526), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 107/120 (89%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL +G+SKL I+ DTK+ NA+VITF KEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN IINKLGILKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  207 bits (526), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL+I+ DTKA NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHP FARFKLRIQT E YDPKDAL+ AC++IINKLG LK+NF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  201 bits (512), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL IE DTKA NAV+ITFEKEDHTLGNLIR ELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFARFK+RIQT E YDPKDALK ACNNII KL  L++NF+TEW+LQTLAS++N+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  200 bits (509), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 93/118 (78%), Positives = 109/118 (92%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG+SKL++EQDTKA++A+++TFEKEDHTLGNLIR ELL DE VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDD 118
           YKVEHPLFA+FK+RIQT E YDPKDALK ACN+IINKL  L++NF+TEWNLQTLA++D
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  198 bits (504), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG++KL+I+ DTKA NAV++TFEKEDHTL NLIR ELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFA+FKLRIQT E YDPKDALK ACN II+KLG L++NF+TEWNLQTLAS+DN+
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  198 bits (503), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 93/120 (77%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60
           MNAPDRFELFLL EG++KL+I+ DTKA NAV++TFEKEDHTL NLIR ELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           YKVEHPLFA+FK+RIQT E YDPKDALK ACN II+KLG L++NF+TEWNLQTLAS+DN+
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 50.1 bits (118), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%)

Query: 20  QIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRIQTEE 79
           Q+   T   +A       EDHTLGN +R  L+ +  V F  Y + HP      LR+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  NYDPKDALKMACNNIINKLGILKTNF 105
           +    DAL     ++++   +++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 50.4 bits (119), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%)

Query: 5   DRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVE 64
           D  ++  +DE + K+     +    +      +EDHTLGN +R+ ++ + +V F  Y + 
Sbjct: 23  DEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIP 82

Query: 65  HPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
           HP      LRIQT  N    +AL+    ++++   +++  F
Sbjct: 83  HPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 50.4 bits (119), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 16  QSKLQIEQDTKAANAVVITFE--KEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKL 73
           ++K+++     + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTEENYDPKDALKMACNNIINKLGILKTNF 105
           RIQT  N    DAL+   +++I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKV 63
           PDR ++ LL +  S    E  T A+  +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            HP      +RIQT       DAL+    ++++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKV 63
           PDR ++ LL +  S    E  T A+  +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            HP      +RIQT       DAL+    ++++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAY 61
           + PDR ++ LL +  S    E  T A+  +V    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            + HP      +RIQT       DAL+    ++++   +++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAY 61
           + PDR ++ LL +  S    E  T A+  +V    +EDHTLGN +R  ++ + +V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            + HP      +RIQT       +AL+    ++++   ++++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKV 63
           PDR ++ +L EG S    E  T A+  +V     EDHTLGN +R  ++ +  V F  Y +
Sbjct: 50  PDREKVKILPEGAS----EDGTCASFQIV----DEDHTLGNALRYIIMKNPNVEFCGYSI 101

Query: 64  EHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            HP      +RIQT  +    +A +    ++++   +++  F
Sbjct: 102 PHPSENFLNVRIQTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%)

Query: 12  LDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARF 71
           LD  + K+  E  T+           EDHTLGN +R  ++ + +V F  Y + HP     
Sbjct: 34  LDREKVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWL 93

Query: 72  KLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            +RIQT       DA K    ++++   +++  F
Sbjct: 94  NVRIQTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVE 64
           DR ++ +L +  S    E  T A+  +V    +EDHTLGN +R  ++ + +V F  Y + 
Sbjct: 32  DRNKIKILPQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPQVEFCGYSIP 83

Query: 65  HPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
           HP      +RIQT       DALK    ++++   +++  F
Sbjct: 84  HPSENLLNIRIQTYGEITAVDALKKGLADLMDLCDVVEETF 124

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  QSKLQIEQDTKAANAVVITFE--KEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKL 73
           + K++I     + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTEENYDPKDALKMACNNIINKLGILKTNF 105
           RIQT  +    +AL+    ++++   +++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 43/94 (45%)

Query: 12  LDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARF 71
           LD  + +L  E  ++           EDHTLGN +R  ++ + +V F  Y + HP     
Sbjct: 27  LDRDKIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVL 86

Query: 72  KLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            LRIQT       +AL     ++++   +++  F
Sbjct: 87  NLRIQTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLQIEQDTKAANAVVITFE--KEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRI 75
           K++I Q   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTEENYDPKDALKMACNNIINKLGILKTNF 105
           QT       +AL     ++++   +++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%)

Query: 12  LDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARF 71
           LD  + +L  +  ++           EDHTLGN +R  ++ + +V F  Y + HP     
Sbjct: 35  LDRDKIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFL 94

Query: 72  KLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            +RIQT       DAL     ++++   +++  F
Sbjct: 95  NIRIQTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKV 63
           PDR ++ LL +  S     +D   A+       +EDHTLGN +R  ++ ++ V F  Y +
Sbjct: 29  PDREKIKLLPQASS-----EDGTCAS---FQIAEEDHTLGNALRYVIMKNKDVEFCGYSI 80

Query: 64  EHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            HP      LRIQT       D L+    ++++    ++  F
Sbjct: 81  PHPSENLLNLRIQTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAY 61
           + PDR ++ +L +  S    E  T A+  +     +EDHTLGN +R  ++ +  V F  Y
Sbjct: 28  DEPDREKIKILPQATS----EDGTCASFQIA----EEDHTLGNALRYMIMKNPDVEFCGY 79

