Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J004006.29ON1512149567050.0
Kpol_1037.226.29ON1496116334630.0
CAGL0E02475g6.29ON1493138432980.0
ZYRO0C07524g6.29ON1670116632410.0
KLTH0C10956g6.29ON1433134432070.0
NCAS0D021306.29ON1434118430640.0
TDEL0G044006.29ON149085530340.0
KNAG0F029206.29ON1492115830030.0
ACL004W6.29ON1377116129610.0
SAKL0E01540g6.29ON141586529020.0
TBLA0E031606.29ON173985828600.0
KAFR0A051206.29ON147983328530.0
Ecym_30336.29ON147488927720.0
YOL004W (SIN3)6.29ON153685927660.0
Smik_15.1666.29ON156688327470.0
Suva_15.1716.29ON156187227430.0
KLLA0C06182g6.29ON151987927350.0
Skud_15.1586.29ON155598827210.0
NDAI0C026606.29ON165787727170.0
Kwal_56.224626.29ON154199527050.0
CAGL0J11594g6.29ON9373296325e-67
CAGL0D01100g2.264ON806180772.9
CAGL0L11880g8.234ON980187746.9
TPHA0B040101.460ON58349739.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00400
         (1512 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  2587   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1338   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1274   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1253   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1239   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1184   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1173   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1161   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1145   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1122   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1106   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1103   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1072   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1070   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1062   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1061   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1058   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1052   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1051   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1046   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   248   5e-67
CAGL0D01100g Chr4 complement(129293..131713) [2421 bp, 806 aa] {...    34   2.9  
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    33   6.9  
TPHA0B04010 Chr2 (948185..949936) [1752 bp, 583 aa] {ON} Anc_1.4...    33   9.4  

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 2587 bits (6705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1295/1495 (86%), Positives = 1295/1495 (86%)

Query: 1    MSQVWXXXXXXXXXXXXXXTPGPATNAMDVDGNEANKPVVLPSFSKLXXXXXXXXXXXXX 60
            MSQVW              TPGPATNAMDVDGNEANKPVVLPSFSKL             
Sbjct: 1    MSQVWNQSQNSNGSANGSATPGPATNAMDVDGNEANKPVVLPSFSKLNNNSSNGSVNSNA 60

Query: 61   XXXXXXXXXXQTPLHHFPXXXXXXXXXXXXXXXFDNPLPVKTETTPAISAETSIPNVNXX 120
                      QTPLHHFP               FDNPLPVKTETTPAISAETSIPNVN  
Sbjct: 61   NASTSSNTTTQTPLHHFPNSNANVNSNSLSVASFDNPLPVKTETTPAISAETSIPNVNTT 120

Query: 121  XXXXXXXXXXXNDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKS 180
                       NDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKS
Sbjct: 121  YSATAGTTASANDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKS 180

Query: 181  QSIDTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYA 240
            QSIDTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYA
Sbjct: 181  QSIDTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYA 240

Query: 241  KPIPSAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPNITRNKETNAIENVATAA 300
            KPIPSAA                                 IPNITRNKETNAIENVATAA
Sbjct: 241  KPIPSAATNTNVPGPTTSTSPPTAATTTGTTTPVAANTTAIPNITRNKETNAIENVATAA 300

Query: 301  QPSLLPNLGTPSHTEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSY 360
            QPSLLPNLGTPSHTEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSY
Sbjct: 301  QPSLLPNLGTPSHTEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSY 360

Query: 361  VNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAXXXXXXXXXXXXXN 420
            VNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNA             N
Sbjct: 361  VNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDN 420

Query: 421  NNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYYQNNVPTXXXXXXXXXGNVVT 480
            NNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYYQNNVPT         GNVVT
Sbjct: 421  NNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYYQNNVPTAAAAAANAAGNVVT 480

Query: 481  IQSLPPLGNFLPPSXXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQ 540
            IQSLPPLGNFLPPS            LMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQ
Sbjct: 481  IQSLPPLGNFLPPSNKNNNTTAVNNNLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQ 540

Query: 541  STTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXXXXXXXXX 600
            STTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELN                    
Sbjct: 541  STTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQQQQQQQQQ 600

Query: 601  XXXXXXXXXXXXDGGYPQDISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAK 660
                        DGGYPQDISVRPEIDLDPS             DSLSLVEETNFFDKAK
Sbjct: 601  QQQLQMQMQMQMDGGYPQDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAK 660

Query: 661  KFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHI 720
            KFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHI
Sbjct: 661  KFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHI 720

Query: 721  ENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDS 780
            ENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDS
Sbjct: 721  ENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDS 780

Query: 781  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPI 840
            GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPI
Sbjct: 781  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPI 840

Query: 841  GLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWN 900
            GLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWN
Sbjct: 841  GLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWN 900

Query: 901  KVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKS 960
            KVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKS
Sbjct: 901  KVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKS 960

Query: 961  QLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAI 1020
            QLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRD            PLADIKAAI
Sbjct: 961  QLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAI 1020

Query: 1021 KIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSN 1080
            KIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSN
Sbjct: 1021 KIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSN 1080

Query: 1081 DISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLIT 1140
            DISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLIT
Sbjct: 1081 DISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLIT 1140

Query: 1141 LYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTR 1200
            LYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTR
Sbjct: 1141 LYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTR 1200

Query: 1201 LIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDR 1260
            LIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDR
Sbjct: 1201 LIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDR 1260

Query: 1261 SCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEK 1320
            SCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEK
Sbjct: 1261 SCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEK 1320

Query: 1321 WKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKI 1380
            WKYYITSYALSHPTEGVPQEEIQIPFLEKIL           VINDKYSPKGVSQSDLKI
Sbjct: 1321 WKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKI 1380

Query: 1381 KISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQS 1440
            KISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQS
Sbjct: 1381 KISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQS 1440

Query: 1441 LSEDEINNINLKYSHIKKYGSLKNYVVPVVAAIPNKPLENKEKTQEEETPDVANL 1495
            LSEDEINNINLKYSHIKKYGSLKNYVVPVVAAIPNKPLENKEKTQEEETPDVANL
Sbjct: 1441 LSEDEINNINLKYSHIKKYGSLKNYVVPVVAAIPNKPLENKEKTQEEETPDVANL 1495

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1338 bits (3463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 694/1163 (59%), Positives = 834/1163 (71%), Gaps = 68/1163 (5%)

Query: 337  NMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVY 396
            N  Q T +I EKPADVEFSQAVSYVNKIKNRF D+PDIYK FLEILQTYQ+EQKPI EVY
Sbjct: 347  NNIQGTTQI-EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVY 405

Query: 397  SQVTILFQNAXXXXXXXXXXXXXNNNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYEN 456
            +QVT+LFQNA             ++ S   +     Q  A+  QQ     V        N
Sbjct: 406  AQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQPMYGV--------N 457

Query: 457  NTYYQ-NNVPTXXXXXXXXXGNVVTIQSLPPLGNFLPPSXXX------XXXXXXXXXLMG 509
            N YYQ   +P+               Q+LPPLGNF PPS                  +M 
Sbjct: 458  NGYYQAGKIPSAN-------------QNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMA 504

Query: 510  ISSIMHPKVDHIQ--SQQYIADQKQAYTPAQQQSTTQLTNEAMQISELRGSPMMDGQTAR 567
            + S++    +H Q  +QQ+IA                +TNEA+ IS+LR S ++D     
Sbjct: 505  LPSMLQAPTEHAQLHAQQHIA---------------PMTNEAIPISDLR-SQIIDNNHVH 548

Query: 568  NLANVNYSPAELNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGGYPQDISVRPEID 627
            N     Y+P EL                                 +  Y  +  VRPEID
Sbjct: 549  N-----YTPIEL---------AQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEID 594

Query: 628  LDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVN 687
            LDPS             +SLSLVEE NFFDKAKKFI NKQ+Y+EFLKILNLYSQ+IL+++
Sbjct: 595  LDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLD 654

Query: 688  ELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPK 747
            +L+EKV YYLGSNKELFDWFK FVG+QDKPKHIEN+VHEKHKLDLDLCEA GPSYKKLPK
Sbjct: 655  DLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPK 714

Query: 748  TDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFY 807
            TDTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFY
Sbjct: 715  TDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFY 774

Query: 808  IESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELI 867
            IESNLRTIQTLETIASKIANMTEEE+  FKLPIGLGHTS TIYQKVIRKVY KERGFE+I
Sbjct: 775  IESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEII 834

Query: 868  DALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADK 927
            DALHEYP+VAVP++LKRLKQKD+EWRRAQREWNKVWREL+QKV++KSLDHLGLTFKQ+DK
Sbjct: 835  DALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDK 894

Query: 928  KLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTS 987
            KLLTTKQL++EISSIKVDQTNK++HWLTPKPKSQLDY+V D+++L+DIL+L DVFINHTS
Sbjct: 895  KLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTS 954

Query: 988  NYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPLDDTKTDSEESSGDSDKFPKKR 1047
            +YSNPDKERLRD            P+ +IK A++  + +D+ K   E     S K   KR
Sbjct: 955  SYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE--AAIDNGKQLDENEQNSSKKNSNKR 1012

Query: 1048 SIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSATSVDD--DELIRQEAQKPWLLG 1105
               D +I   DIL++ +YQ++K  LD +E     +S   +  D  DE+IRQEA+KPWLLG
Sbjct: 1013 P-RDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLG 1071

Query: 1106 SIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIV 1165
            S+V++ANS G+IQNR  YN+F N N+YVF+R+LIT+Y+RL+E K +N  VT+EI  R +V
Sbjct: 1072 SLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVV 1131

Query: 1166 PFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFK 1225
             FAKDLNL+S QLKNMGLDF G DSY QLL LS RLIEG+LEH WFEESLRQA+RN+AFK
Sbjct: 1132 QFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFK 1191

Query: 1226 LYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTD 1285
            LYTIDKV QS+VKHAH IM+D+K++++M L EKDR  ++T+SKDQILYRLQ RSHMSTT+
Sbjct: 1192 LYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTE 1251

Query: 1286 NMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIP 1345
            +MFRIE+N    +ISIQYI +DDLTL EPKT E+KWKYYITSY+LSHPTEG+PQEEI+IP
Sbjct: 1252 HMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIP 1311

Query: 1346 FLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMN 1405
            FL+K++             N KYSP+GVS+S+L IKI PE Y LE+EPGSFD FSR S+N
Sbjct: 1312 FLDKVIESEQVHMEDEDD-NPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVN 1370

Query: 1406 KYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSLKNY 1465
            K+P+DV S+ YK KK+   +R   FLNGK GWK+ LS D I+ I  K++ +K  G+ +  
Sbjct: 1371 KFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GTFQQR 1429

Query: 1466 VVPVVAAIPNKPLENKEKTQEEE 1488
                 +   + PL   + TQ+E+
Sbjct: 1430 SRSATSETTSVPLNASDSTQKEQ 1452

 Score =  198 bits (503), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 98/101 (97%)

Query: 137 SDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 196
           +D  +YRPLNVKDALTYLEQVKLQF+SRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF
Sbjct: 116 ADGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175

Query: 197 RGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237
           RGYP+LIQGFNTFLPQGYTIEC++NP+DPIKVTTP+GS+ +
Sbjct: 176 RGYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIV 216

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 140 QFYRPLNVK--DALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197
           Q  +P +V+   A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 354 QIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413

Query: 198 GYPSLIQGFNTFLP 211
             P L+  F  FLP
Sbjct: 414 NAPDLLDDFKKFLP 427

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404
           A++Y+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1274 bits (3298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1384 (50%), Positives = 885/1384 (63%), Gaps = 156/1384 (11%)

Query: 136  ESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTL 195
            + D   YRPLNVKDAL+YLEQVK QF +RPDIYN FLDIMKDFKSQ+IDTPGVIERVS+L
Sbjct: 179  QGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSL 238

Query: 196  FRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPIPSAAXXXXXXXX 255
            F+GYP+LIQGFNTFLPQGY IEC+   N+P        ++ I    P+ S+         
Sbjct: 239  FKGYPNLIQGFNTFLPQGYRIECS---NNP--------NDPIKVTTPMGSST-------- 279

Query: 256  XXXXXXXXXXXXXXXXXXXXXXXXXIPNITRNKETNAIENVATAAQPSLLPNLGTPSHTE 315
                                                 + N A    PS          T+
Sbjct: 280  ------------------------------------TVLNTAPQKSPSPSDIQTNNQQTQ 303

Query: 316  VTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIY 375
                E+ +QS A  PI P  H++ Q+     +KPADVEFSQA++YVNKIK RF D+PDIY
Sbjct: 304  AIAQEAQLQSQA-TPI-PTQHDVGQN-FGSAKKPADVEFSQAITYVNKIKTRFADQPDIY 360

Query: 376  KTFLEILQTYQKEQKPIHEVYSQVTILFQNAXXXXXXXXXXXXXNNNSAGAETNQNIQAN 435
            K FLEILQTYQ+EQKPIHEVY+QVTILFQNA             ++ S   ET    Q +
Sbjct: 361  KQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQH 420

Query: 436  AMQYQQLHQNNVAIPQH----IYENNTYYQNNVPTXXXXXXXXXGNVVTIQSLPPLGNFL 491
                      N     +    +     YY+   P           N    Q+LPP+G+F 
Sbjct: 421  YQSLSDKMGGNAEAANYAASGMNAQTGYYE---PVKGGVSYNTQQNQHQQQNLPPIGSFS 477

Query: 492  PPS-------XXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTP-------- 536
            PP+                   +M + S+M+   + ++ Q      KQA++         
Sbjct: 478  PPTNGPFVDQTQQSANPETQKGVMSLPSMMN-NAEAVKEQAI----KQAHSRLISDSHDH 532

Query: 537  -AQQQSTTQ--LTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXX 593
             +QQQ  +Q   +N+ + +S LR +          +   NY P  +              
Sbjct: 533  NSQQQVLSQNIHSNDDIPVSNLRTT----------VVEQNYHPETI-------------- 568

Query: 594  XXXXXXXXXXXXXXXXXXXDGGY---PQDISVRPEIDLDPSXXXXXXXXXXXXXDSLSLV 650
                               DGGY   P ++ VRPEIDLDPS             +SL+L+
Sbjct: 569  -------YQQQGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLM 621

Query: 651  EETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGF 710
            EETNFF++ KK I NKQIY EFLKILNL+S ++L V+ELV+KV+YY+G+NKELFDWFK F
Sbjct: 622  EETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVF 681

Query: 711  VGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWV 770
            VGYQDKPK IENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRD+MCWEVLND+WV
Sbjct: 682  VGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWV 741

Query: 771  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTE 830
            GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQTLETIA+KIANMT+
Sbjct: 742  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTD 801

Query: 831  EERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDE 890
             E+A F+LP GLGHTS+TIY+KVIRKVY KERGFE+IDALH YPA++VPIIL+RLKQKDE
Sbjct: 802  AEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDE 861

Query: 891  EWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKK 950
            EWRRAQREWNK+WR+L+QKVY+KSLDHLGLTFKQADKKLLTTKQLISEI+ IKVDQ +K+
Sbjct: 862  EWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKR 921

Query: 951  LHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXX 1010
            +HWLTPKPK+QLDY   D  IL+DI+ L  VF  +T+ YSNPDKER++D           
Sbjct: 922  IHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFS 981

Query: 1011 XPLADIKAAIKIRSPLDDTKTDSEESSGDSDKFP-------------KKRSIEDDDISFH 1057
             PL ++  A++ R   DD   DS++ SG  D+               KKR   D+D++  
Sbjct: 982  IPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPF-DNDLNMS 1040

Query: 1058 DILDKVKYQKVKQG--LDKNETFSNDISSATSVD--DDELIRQEAQKPWLLGSIVDDANS 1113
            DIL K K QK K    +D +++ S D+ +  +V   +D     E +K WL+G +VD AN 
Sbjct: 1041 DILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANK 1100

Query: 1114 LGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNL 1173
               + NR+ YN+F NTNIY+F RHL+TLYERL+E KQ+N E+ +EIK+R +  FAKDL L
Sbjct: 1101 ETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGL 1160

Query: 1174 VSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVT 1233
            +STQL  +GLDF  +D+Y+QLL LS RLIEG++EH WFEES+RQA+ N+AFKLYTIDKV 
Sbjct: 1161 ISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVV 1220

Query: 1234 QSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFN 1293
            QS VKHAHT++SD+KT+EIM+L E  R+   T++KDQILYR+Q RSHMS+T+NMFRIE+ 
Sbjct: 1221 QSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYK 1280

Query: 1294 KSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXX 1353
            +   + SIQYI +DDLTL   K+ EE W YY+TSY+LS+PTEGVP E +++PFLEK++  
Sbjct: 1281 REKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEF 1340

Query: 1354 XXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTS 1413
                       N  YS  G+S+S+L I I  E Y L ++ GS D +SR ++ KYPI V S
Sbjct: 1341 DQEYSKDNGN-NSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPI-VAS 1398

Query: 1414 DDYK----NKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSLKNYVVPV 1469
            D+ +    ++K   I +V +  +G        S D++N    K+++I   G++  YV   
Sbjct: 1399 DESRAANISEKTQEIRKVLSHYDGN-------SNDDVNE---KFNYILANGTIDGYVRQS 1448

Query: 1470 VAAI 1473
             A +
Sbjct: 1449 AAVV 1452

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1166 (55%), Positives = 808/1166 (69%), Gaps = 57/1166 (4%)

Query: 314  TEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPD 373
            + V+      Q    AP+QP + + T+       K ADVEFSQA+SYVNKIKNRF D+PD
Sbjct: 489  SAVSSGTGPTQPEVPAPVQPQLADQTK-------KAADVEFSQAISYVNKIKNRFSDQPD 541

Query: 374  IYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAXXXXXXXXXXXXXNNNSAGAETNQNIQ 433
            IYK FLEILQTYQ+EQKPI+EVY+QVT+LFQNA             +++++ A+  +   
Sbjct: 542  IYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLP-DSSASAAQQQRQQL 600

Query: 434  ANAMQYQQLHQNNVAIPQHIYENNTYYQNNVPTXXXXXXXXXGNVVTIQSLPPLGNFLPP 493
               MQ+QQ                 YY  N P             V  Q+LPPLG+F PP
Sbjct: 601  QPVMQHQQAAAAT---------GYGYYGENQP-------------VARQNLPPLGSFSPP 638

Query: 494  SXXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQSTTQLTNEAMQIS 553
                           G++    P + H+++Q          TP+    T  ++N+A+ +S
Sbjct: 639  PNGTAPRDYYQEPSQGMAL---PPMTHLETQ------AAKVTPSHYVMTQGMSNDAIPLS 689

Query: 554  ELR----GSPMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 609
             +R    G+P    QT    A  +                                    
Sbjct: 690  NMRSPTVGAP--GAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPPQQQEQSLPPQTIPLT 747

Query: 610  XXXDGGYPQ-----DISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFIN 664
                 G  Q     DI+VRPEIDLDPS             DSLSLVEET+FFDKAKKFI 
Sbjct: 748  QPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIG 807

Query: 665  NKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIV 724
            NKQ+Y EFLKILNLYSQ++L+++ LVEKV++YLG +KELF WFK FVGYQD+PK+IEN++
Sbjct: 808  NKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVI 867

Query: 725  HEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIA 784
            HEKH+LDLD+CEA GPSYKKLPK+DTFMPCSGRDEMCWEVLND+W+GHPVWASEDSGFIA
Sbjct: 868  HEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIA 927

Query: 785  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGH 844
            HRKNQYEETLFK+EEERHEYDFYIESNLRTIQTLETIASKIANMTEEE+ANFKLP GLGH
Sbjct: 928  HRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGH 987

Query: 845  TSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWR 904
            TS+TIY+KVIRKVY KERGFE+IDALHE+PAVAVP++LKRLKQKDEEWRRAQREWNKVWR
Sbjct: 988  TSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWR 1047

Query: 905  ELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDY 964
            EL+QKVY+KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK++HWLTPKPKSQLDY
Sbjct: 1048 ELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDY 1107

Query: 965  KVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRS 1024
               DR+I  DIL LT+VF+NHT NYSN DKERL+D            P++++   ++ RS
Sbjct: 1108 DFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRS 1167