Query: 62  KVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            + HP      +R+QT  N    D L     ++++    ++  F
Sbjct: 80  SIPHPSENLLNIRVQTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKV 63
           PDR ++ LL +  S      D  +A+       +EDHTLGN +R  ++ + +V F  Y +
Sbjct: 31  PDREKIKLLPQATSD-----DGTSAS---FQISEEDHTLGNALRYIIMKNPEVEFCGYSI 82

Query: 64  EHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            HP      +RIQT       +AL+    ++++    ++  F
Sbjct: 83  PHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%)

Query: 12  LDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARF 71
           +D  + KL  E  ++   +       EDHTLGN +R  ++ + +V F  Y + HP     
Sbjct: 27  VDSEKIKLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFL 86

Query: 72  KLRIQTEENYDPKDALKMACNNIINKLGILKTNF 105
            +RIQT       +AL     ++++    ++  F
Sbjct: 87  HIRIQTYGKITAVEALHKGLGDLMDMCDAVEDRF 120

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 42.0 bits (97), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%)

Query: 35  FEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRIQTEENYDPKDALKMACNNI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+    ++
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  IN 96
           ++
Sbjct: 129 MD 130

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 35  FEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRIQT 77
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQT 115

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 34.7 bits (78), Expect = 0.030,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 41  TLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLG 99
           T G+L+R E  N  K    AY  EHP    +++   TE++++  DA  +  N+I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 4/109 (3%)

Query: 14  EGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVE--HPLFARF 71
           EG  KLQ+ + T A N  ++    +  TLG+++  E    E + F  +  +      + F
Sbjct: 394 EGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDLSEF 453

Query: 72  KLRIQTEENYDPKDALKMACNNIINKL-GILKTNFDTEWNLQTLASDDN 119
           +  IQ E        L+   ++  +KL GILK     ++NLQ  +SD N
Sbjct: 454 RASIQ-EALISLTPHLRKLPSSSKDKLKGILKNLLSDDFNLQEASSDQN 501

>YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative
           maltose-responsive transcription factor
          Length = 470

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 28  ANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRIQT 77
           ANA+V    K DH +     N L +  K +F+     H +F RF  + Q+
Sbjct: 396 ANALVDVVSKYDHNMKLEAWNILCDVSKFVFSLKHCNHKMFQRFSTKCQS 445

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 26  KAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAAYKVEHPLFARFKLRIQT 77
           + ANA+V    K DH +     N L +  K +F+     H +F RF  + Q+
Sbjct: 392 EVANALVDIVNKYDHNMKLEAWNILCDVSKFVFSLKHCNHKMFQRFSTKCQS 443

>Ecym_8355 Chr8 complement(709850..711211) [1362 bp, 453 aa] {ON}
           similar to Ashbya gossypii ADL021W
          Length = 453

 Score = 28.5 bits (62), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/26 (53%), Positives = 16/26 (61%)

Query: 30  AVVITFEKEDHTLGNLIRNELLNDEK 55
           A V  F K D+ LG    NE+LNDEK
Sbjct: 145 ATVDAFAKYDNVLGFFAGNEVLNDEK 170

>ZYRO0C01320g Chr3 (89149..91608) [2460 bp, 819 aa] {ON} similar to
           uniprot|P32497 Saccharomyces cerevisiae YMR309C NIP1
           Subunit of the eukaryotic translation initiation factor
           3 (eIF3) involved in the assembly of preinitiation
           complex and start codon selection
          Length = 819

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 80  NYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           +Y P D  K + N+I+  + IL+ N DT + L  LA  ++F
Sbjct: 320 SYQPVDQWKSSYNDIVKLVTILEQNIDT-YQLSELAPTNDF 359

>NCAS0D02280 Chr4 complement(427826..430252) [2427 bp, 808 aa] {ON}
           Anc_5.9 YMR309C
          Length = 808

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 75  IQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120
           + +  +Y P D  K + N+I+N + IL  NF T + +  LA+   F
Sbjct: 309 VSSTLSYQPIDQWKASFNDIVNLMTILDNNFST-YQVSELAAPAEF 353

>KLLA0E11309g Chr5 complement(993416..994498) [1083 bp, 360 aa] {ON}
           conserved hypothetical protein
          Length = 360

 Score = 28.1 bits (61), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 79  ENYDPKDALKMACNNIINKLGILKTNFDTEWN 110
           E+ DPKD+L + C  +I  LG+   N   + N
Sbjct: 264 EDSDPKDSLSLVCGFVIIFLGVYLLNLSRKKN 295

>TPHA0C00880 Chr3 complement(186826..187494) [669 bp, 222 aa] {ON}
          Anc_8.312 YDR140W
          Length = 222

 Score = 27.3 bits (59), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 8  ELFLLDEGQSKLQIEQDTKAANAVVITFEKEDH--TLGN 44
          +LFL D  ++KL +  +      +V+TF  ++H  T+GN
Sbjct: 32 QLFLKDRFKNKLTVVSEFGPGTGIVLTFMMQNHIPTMGN 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,503,806
Number of extensions: 549163
Number of successful extensions: 1581
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1580
Number of HSP's successfully gapped: 60
Length of query: 120
Length of database: 53,481,399
Length adjustment: 89
Effective length of query: 31
Effective length of database: 43,276,125
Effective search space: 1341559875
Effective search space used: 1341559875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)