Query: 1025 PLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISS 1084
            P +  + ++ +    +     KR  E  ++   DIL + KYQK+K   D  E        
Sbjct: 1168 PSNKEEHEANKKENGTALAHGKRPRE-IELPLRDILHRNKYQKLKLRSDGEEGSIGQSEE 1226

Query: 1085 A-----TSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLI 1139
                     +++E+I+QEA+KPWLLG+IV++AN+ GII NR  +N+F NT+IYVF RHL 
Sbjct: 1227 GLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLT 1286

Query: 1140 TLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLST 1199
            TLYERL E K ++ EVT+EI +R +  FAKDLNL+S QLKNMGLDF G D+Y+QLL LS 
Sbjct: 1287 TLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSK 1346

Query: 1200 RLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKD 1259
            RLIEG++EH WFEESLRQA+ N+AFK YT+DKV Q++VKHAHTI++D K +EIM+L EKD
Sbjct: 1347 RLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKD 1406

Query: 1260 RSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEE 1319
            R+ ATTS+KDQILYR+QARSHMS T+NMFRIEFN+ S ++ IQYI +DDLTL E K+ E+
Sbjct: 1407 RTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLED 1466

Query: 1320 KWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLK 1379
            KWKYY+TSY+LSHPTEG+  E++Q+PFLEKI+             + K+SP+GVS+S L+
Sbjct: 1467 KWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGG-DPKFSPEGVSKSSLR 1525

Query: 1380 IKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQ 1439
            IKI PE Y LE+EPGS D FSR ++NK+P++  S+ +K K     + +  +L+ + GWK+
Sbjct: 1526 IKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKK 1585

Query: 1440 SLSEDEINNINLKYSHIKKYGSLKNY 1465
            +L    I ++  K + +K YG+L+ Y
Sbjct: 1586 NLDAKSIQSVEEKLNFVKNYGTLQGY 1611

 Score =  189 bits (481), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/146 (61%), Positives = 108/146 (73%), Gaps = 2/146 (1%)

Query: 94  FDNPLPVKTETTPAISAE--TSIPNVNXXXXXXXXXXXXXNDSKESDEQFYRPLNVKDAL 151
           FDNPLP    + P++  +  +S                         +Q+YRPLNVKDAL
Sbjct: 227 FDNPLPPSQPSVPSLHYQMLSSQQQQEQKGQDQQQQHQQQQQQIPLHDQYYRPLNVKDAL 286

Query: 152 TYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFLP 211
           +YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLFRGYP+LIQGFNTFLP
Sbjct: 287 SYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTFLP 346

Query: 212 QGYTIECTNNPNDPIKVTTPIGSETI 237
           QGY I+C+ NP++PIKVTTP+GS T+
Sbjct: 347 QGYRIDCSQNPDEPIKVTTPMGSSTV 372

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +FS +PDIY HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 210 LP 211
           LP
Sbjct: 585 LP 586

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LF+ 
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1239 bits (3207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1344 (49%), Positives = 863/1344 (64%), Gaps = 131/1344 (9%)

Query: 142  YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
            YRPLN KDAL+YLEQVK QF++RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP 
Sbjct: 142  YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPI 201

Query: 202  LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPY--AKPIPSAAXXXXXXXXXXXX 259
            LIQG NTFLPQGY IECT NPNDP  +       T P+  A+ +  A             
Sbjct: 202  LIQGLNTFLPQGYKIECTLNPNDPHSIKV-----TTPFDNARELNLATMATGNGIVEGHP 256

Query: 260  XXXXXXXXXXXXXXXXXXXXXIPNITRNKETNAIENVATAAQPSLLPNLGTPSHTEVTKS 319
                                  P   + K  NA  N+     P+   N   P H +  + 
Sbjct: 257  SLMPSDDVSPPKLVGHE-----PAAVQPKLENAPTNLPV---PTTF-NQNLPQHEQQNQ- 306

Query: 320  ESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFL 379
                Q  + +P  P      Q  M       DVEFS A+SYVNKIK RF D+P+IYK FL
Sbjct: 307  ----QHGSQSPAMPQQQRQDQQFMG-NRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFL 361

Query: 380  EILQTYQKEQKPIHEVYSQVTILFQNA--------------XXXXXXXXXXXXXNNNSAG 425
            EILQTYQ+EQKPIHEVY+QVT LFQNA                                 
Sbjct: 362  EILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQQ 421

Query: 426  AETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYYQNNVPTXXXXXXXXXGNVVTIQSLP 485
                Q IQ +   YQ   Q+     QH ++    + N VP                Q+LP
Sbjct: 422  QLQQQQIQQHQSHYQNASQDLDQRQQHTHQP---FGNTVPFYQTQQGRP-------QNLP 471

Query: 486  PLGNFLPPSXXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQSTTQL 545
            PLG+F PP              + + ++  P ++        A Q+  + P+       +
Sbjct: 472  PLGSFSPPINGRENDPQ-----LNLPAVQPPAME-------FASQQVPHHPSHVVPQV-I 518

Query: 546  TNEAMQISELRGSPMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXXXXXXXXXXXXXX 605
                + +S+LRG+  MDG         N++P  L                          
Sbjct: 519  PGGTLPLSDLRGA--MDG---------NFAPQPLQS------------------------ 543

Query: 606  XXXXXXXDGGYPQDI-----SVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAK 660
                        QD+     + RPEIDLDPS             + L+L+EET+FFD+AK
Sbjct: 544  ------------QDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAK 591

Query: 661  KFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHI 720
            K++ NKQ+Y EFLKILNL+SQ+++   ELV+KV++YLG + ELFDWFK FV Y +KPKHI
Sbjct: 592  KYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHI 651

Query: 721  ENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDS 780
            EN++HEKH+LDLDLCEA  PSYKKLPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDS
Sbjct: 652  ENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS 711

Query: 781  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPI 840
            GFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETIA+KI+NMT EE+  FKLP 
Sbjct: 712  GFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPP 771

Query: 841  GLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWN 900
            GLGHTS+TIY+KVIRKVY K+RGFE+IDALHE PAV+VPIILKRLKQKDEEWRRAQREWN
Sbjct: 772  GLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWN 831

Query: 901  KVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKS 960
            KVWREL+QKV+YKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQTNK+++  TPKPKS
Sbjct: 832  KVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKS 891

Query: 961  QLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAI 1020
            QLDY + D+ +L+DIL L + FI+H+S YSNPDKE+L                  +  +I
Sbjct: 892  QLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKL---------AAFFKGFLSVFFSI 942

Query: 1021 KIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSN 1080
              +   + T  DS+  S  +   P+KR  E +      +  K K+ K +    ++++ S+
Sbjct: 943  SYQEIENSTPADSDAVSNSN---PRKRLWESEQPLKELLRSKHKHHKKRDTSAEDDSISD 999

Query: 1081 DIS----SATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIR 1136
            D +    S   ++D+E+IRQEA+KPWLLG+I+D+AN  G + NR  +N+F NTN+YVF R
Sbjct: 1000 DQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFR 1059

Query: 1137 HLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLD 1196
            HL T+Y+RL+E K MN EVT EI +R++V FAKDLNLVSTQL +MGLDF+G D+Y QLL 
Sbjct: 1060 HLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLT 1119

Query: 1197 LSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLM 1256
            L  RLI  +++H WFEESLRQA++NKAFK+YT+DKV QS+VKHAH+I++D K+AEIM+L 
Sbjct: 1120 LCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILF 1179

Query: 1257 EKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKT 1316
            EKDR C  TS+K+QILYRLQ RS+M  T+NMFR+E NK S ++ IQY+ +DDLTL EP++
Sbjct: 1180 EKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPES 1239

Query: 1317 AEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQS 1376
             +++W YY+TSYALSHPTEG+P EEI++PFLEK L             +++ SP G S S
Sbjct: 1240 LKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEG----SEERSPSGHSLS 1295

Query: 1377 DLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFG 1436
            +L+I+++PE+Y L+IEPGS D F+R ++N++     ++   + K+     + + L+G  G
Sbjct: 1296 NLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRG 1355

Query: 1437 WKQSLSEDEINNINLKYSHIKKYG 1460
            WK+ +S++ ++      ++++ +G
Sbjct: 1356 WKKGMSQELVDKTLTALNYVRLHG 1379

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1184 (54%), Positives = 795/1184 (67%), Gaps = 114/1184 (9%)

Query: 309  GTPSHTEVTKSESVIQSSAN--APIQPNMHNMTQDTMKITEKP---------ADVEFSQA 357
            G P+    + SES +Q   +  +P  P++   T       + P         A+VEFSQA
Sbjct: 304  GGPAMEAPSSSESNLQQQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEFSQA 363

Query: 358  VSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAXXXXXXXXXXX 417
            ++YVNKIKNRF D+PDIYK FLEILQTYQ+EQKPI+EVYSQVT+LFQ+A           
Sbjct: 364  INYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFL 423

Query: 418  XXNNNSAGAETNQNIQANAMQYQQLHQNNVAIP-------QHIYENNTYYQNNVPTXXXX 470
                 S+G  +   +  NA   Q+      AIP       Q+ Y NN YY N   T    
Sbjct: 424  PE---SSGTTSTSELPQNAGIQQR-----AAIPTPNPKHQQYGYPNN-YYPNGTGTQ--- 471

Query: 471  XXXXXGNVVTIQSLPPLGNFLPPSXXXXXXXXXXXXLMGISSI--MHPKVDHIQSQQYIA 528
                       Q+LPP+G+F PP+             +G   +  M P  D    QQ   
Sbjct: 472  -----------QNLPPIGSFAPPNGTASREYAPGNQFVGPGGLPSMIPN-DQALQQQQQP 519

Query: 529  DQKQAYTPAQQQSTTQLTNEAMQISELRGSPMMDGQTARNLANVN--YSPAELNXXXXXX 586
                 YT           NEA+ +S LR SP+ D Q   NL N+    +P +++      
Sbjct: 520  GLVHGYT-----------NEAIPVSNLR-SPLTDQQYP-NLLNMQNQMTPGQMDINNATA 566

Query: 587  XXXXXXXXXXXXXXXXXXXXXXXXXXDGGYPQDISVRPEIDLDPSXXXXXXXXXXXXXDS 646
                                         Y  +  +RPEIDLDPS              +
Sbjct: 567  PMAQQ------------------------YTNEAPIRPEIDLDPSIVPVIPEPTEPLEYN 602

Query: 647  LSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDW 706
            +SLVEETNFF+KAKKFI  KQ+Y EFLKILNLYSQ++L  +EL  KV+YYLGSN+ELF W
Sbjct: 603  VSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTW 662

Query: 707  FKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLN 766
            FK FVG+Q+KP  IENIVHEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRDEMCWEVLN
Sbjct: 663  FKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLN 722

Query: 767  DDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIA 826
            D+WVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQTLETIA+KI 
Sbjct: 723  DEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIG 782

Query: 827  NMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLK 886
            NMT EE+ NFKLP GLGHTS TIY+KVIRKVY K+RGFE+ID LHE PA+ VP++LKRLK
Sbjct: 783  NMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLK 842

Query: 887  QKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ 946
            QKDEEWRRAQREWNKVWREL+QKVYYKSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQ
Sbjct: 843  QKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQ 902

Query: 947  TNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXX 1006
            TNK++HWLTPKPKSQL+++  D  I  DIL LT VFINH+S YSNP+KER++D       
Sbjct: 903  TNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVS 962

Query: 1007 XXXXXPLADIKAAIKIRSP-LDDTKTDSEESSGDSD---------KFPKKRSIEDDDISF 1056
                 PL  +  A+  RS  L + +  ++ESS + D            KKR + + DI  
Sbjct: 963  LFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPL-NIDIPL 1021

Query: 1057 HDILDKVKYQKV-KQGLDKNETFSNDISSATSV----------DDDELIRQEAQKPWLLG 1105
             DIL K KYQK+ KQ  + NE  + +      V          D++E+I +E ++PWLLG
Sbjct: 1022 ADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLG 1081

Query: 1106 SIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIV 1165
            +I++ A++ G I NR  +N+F NTNIYVF R    +YERL E KQ+N +VT+E+ +R I 
Sbjct: 1082 NIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRIS 1141

Query: 1166 PFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFK 1225
             FAKDLNL+STQLK+MGLDF G +SY++LL LS RLI+ ++EH WFEESLRQAF NKAFK
Sbjct: 1142 QFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFK 1201

Query: 1226 LYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTD 1285
            LYT+DKV QS+VKHAHTI+ D KT+EIM+L EKDR C++TS+K+QILYRLQ R+HM+ T+
Sbjct: 1202 LYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTE 1261

Query: 1286 NMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIP 1345
            NMFRIEFN+  +++ IQYI ++DLT+ +PK+ E+ W+YY+TSY+L HPTEGVPQ+E++IP
Sbjct: 1262 NMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIP 1321

Query: 1346 FLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMN 1405
            FLEK L             ++K SP+GVS S LKIKI P++YALEIEPGSFD FSR SMN
Sbjct: 1322 FLEKTLELEVDEEG-----DNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMN 1376

Query: 1406 KYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNI 1449
             YP    SD+ K +K  SID++  FL+GK GWK++L+  +  NI
Sbjct: 1377 VYP--TYSDETKKRK--SIDQMTKFLDGKNGWKKNLTTADSTNI 1416

 Score =  178 bits (451), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (90%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK QFS RPDIYN FLDIMKDFKSQSIDTPGVIERVS LFRGYP 
Sbjct: 207 YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237
           L+QGFNTFLPQGY IECT +P+ PI+VTTP+G+ T+
Sbjct: 267 LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTL 302

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 39/64 (60%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A+ Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 210 LPQG 213
           LP+ 
Sbjct: 423 LPES 426

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404
           A+SY+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1173 bits (3034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/855 (65%), Positives = 679/855 (79%), Gaps = 4/855 (0%)

Query: 613  DGGYPQDISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEF 672
            DG Y  DI+VRPEIDLDPS             DSL+LVEET+FFD+AKKFI NKQIY EF
Sbjct: 580  DGQY-LDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEF 638

Query: 673  LKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDL 732
            LKILNL+SQ++L+V+ELV +V++YLG NKELF WFK FVG+QDKPKHIENIVHEKH+LDL
Sbjct: 639  LKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDL 698

Query: 733  DLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEE 792
            DLCEA GPSYKKLPK+DTFMPCSGRDEMCW VLND+WVGHPVWASEDSGFIAHRKNQYEE
Sbjct: 699  DLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEE 758

Query: 793  TLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQK 852
            TLFKIEEERHEYDFYIESNLRTIQTLETIASKIANM+EEE+A FKLP GLGHTS+TIY+K
Sbjct: 759  TLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKK 818

Query: 853  VIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYY 912
            VIRKVY KERGFE+IDALHEYPA+AVP++LKRLKQKDEEWRRAQREWNKVWREL+QKVYY
Sbjct: 819  VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYY 878

Query: 913  KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQIL 972
            KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLDY V D+ + 
Sbjct: 879  KSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVF 938

Query: 973  YDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPLDDTKTD 1032
            +DIL LTD FINH S+YSNPDK RL+D            P+ ++  A+  R  LDD K D
Sbjct: 939  FDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKED 998

Query: 1033 SEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVK-QGLDKNETFSNDISSATSVDDD 1091
            S +   +SD     +   +D+IS  ++L + K Q+ K +  D+    S         +++
Sbjct: 999  STQKM-ESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADETSEESAAEPEPELNEEE 1057

Query: 1092 ELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQM 1151
            E IRQEA+KPWLLG++V++ N+ G+I NR  +N+F NTNIYVF RHL TLYERL E K+M
Sbjct: 1058 ETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKM 1117

Query: 1152 NAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWF 1211
            N  VT+EI +R +V FAKDLNL+S QLK MGLDFEG D+Y+QL  L  RLIEG++EH WF
Sbjct: 1118 NDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWF 1177

Query: 1212 EESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQI 1271
            EESLRQA+ NKAFKLYT+DKV QS+VKHAHTI++D+KT+EIM   EKDR+   TS+KDQI
Sbjct: 1178 EESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQI 1237

Query: 1272 LYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALS 1331
            LYRLQ RS+MS+T+NMFRIE+NK S N+ IQ+I +DDLTL EP++ EEKW+YY+TSY+LS
Sbjct: 1238 LYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLS 1297

Query: 1332 HPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVIN-DKYSPKGVSQSDLKIKISPENYALE 1390
            HPTEG+ QEE+Q+PFLEK+L             + DK+SP+GVS+S LKIKI PE Y L+
Sbjct: 1298 HPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLD 1357

Query: 1391 IEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNIN 1450
            IE GS+D FSR S+N++P+ V S+DY  KK+   + V  FL  K GWK++L +D++  I 
Sbjct: 1358 IEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQ 1417

Query: 1451 LKYSHIKKYGSLKNY 1465
             K + +K+ GSL ++
Sbjct: 1418 EKLARVKENGSLDDF 1432

 Score =  184 bits (467), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 107/144 (74%), Gaps = 5/144 (3%)

Query: 94  FDNPLPVKTETTPAISAETSIPNVNXXXXXXXXXXXXXNDSKESDEQFYRPLNVKDALTY 153
           FDNPLP + +T  + S    +P                   +   + +YRPLNVKDAL+Y
Sbjct: 148 FDNPLPPQQQTILSSSHFQVLP-----PHQQQQEQQQQMQQQMQHDAYYRPLNVKDALSY 202

Query: 154 LEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFLPQG 213
           LEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVI+RVSTLF+GYP LIQGFNTFLPQG
Sbjct: 203 LEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQG 262

Query: 214 YTIECTNNPNDPIKVTTPIGSETI 237
           Y IEC+ NP++PI+VTTP+GS ++
Sbjct: 263 YRIECSANPDEPIRVTTPMGSSSV 286

 Score =  105 bits (263), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/78 (66%), Positives = 64/78 (82%), Gaps = 1/78 (1%)

Query: 330 PIQPNMHNMTQ-DTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKE 388
           P+QP     +Q  +    +K ADVEFSQA++YVNKIKNRF ++PDIYK FLEILQTYQ+E
Sbjct: 357 PLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416

Query: 389 QKPIHEVYSQVTILFQNA 406
           QKPI+EVY+QVT+LFQNA
Sbjct: 417 QKPINEVYAQVTVLFQNA 434

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A+ Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 210 LP 211
           LP
Sbjct: 445 LP 446

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LF+ 
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1158 (52%), Positives = 772/1158 (66%), Gaps = 72/1158 (6%)

Query: 311  PSHTEVTKSESVIQSSANAPIQPNMH--------NMTQDTMKI-----TEKPADVEFSQA 357
            P+  ++  ++S IQ+S   P   ++H           Q +  +      +K  DVEFSQA
Sbjct: 325  PAIGQLPTTQSPIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKANDVEFSQA 384

Query: 358  VSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAXXXXXXXXXXX 417
            +SYVNKIKNRF D+PDIYK FLEILQTYQ+EQKPI+EVY+QVT+LF NA           
Sbjct: 385  ISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFL 444

Query: 418  XXNNNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYY---QNNVPTXXXXXXXX 474
              ++ S   +  Q+  +      Q++        ++Y N   Y   Q N P         
Sbjct: 445  PDSSASNEQQPKQSPYS-----PQVYSGADMARGYMYNNTGVYYPPQVNQPQ-------- 491

Query: 475  XGNVVTIQSLPPLGNFLPPSXXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAY 534
                    +LPP+G+F PP+              G++      + H   Q  +A      
Sbjct: 492  -------SNLPPIGSFSPPAN-------------GVAPTTGTAIPHADEQHVVAGVPAMA 531

Query: 535  TPAQQQSTTQLTNEAMQISELRGSPMMDGQTARNLANVNY-SPAELNXXXXXXXXXXXXX 593
               QQ + + + N+ +QIS +RG     G T   L      SP +               
Sbjct: 532  PHEQQHAPSMINNDGIQISNMRG-----GGTVPALNQYGMISPHDYTQQQAKQVQQFQED 586

Query: 594  XXXXXXXXXXXXXXXXXXXDGGYPQDISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEET 653
                                     D+ VRPEIDLDPS             ++LSL EET
Sbjct: 587  QQQQQQQSMMMDEQYGSG-------DMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEET 639

Query: 654  NFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGY 713
            +FF+K KK I N+QIY+EFLK+LNL+SQ+++ V+ELV KV+ YL    ELF+WFK FVGY
Sbjct: 640  SFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGY 699

Query: 714  QDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHP 773
            QDKPK IEN++HEKH+LDLDLCEAYGPSYKKLPK+DTFMPCSGRD+MCWEVLND+WVGHP
Sbjct: 700  QDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHP 759

Query: 774  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEER 833
            VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEE+
Sbjct: 760  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK 819

Query: 834  ANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWR 893
              FKLP GLGHTS+TIY+K+IRKVY KERGFE+ID LHE+PA+ VPI+LKRLKQKDEEWR
Sbjct: 820  NMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWR 879

Query: 894  RAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHW 953
            RAQREWNKVWREL+QKVY+KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ NK++HW
Sbjct: 880  RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHW 939

Query: 954  LTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPL 1013
            LTPKPK QLDY+  D  I++DI+ LTDVF++H S YSNPDKERL+D            P 
Sbjct: 940  LTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPR 999

Query: 1014 ADIKAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVK--QG 1071
              I AA+  +S    +     E + DS    KKR   D ++S  DIL + KYQK+K  +G
Sbjct: 1000 DLISAALDTKSDEGKSTDTKFEKADDS----KKRPRPDVELSLSDILHRAKYQKLKNGEG 1055

Query: 1072 LDKNETFSNDISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNI 1131
            L  +E   +D     + + +E+  + A KPWL+G IV+ ANS G++ +R+ YN+FGNTN+
Sbjct: 1056 LGMSE---DDDEEKLAKEAEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNV 1112

Query: 1132 YVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSY 1191
            Y+FIRH  TLY RL E KQM+  VT+EI NR +V FA+DLNL+STQL++MGLDF+G ++Y
Sbjct: 1113 YIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAY 1172

Query: 1192 KQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAE 1251
            ++ L LS RLI   LEH WFEESLRQA+ NKAFKLYT+DKV  S+VKHAHT+M+D K++E
Sbjct: 1173 QETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSE 1232

Query: 1252 IMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTL 1311
            +M L EKDR  ++T  KDQILYRL  RSHMS+T+NMFR+++NK + ++SIQYIG+DD+TL
Sbjct: 1233 LMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTL 1292

Query: 1312 GEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPK 1371
             + K   E+W YY+TSYAL HPTEG+ Q+++ +PFLE+IL             +D+Y+P 
Sbjct: 1293 EDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERIL-EFENDMLDVEAGSDRYNPV 1351

Query: 1372 GVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFL 1431
            G S S LKI I P+ Y L I+ GS+D FSR S+N+YPI   S  Y    +   +    FL
Sbjct: 1352 GTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFL 1411

Query: 1432 NGKFGWKQSLSEDEINNI 1449
            +G+FGWK+ LS+D IN +
Sbjct: 1412 DGRFGWKKDLSDDVINTV 1429

 Score =  177 bits (448), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 79/92 (85%), Positives = 89/92 (96%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVKLQF+SRP IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+G+P+
Sbjct: 218 YRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPA 277

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIG 233
           LIQGFNTFLPQGY IEC++NPN+PIKVTTP+G
Sbjct: 278 LIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG 309

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 99  PVKTETTPAISAETSIPNVNXXXXXXXXXXXXXNDSKESDEQFYRPLNVKDALTYLEQVK 158
           P++    P  SA   +P+               N   E++ +    +    A++Y+ ++K
Sbjct: 336 PIQASLPPPQSAHLHLPST---VAAATTVQQSANVHAENEPKKANDVEFSQAISYVNKIK 392

Query: 159 LQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFLP 211
            +FS +PDIY +FL+I++ ++ +      V  +V+ LF   P L+  F  FLP
Sbjct: 393 NRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLP 445

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F   P IY  FL+I++ ++ +      V  +V+ LF+ 
Sbjct: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/1161 (51%), Positives = 765/1161 (65%), Gaps = 112/1161 (9%)

Query: 321  SVIQSSANAPIQPNMHNMTQDTMKITEKPA-DVEFSQAVSYVNKIKNRFVDEPDIYKTFL 379
            +V +S+  +P        TQ+      K A DVEFS A+SYVNKIK RF ++PDIYK FL
Sbjct: 252  TVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFL 311

Query: 380  EILQTYQKEQKPIHEVYSQVTILFQNAXXXXXXXXXXXXXNNNSAGAETNQNIQANAMQY 439
            EILQTYQ+EQKPI+EVY+QVT+LFQNA                           ++A Q 
Sbjct: 312  EILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLP--------------DSSAPQL 357

Query: 440  QQLHQ-NNVAIPQHIYENNTYYQNNVPTXXXXXXXXXGNVVTIQSLPPLGNFLPPSXXXX 498
            Q   Q N   +        +  Q  +P            ++  Q+LPPLGNF  P     
Sbjct: 358  QSHQQINGAMVAPGFGHAQSGLQQALPGTQP--------LMHQQNLPPLGNFSTPGDHHP 409

Query: 499  XXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQSTTQLTNEAMQISELRGS 558
                     M + S+  P V   Q Q            +    T  ++N+ + +S+LRG+
Sbjct: 410  ---------MSLPSVQGPNVGLSQGQ------------SGHIVTQGVSNQHIPVSDLRGA 448

Query: 559  PMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGGYPQ 618
            P           + ++  +E N                                     Q
Sbjct: 449  P-----------DASFRASEYNQV-----------------------------------Q 462

Query: 619  DI-----SVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFL 673
            D+     +VRPEIDLDPS             D L+LVEE  FFDKAKKFI NKQIY EFL
Sbjct: 463  DVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFL 522

Query: 674  KILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLD 733
            KILNLYSQ++L   +LVE V +YL  + ELFDWFK FVGYQ++PKHIEN++HEKH+LDLD
Sbjct: 523  KILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLD 582

Query: 734  LCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEET 793
            LCEA GPSYK+LPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAHRKNQYE+T
Sbjct: 583  LCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDT 642

Query: 794  LFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKV 853
            LFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EE+A FKLP GLGHTSVTIY+KV
Sbjct: 643  LFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKV 702

Query: 854  IRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYK 913
            IRKVY K+RGFE+IDALHE+PA+ VP++LKRLKQKDEEWRRAQREWNKVWREL+QKV+YK
Sbjct: 703  IRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYK 762

Query: 914  SLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILY 973
            SLDHLGLTFKQADKKLLT KQLISEISSIKVDQ+NK++H LTPK KSQL Y   + ++  
Sbjct: 763  SLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQ 822

Query: 974  DILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPL------- 1026
            DIL L  VF+ + + YS  D ERL+D            PL +I+  +  RS         
Sbjct: 823  DILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHG 882

Query: 1027 DDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSAT 1086
            DDT+   E+   +     +KR  +D +    DIL + K QKV +G  +N+  S +    +
Sbjct: 883  DDTRKSKEDPKTEKHS-ARKRVRDDTEHLLRDILYRNKQQKVNKG-PQNDQSSEEFEKES 940

Query: 1087 SVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLN 1146
             +++ E++RQEA+KPWLLGSIVD+A++ G + +R  +N+F NTNIYVF RHL T+YERL 
Sbjct: 941  DIEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLV 1000

Query: 1147 EAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNL 1206
            E K++N EVT+EI NR +V FAKDLNL+STQL +MGLDF+G D+Y++LL LS  LI G L
Sbjct: 1001 EVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGEL 1060

Query: 1207 EHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTS 1266
            EH WFEESLRQA++NKAFKLYTIDKV Q++VKHAHTI+ D KT EIM+L + DR+  +TS
Sbjct: 1061 EHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTS 1120

Query: 1267 SKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYIT 1326
            +KDQILYRLQ RS+MS  +NMFRIE+N ++ + SIQ++ ++DLTL EPK+  +KW+YY+T
Sbjct: 1121 TKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLT 1180

Query: 1327 SYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPEN 1386
            SY+LSHPTEG+  + ++ PFLEKI+             +++YSP+GV+ S++K+KI P  
Sbjct: 1181 SYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDG---DERYSPEGVASSNMKVKIDPLT 1237

Query: 1387 YALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRV-NAFLNGKFGWKQSLSEDE 1445
            Y++E+EPG  D FSR S+NK+P  V   D K KK   +  V   FLNG+ GWK+ L+   
Sbjct: 1238 YSMEVEPGCHDIFSRKSVNKFPTRV---DVKKKKSAELKLVLEGFLNGERGWKRGLTTKR 1294

Query: 1446 INNINLKYSHIKKYGSLKNYV 1466
                  +  ++K  G+L +Y 
Sbjct: 1295 TAEAERRLEYVKNNGTLDDYA 1315

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/97 (83%), Positives = 88/97 (90%)

Query: 138 DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197
           D   YRPLNVKDAL+YLEQVK QFSSRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF 
Sbjct: 125 DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184

Query: 198 GYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGS 234
           GYP+LIQGFNTFLP GY IEC ++PNDPIKVTTP G+
Sbjct: 185 GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 210 LP 211
           LP
Sbjct: 349 LP 350

 Score = 36.2 bits (82), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LF  
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHG 185

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 145 LNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQ 204
           LN+ +  T+ ++ K +F     IY  FL I+  +    ++   ++E VS    G P L  
Sbjct: 496 LNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFD 554

Query: 205 GFNTFLPQGY 214
            F +F+  GY
Sbjct: 555 WFKSFV--GY 562

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/865 (63%), Positives = 673/865 (77%), Gaps = 21/865 (2%)

Query: 613  DGGYPQDIS-----------VRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKK 661
            DG Y  D+             RPEIDLDPS             + +SLVEET+FFDKAKK
Sbjct: 494  DGAYRSDLRNSGEVQYMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKK 553

Query: 662  FINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIE 721
            FI NKQIY EFLKILNLYSQ++L+ +ELVEKV+YYLG NKELFDWFK FVGY+ KPKHIE
Sbjct: 554  FIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIE 613

Query: 722  NIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSG 781
            NIVHEKH+LDLDLCEA GPSYKKLPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSG
Sbjct: 614  NIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 673

Query: 782  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIG 841
            FIAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EE+A FKL  G
Sbjct: 674  FIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPG 733

Query: 842  LGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNK 901
            LGHTSVTIY+KVIRKVY K+RGFE+IDALHE P++AVPI+LKRLKQKDEEWRRAQREWNK
Sbjct: 734  LGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNK 793

Query: 902  VWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQ 961
            VWREL+QKVYYKSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NK++H LTPKPKSQ
Sbjct: 794  VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQ 853

Query: 962  LDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIK 1021
            LDY   DR++LYDIL L  VFI+  + YSNPDKE++ D            P+ +++ A  
Sbjct: 854  LDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFA 913

Query: 1022 IRSPLDDTKTDSEESSG-DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSN 1080
             R   D    D EE+SG ++    +KR+ E++++   D+L + KYQK +   ++      
Sbjct: 914  RRRG-DIGVQDGEENSGQENSDLSRKRTREEENL-LKDVLRRNKYQKGRNFAEEEPIPEE 971

Query: 1081 DISS---ATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRH 1137
               +       +++E+IRQEA+KPWLLGSIVD+AN  G ++NR  +N+F NTNIYVF RH
Sbjct: 972  SEFAEKTVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRH 1031

Query: 1138 LITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDL 1197
            L TLY RL+E K +N  VTEEIKNR +V FAKDLNL+STQL +MGLDFEG D+Y Q+L L
Sbjct: 1032 LATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTL 1091

Query: 1198 STRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLME 1257
            S RLIEG++EH WFEESLRQA++NKAFK+YTIDKV QS+VKHAHTI++D KT EIM+L E
Sbjct: 1092 SKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFE 1151

Query: 1258 KDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTA 1317
            KDR+C  TS+K+QILYRLQ RSHM+T +NMFRIE+N+ S + SIQ++ +DDLTL EPK+ 
Sbjct: 1152 KDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSL 1211

Query: 1318 EEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSD 1377
            E++WKYY+TSY+LSHPTEG+  EE+Q PFLEKIL             N +YSP+GVS S+
Sbjct: 1212 EDRWKYYVTSYSLSHPTEGISHEELQPPFLEKILEKEEEFQCE----NGEYSPEGVSSSN 1267

Query: 1378 LKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGW 1437
            LK+KI+PE Y+L+++PGS+D FSR S+NK+PI++ +D YK+K+      + ++LNG  GW
Sbjct: 1268 LKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGW 1327

Query: 1438 KQSLSEDEINNINLKYSHIKKYGSL 1462
            K+ L   ++     +  ++K  G+L
Sbjct: 1328 KRGLVASKVLKAQTEIEYVKTKGTL 1352

 Score =  175 bits (444), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 89/95 (93%), Gaps = 2/95 (2%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK QF++RPD+YNHFLDIMKDFKSQ+IDTPGVIERVS LF+GYP+
Sbjct: 158 YRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPN 217

Query: 202 LIQGFNTFLPQGYTIECTNNPND--PIKVTTPIGS 234
           LIQGFNTFLPQGY IEC++NPND  PIKVTTP G+
Sbjct: 218 LIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGT 252

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/67 (71%), Positives = 57/67 (85%)

Query: 340 QDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQV 399
           QD   + +K  DVEFS A+SYVNKIK RF ++PDIYK FLEILQTYQ+EQKPI+EVY+QV
Sbjct: 327 QDQHYLAKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQV 386

Query: 400 TILFQNA 406
           T+LFQNA
Sbjct: 387 TVLFQNA 393

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 43/73 (58%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 210 LPQGYTIECTNNP 222
           LP     + T  P
Sbjct: 404 LPDASAPQSTTTP 416

 Score = 36.2 bits (82), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F + PD+Y  FL+I++ ++ +      V  +V+ LFQ 
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/858 (63%), Positives = 662/858 (77%), Gaps = 18/858 (2%)

Query: 621  SVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYS 680
            +VRPEIDLDPS             D+L LVEETNFFDK KK+I NK IY EFLK+LNLYS
Sbjct: 829  AVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNLYS 888

Query: 681  QNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGP 740
             ++L V+ELVEK++YYL  N+ELF WFK FVGY +KPKHIENIVHEKHKLDLDLCEA GP
Sbjct: 889  VDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEACGP 948

Query: 741  SYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEE 800
            SYKKLPKTDT MPCSGRDEMCWE+LND+WVGHPVWASEDSGFIAHRK   ++   +++++
Sbjct: 949  SYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLKKK 1008

Query: 801  RHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGK 860
             HEYDFYIESNLRTIQTLETIASKIANMTE E+ NFKLP GLGHT+ TIY+KVIRKVY K
Sbjct: 1009 VHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVYDK 1068

Query: 861  ERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGL 920
            ERGFE+IDALHEYPA+AVP++LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHLGL
Sbjct: 1069 ERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGL 1128

Query: 921  TFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTD 980
            TFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLD+ + D+ I++DIL   +
Sbjct: 1129 TFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSFVE 1188

Query: 981  VFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIR--SPLDDTKTDSEESSG 1038
            +F+ HTS YSNP+KERL D            PL +IK AI  R  +  +D K + ++ +G
Sbjct: 1189 IFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQKNG 1248

Query: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNET--FSNDISSATSVDDDELIRQ 1096
            + +   KKR+  D  +S  DIL + KYQ++K G D +E     N       ++++EL+RQ
Sbjct: 1249 EENS--KKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKLLEEEELLRQ 1306

Query: 1097 EAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVT 1156
            EA+KPWLLG++V++AN+ G I +R+ +N+F NTN+Y+FIRHL T+YERL+E KQMN +V+
Sbjct: 1307 EAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVS 1366

Query: 1157 EEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLR 1216
             EI  R I  FAKDLNL+STQL  MGLDF   D Y+QLL L  RLI G+LEH WFEESLR
Sbjct: 1367 REISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLR 1426

Query: 1217 QAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQ 1276
            QAF NKAFKLYT+DKVTQ++VKHAHTI+SD KT EIM L EKDR+  +TSSKDQILYRLQ
Sbjct: 1427 QAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQ 1486

Query: 1277 ARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEG 1336
             R+ M+  +NMFRIE+N ++ +I IQYI +DDLT+ + KT EEKWKYYITSYALSHPTEG
Sbjct: 1487 TRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEG 1546

Query: 1337 VPQEEIQIPFLEKILXXXXXXXXXXXVIND--------KYSPKGVSQSDLKIKISPENYA 1388
            + QE IQIPFLE+I+             +D        KYSP+G+S S LKIKI P+NY 
Sbjct: 1547 IFQENIQIPFLERII--EEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYC 1604

Query: 1389 LEIEPGSFDTFSRLSMNKYPIDVTSDD-YKNKKKLSIDRVNAFLNGKFGWKQSLSEDEIN 1447
            L IE GSFD FSR S+N++P+ +T D  Y    KL  + V  FLN K GWK+++S+D++ 
Sbjct: 1605 LNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLK-NTVEKFLNSKMGWKRAISKDQME 1663

Query: 1448 NINLKYSHIKKYGSLKNY 1465
            +I  K+ H+   G+L+ Y
Sbjct: 1664 SIESKWDHLSNNGNLEGY 1681

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (87%), Gaps = 1/105 (0%)

Query: 133 DSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERV 192
           DS + D Q YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVI RV
Sbjct: 291 DSPKEDNQ-YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARV 349

Query: 193 STLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237
           S+LF  YPSLIQGFNTFLPQGY IEC++NPN PI V TP+G+ T+
Sbjct: 350 SSLFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTV 394

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 41/62 (66%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+++P IY HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 210 LP 211
           LP
Sbjct: 608 LP 609

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%)

Query: 335 MHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHE 394
           M N TQD+ K   +   +    A+SY+ ++K +F   PD+Y  FL+I++ ++ +      
Sbjct: 285 MPNNTQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPG 344

Query: 395 VYSQVTILFQN 405
           V ++V+ LF +
Sbjct: 345 VIARVSSLFHD 355

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/833 (64%), Positives = 643/833 (77%), Gaps = 15/833 (1%)

Query: 622  VRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQ 681
            VRPEIDLDPS              + +L+EET+FFDKAKKFINNKQIY EFLK+LNL+SQ
Sbjct: 608  VRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQ 667

Query: 682  NILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPS 741
            ++++V++LV KV+YY+GS+KELF+WF+ FVGYQ  PK IENIVHEKH+LDLDLCEA GPS
Sbjct: 668  DLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPS 727

Query: 742  YKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 801
            YK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 728  YKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 787

Query: 802  HEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKE 861
            HEYD+YIESNLRTIQTLE I +KI+NM+EEE+ NFKL  GLGHTS+TIY+KVIRKVY KE
Sbjct: 788  HEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKE 847

Query: 862  RGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLT 921
            RGFE+IDALHE+PA+A PI+LKRLKQKDEEWRRAQREWNKVWREL+QKVY+KSLDHLGLT
Sbjct: 848  RGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLT 907

Query: 922  FKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDV 981
            FKQADKKLLT KQLISEISSIKVDQ NK++HWLTPKPKSQL++ + D +IL+DIL L++ 
Sbjct: 908  FKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSEN 967

Query: 982  FINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPLDDTKTDSEESSGDSD 1041
            FINH+S YS  DKERL D            PL +I  A+  R+   +++  ++ +  D  
Sbjct: 968  FINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGT 1027

Query: 1042 KFPKKRSIEDDDISFHDILDKVKYQKVK---QGLDKNETFSNDISSATSVDDDE------ 1092
            +  KKRSI D ++S  DIL + KYQK+K   +G D  E   N+I +    + DE      
Sbjct: 1028 ENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQE--ENNIDTIIDEESDERLAEEA 1085

Query: 1093 -LIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQM 1151
             LIRQ+A++PWLLG I+D  N+ GII +R K+N+F NTNIYVF+RH  TLYERL E K+M
Sbjct: 1086 DLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEM 1145

Query: 1152 NAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWF 1211
            N EVT+EI NR  V FA+DL LVSTQLKNMGLDF   DSY++LL LS RLIE ++EH WF
Sbjct: 1146 NGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWF 1205

Query: 1212 EESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQI 1271
            EESLRQA+ N+AFKLYT+DKV Q++VKH HT+M+D KT E+M L EKDR  + TS+KDQI
Sbjct: 1206 EESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQI 1265

Query: 1272 LYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALS 1331
            LYRLQARSHMS T+ MFRIE+NK   NI IQYI +DDLTL E  T EEKWKYY+TSY+L 
Sbjct: 1266 LYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLP 1325

Query: 1332 HPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVI---NDKYSPKGVSQSDLKIKISPENYA 1388
            HPTEG+  E +QIPFL+KIL                N KYSP+GVS S  KIKI P NYA
Sbjct: 1326 HPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIKIHPGNYA 1385

Query: 1389 LEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSL 1441
            L+I+ GSFD FSR S+NKYP+ V  D    K     + +N FL    GWK+ L
Sbjct: 1386 LDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHL 1438

 Score =  187 bits (475), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 107/144 (74%), Gaps = 5/144 (3%)

Query: 94  FDNPLPVKTETTPAISAETSIPNVNXXXXXXXXXXXXXNDSKESDEQFYRPLNVKDALTY 153
           FDNPLP   +      ++ S P ++               + E D+  YRPLNVKDAL+Y
Sbjct: 167 FDNPLPPLNQQ----QSQPSFPAMHMRDQQQQQQMAAAPAAAE-DDASYRPLNVKDALSY 221

Query: 154 LEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFLPQG 213
           LEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYPSLIQGFNTFLP G
Sbjct: 222 LEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTFLPTG 281

Query: 214 YTIECTNNPNDPIKVTTPIGSETI 237
           Y I+C +NPNDPIKVTTPIGS T+
Sbjct: 282 YRIDCPSNPNDPIKVTTPIGSSTL 305

 Score =  113 bits (282), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 326 SANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTY 385
           S NA +   + ++     +  +KPADVEFSQA++YVNKIKNRF D+PDIYK FLEILQTY
Sbjct: 342 SNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTY 401

Query: 386 QKEQKPIHEVYSQVTILFQNA 406
           Q+EQKPI+EVY+QVTILFQNA
Sbjct: 402 QREQKPINEVYAQVTILFQNA 422

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A+ Y+ ++K +F+ +PDIY +FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKF 432

Query: 210 LP 211
           LP
Sbjct: 433 LP 434

 Score = 37.4 bits (85), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404
           A+SY+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/889 (60%), Positives = 670/889 (75%), Gaps = 28/889 (3%)

Query: 619  DISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678
            + + RPEIDLDPS             D L+LVEE +FFDKAKK+I NKQIY EFLKILNL
Sbjct: 562  ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621

Query: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738
            YSQ++L+   LVEKV +YL    ELFDWFK FVGYQ+KPKHIENIVHEKH+LDLDLCEA 
Sbjct: 622  YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEAC 681

Query: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798
            GPSYK+LPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 682  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 741

Query: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858
            EERHEYDFYIE+NLRTIQTLETIA+KIANMT EE+A FKLP GLGHTSVTIY+KVIRKVY
Sbjct: 742  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVY 801

Query: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918
             K+RG+E+IDALHEYPA+ VPI+LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHL
Sbjct: 802  DKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 861

Query: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978
            GLTFKQADKKLLT KQLISEISSIKVDQ NK++H LTPK KSQLD+   D ++ YDIL L
Sbjct: 862  GLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNL 921

Query: 979  TDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPL-------DDTKT 1031
              VF+ + + YS PDKERL+D            P+  I+ A+  R           +T+T
Sbjct: 922  AIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAASSSQSSNSNTET 981

Query: 1032 DSEESSGDSD-KFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSATSVDD 1090
             SE+   D D K PKKR+ ED D    D+L + K QK  +   + ++ S      + +++
Sbjct: 982  YSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGDS-SISAEKESDMEE 1040

Query: 1091 DELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQ 1150
            +E+IRQEA+ PWLLGSIVD+A++ G ++NR  +N+F NTNIYVF RHL T+YERL E K+
Sbjct: 1041 EEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKK 1100

Query: 1151 MNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHW 1210
            MN EVT+EI NR +V FAKDLNL+STQL +MGLDF+G D+Y++LL LS  LI G+LEH W
Sbjct: 1101 MNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQW 1160

Query: 1211 FEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQ 1270
            FEESLRQA++NKAFK+YT+DKV Q++VKHAH I++D KT EIMML EKDR+  +TS+KDQ
Sbjct: 1161 FEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQ 1220

Query: 1271 ILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYAL 1330
            ILYRLQ RS+MS  +NMFRIE+N+ + ++ IQ++ +DDLTL EPK+ ++KW+YY+TSY+L
Sbjct: 1221 ILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSL 1280

Query: 1331 SHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALE 1390
            SHPTEG+  + ++ PFLEKI+             ++KYSP+GV+ S+LK+KI P  Y++E
Sbjct: 1281 SHPTEGISHDNLRSPFLEKIIESEEDIIEDK---DEKYSPEGVATSNLKVKIDPITYSME 1337

Query: 1391 IEPGSFDTFSRLSMNKYPIDVTSDDYKNKK----KLSIDRVNAFLNGKFGWKQSLSEDEI 1446
            +E GS D FSR ++NK+P+ V   D + KK    KL ++R   FLN   GWK+ LS  +I
Sbjct: 1338 VEFGSHDIFSRKAVNKFPVRV---DIRKKKSSELKLELER---FLNSNSGWKKDLSAKQI 1391

Query: 1447 NNINLKYSHIKKYGSLKNY----VVPVVAAIPNKPL--ENKEKTQEEET 1489
              +  +   +K  G+L+ Y     V   +A+    L  E+  ++Q E T
Sbjct: 1392 AEVEKRLEFVKLNGNLEEYSDDSAVASTSAVSGSDLAKEDIARSQSEST 1440

 Score =  184 bits (466), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/97 (83%), Positives = 91/97 (93%)

Query: 138 DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197
           D   YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF+
Sbjct: 156 DGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

Query: 198 GYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGS 234
           GYP+LIQGFNTFLPQGY IEC+++PNDPIKVTTP G+
Sbjct: 216 GYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGT 252

 Score =  105 bits (261), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 63/86 (73%), Gaps = 3/86 (3%)

Query: 322 VIQSSANAPIQPNMHNMTQDTMKIT-EKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLE 380
           V QS+  +P  P      QD      +K  DVEFS A+SYVNKIK RF D+PDIYK FLE
Sbjct: 323 VYQSTDGSPTMP--QRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLE 380

Query: 381 ILQTYQKEQKPIHEVYSQVTILFQNA 406
           ILQTYQ+EQKPI+EVY+QVT+LFQNA
Sbjct: 381 ILQTYQREQKPINEVYAQVTVLFQNA 406

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 210 LP 211
           LP
Sbjct: 417 LP 418

 Score = 37.0 bits (84), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LFQ 
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQG 216

 Score = 33.5 bits (75), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 145 LNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQ 204
           LN+ +  ++ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 205 GFNTFLPQGY 214
            F +F+  GY
Sbjct: 649 WFKSFV--GY 656

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/859 (62%), Positives = 655/859 (76%), Gaps = 18/859 (2%)

Query: 619  DISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678
            DI VRPEIDLDPS             +++SL EE  FF+KAK++I NK +Y EFLKILNL
Sbjct: 632  DIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 691

Query: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738
            YSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ+K K IENIVHEKH+LDLDLCEA+
Sbjct: 692  YSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAF 751

Query: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798
            GPSYK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 752  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 811

Query: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858
            EERHEYDFYIESNLRTIQ LETI +KI NMTE E+ANFKLP GLGHTS+TIY+KVIRKVY
Sbjct: 812  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVY 871

Query: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918
             KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHL
Sbjct: 872  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 931

Query: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978
            GLTFKQADKKLLTTKQLISEISSIKVDQTNKK+HWLTPKPKSQLD+   D+ I YDIL L
Sbjct: 932  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCL 991

Query: 979  TDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAI-KIRSPLDDTKTDSEESS 1037
             D FI HT+ YSNPDKERL+D                I+ ++   +  + ++    + SS
Sbjct: 992  ADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSS 1051

Query: 1038 GDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKN----ETFSNDISSATSVDDDEL 1093
              S K P ++     ++S  DIL + +YQK+K+  D++    +          +++++EL
Sbjct: 1052 IASRKRPYQQ-----EMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEEL 1106

Query: 1094 IRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNA 1153
            I +EA+ PWL G++V++ANS GIIQNRS +N+F NTNIY+F RH  T+YERL E KQMN 
Sbjct: 1107 IDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNE 1166

Query: 1154 EVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEE 1213
             VT+EI  RS V FAKDL+L+S+QL  MGLDF G D+YKQ+L LS RLI G+LEH WFEE
Sbjct: 1167 RVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEE 1226

Query: 1214 SLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILY 1273
            SLRQA+ NKAFKLYTIDKVTQS+VKHAHT+M+D KTAEIM L  KDR+ +TTS+KDQI+Y
Sbjct: 1227 SLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIY 1286

Query: 1274 RLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHP 1333
            RLQ RSHMS T+NMFRIEF+K + ++SIQYI +DDLTL EPK  E+KWKYY+TSYAL HP
Sbjct: 1287 RLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHP 1346

Query: 1334 TEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEP 1393
            TEG+P E+++IPFLE+++            +++++SP+G+S S LKIKI P  Y L IE 
Sbjct: 1347 TEGIPHEKLKIPFLERLIEFGQDIDGTE--VDEEFSPEGISVSTLKIKIQPITYQLHIEN 1404

Query: 1394 GSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKY 1453
            GS+D F+R + NKYP     +  K       + ++ FL+   G + +L E +      K 
Sbjct: 1405 GSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQ------KL 1458

Query: 1454 SHIKKYGSLKNYVVPVVAA 1472
            S  KK+ +LK+ +    A 
Sbjct: 1459 SMQKKWENLKDSIAKTSAG 1477

 Score =  255 bits (652), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 169/272 (62%), Gaps = 34/272 (12%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK QFSSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI-----PYAKPIPSAAXXXXXXXXX 256
           LIQGFNTFLPQGY IEC++NP+DPI+VTTP+G+ T+     P  +    A          
Sbjct: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDA---------- 325

Query: 257 XXXXXXXXXXXXXXXXXXXXXXXXIPNITRNKETNAIENVATAAQPSLLPNLGTPS--HT 314
                                   +P +  +   +        + P L  + G PS    
Sbjct: 326 -----QELGSFPESDGNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQP 380

Query: 315 EVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDI 374
           E+     + QS +  P         Q+  K   K  DVEFSQA+SYVNKIK RF D+PDI
Sbjct: 381 EMPAHRQIPQSQSLVP---------QEDAK---KNVDVEFSQAISYVNKIKTRFADQPDI 428

Query: 375 YKTFLEILQTYQKEQKPIHEVYSQVTILFQNA 406
           YK FLEILQTYQ+EQKPI+EVY+QVT LFQNA
Sbjct: 429 YKHFLEILQTYQREQKPINEVYAQVTHLFQNA 460

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 210 LP 211
           LP
Sbjct: 471 LP 472

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/883 (60%), Positives = 666/883 (75%), Gaps = 20/883 (2%)

Query: 619  DISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678
            D+ VRPEIDLDPS             D++SL EE  FF+KAK++I NK +Y EFLKILNL
Sbjct: 664  DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 723

Query: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738
            YSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ++ K IENIVHEKH+LDLDLCEA+
Sbjct: 724  YSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAF 783

Query: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798
            GPSYK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 784  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 843

Query: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858
            EERHEYDFYIESNLRTIQ LETI +KI NMTE E+ NFKLP GLGHTS+TIY+KVIRKVY
Sbjct: 844  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVY 903

Query: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918
             KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHL
Sbjct: 904  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 963

Query: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978
            GLTFKQADKKLLTTKQLISEISSIKVDQTNKK+HWLTPKPKSQLD+   D+ I  DIL L
Sbjct: 964  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYL 1023

Query: 979  TDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPLDDTKTDSEESSG 1038
             D FI+HT+ YSNPDKERL+D             L +I+ +++       + ++S  S  
Sbjct: 1024 ADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQA---YKQSVSESSGSDD 1080

Query: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSA-----TSVDDDEL 1093
                  +KRS +  +++  DIL + +YQK+K+  D++      +S A       ++++EL
Sbjct: 1081 GGSSVSRKRSYQ-QEMTLLDILHRSRYQKLKRSKDEDGKVPQ-LSEAPDEESNIIEEEEL 1138

Query: 1094 IRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNA 1153
            I +EA+ PWL G++V++ANS G+IQNR  +N+F NTNIY+F RH  T+YERL E KQMN 
Sbjct: 1139 INEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNE 1198

Query: 1154 EVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEE 1213
            +VT+EI  RS V FAKDL+L+S QL  MGLDF G D+YKQ+L LS RLI G+LEH WFEE
Sbjct: 1199 KVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEE 1258

Query: 1214 SLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILY 1273
            SLRQA+ N+AFKLYTIDKVTQS+VKHAHT+M+D KTAEIM L  KDR+  TTS+K QI+Y
Sbjct: 1259 SLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIY 1318

Query: 1274 RLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHP 1333
            RLQ RSHMS T+NMFRIEF+K + ++SIQYI +DDLTL EPK  E+KWKYY+TSYAL HP
Sbjct: 1319 RLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHP 1378

Query: 1334 TEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEP 1393
            TEGV  E+++IPFLE+++            +++K+SP+G+S S LKIKI P  Y L+IE 
Sbjct: 1379 TEGVLHEKLKIPFLERLIEFGQDIDGKD--VDEKFSPEGISVSTLKIKIQPTTYKLDIEN 1436

Query: 1394 GSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKY 1453
            GS+D F+R S NKYP     D +K       + ++ FL+     +  L+E +      K 
Sbjct: 1437 GSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQ------KI 1490

Query: 1454 SHIKKYGSLKNYVVP--VVAAIPNKPLENKEKTQEEETPDVAN 1494
            S  +K+ SLK+      V   + +  +E   KT++E+  ++A+
Sbjct: 1491 SMQEKFESLKDTTAKLNVDGQVVDTKIEEATKTKQEQQENLAS 1533

 Score =  183 bits (465), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 90/96 (93%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK QFSSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237
           LIQGFNTFLPQGY IEC+ NP+DPI+VTTP+G+ T+
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV 324

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%)

Query: 347 EKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNA 406
           +K  DVEFSQA+SYVNKIK RF D+PDIYK FLEILQTYQ+EQKPI+EVY+QVT LFQNA
Sbjct: 414 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 473

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 210 LP 211
           LP
Sbjct: 484 LP 485

 Score = 36.6 bits (83), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404
           A+SY+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 284

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/872 (61%), Positives = 660/872 (75%), Gaps = 10/872 (1%)

Query: 619  DISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678
            D+ VRPEIDLDPS             D++SL EE  FF+KAK++I NK +Y EFLKILNL
Sbjct: 656  DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 715

Query: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738
            YSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ+K K IEN+VHEKH+LDLDLCEA+
Sbjct: 716  YSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAF 775

Query: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798
            GPSYK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 776  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 835

Query: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858
            EERHEYDFYIESNLRTIQ LETI +KI NMTE E+ANFKLP GLGHTS+TIY+KVIRKVY
Sbjct: 836  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVY 895

Query: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918
             KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQREWNKVWREL+QKVY+KSLDHL
Sbjct: 896  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 955

Query: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978
            GLTFKQADKKLLTTKQLISEISSIKVDQTNKK+HWLTPKPKSQLD+   D+ I YDIL L
Sbjct: 956  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYL 1015

Query: 979  TDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPLDDTKTDSEESSG 1038
             D FI HT+ YSNPDKERL+D            PL  I+ A++         +DS  S  
Sbjct: 1016 ADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQ---SYKQNLSDSSGSDD 1072

Query: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKN---ETFSNDI-SSATSVDDDELI 1094
                 P+KR  +  ++S  DIL + KYQK+K+  D++      S  +   + +++++ELI
Sbjct: 1073 GDSSTPRKRPYQ-QEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELI 1131

Query: 1095 RQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAE 1154
             +EA+ PWL G++V++ANS GIIQNR+ +N+F N+NIY+F RH  T+YERL E KQMN +
Sbjct: 1132 NEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEK 1191

Query: 1155 VTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEES 1214
            VT+EI  RS+V FAKDL+L+S+QL  MGLDF G D+YKQ+L LS RLI G LEH WFEE 
Sbjct: 1192 VTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEG 1251

Query: 1215 LRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYR 1274
            LRQA+ NKAFKLYTIDKV Q +VKHAHT+M+D KTAEIM L  KDR+ +TTS+KDQI+YR
Sbjct: 1252 LRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYR 1311

Query: 1275 LQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPT 1334
            LQARS+MS T+NMFR+EF++ + ++S+QYI +DDLTL EP+  E+KWKYY+TSYAL HPT
Sbjct: 1312 LQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPT 1371

Query: 1335 EGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEPG 1394
            EG+  E+++IPFLE+++            +++K+SP+G+S S LKIKI P  Y L IE G
Sbjct: 1372 EGISHEKLKIPFLERLIEYGQDTDGRE--VDEKFSPEGLSVSTLKIKIQPVTYKLHIESG 1429

Query: 1395 SFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYS 1454
            S+D F+R + NKYP     D +K         ++ FL+     +  L+E +  ++  K  
Sbjct: 1430 SYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLD 1489

Query: 1455 HIKKYGSLKNYVVPVVAAIPNKPLENKEKTQE 1486
             +K   +  +    +  A   K +E KE+ QE
Sbjct: 1490 SLKGATTKADVDDKITVAKNEKAIEAKEEQQE 1521

 Score =  253 bits (645), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/268 (52%), Positives = 169/268 (63%), Gaps = 29/268 (10%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPIPSAAXXXXXXXXXXXXXX 261
           LIQGFNTFLPQGY IEC+ NP+DPI+VTTP+G+ T+      P+ +              
Sbjct: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARS-------ALEPQEP 179

Query: 262 XXXXXXXXXXXXXXXXXXXIPNITRNKETNAIEN---VATAAQPSLLPNLGTPSHTEVTK 318
                              +P+   + E +  +    +   A PS LP++  P       
Sbjct: 180 SSLPEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPE------ 233

Query: 319 SESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTF 378
                      PI  +     Q+ +K   K  DVEFSQA+SYVNKIK RF D+PDIYK F
Sbjct: 234 ----------LPIPQSQPLTAQEDVK---KNVDVEFSQAISYVNKIKTRFADQPDIYKHF 280

Query: 379 LEILQTYQKEQKPIHEVYSQVTILFQNA 406
           LEILQTYQ+EQKPI+EVY+QVT LFQNA
Sbjct: 281 LEILQTYQREQKPINEVYAQVTHLFQNA 308

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 210 LP 211
           LP
Sbjct: 319 LP 320

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/879 (59%), Positives = 655/879 (74%), Gaps = 29/879 (3%)

Query: 615  GYPQDIS---------VRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINN 665
            GYPQ +           RPEIDLDPS             D+++L +E  FF++ K+FI N
Sbjct: 645  GYPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGN 704

Query: 666  KQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVH 725
            KQ+Y EFLKILNLYSQ++L  +ELV KV++YL S+KELFDWFK FVGYQ+KPKHIENIVH
Sbjct: 705  KQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVH 764

Query: 726  EKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAH 785
            EKH+LDLDLCEA GPSYKKLPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAH
Sbjct: 765  EKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAH 824

Query: 786  RKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHT 845
            RKNQYE+TLFK+EEERHEYDFYIESNLRTIQTLETIA+KIANMT EE+ NFKLP GLGHT
Sbjct: 825  RKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHT 884

Query: 846  SVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRE 905
            S+TIY+KV+RKVY K+RGFE+IDALHE+PAV VPI+LKRLKQKDEEWRRAQREWNKVWRE
Sbjct: 885  SLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRE 944

Query: 906  LQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYK 965
            L+QKVYYKSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK++H LTPKPKSQLD++
Sbjct: 945  LEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFE 1004

Query: 966  VADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSP 1025
            + DR++LYDIL L   F+   ++YSN DK +L              P+ D+  A+  RS 
Sbjct: 1005 INDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSS 1064

Query: 1026 LDDTKTDSEESS-GDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISS 1084
            + D +   E+S+  DS+K  K+   ++D     DIL + K  K       N   + + SS
Sbjct: 1065 ITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILRRTKNAKT-----SNSEENQNSSS 1119

Query: 1085 ATSVDDD--ELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLY 1142
              S ++D  EL+ +EA KPWLLGS++D+AN+ GI+ +R  +N+F NT IYVF RHL TLY
Sbjct: 1120 VKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLY 1179

Query: 1143 ERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLI 1202
            ERL E K+++AEVT+EIKNR IV FA DLNL+STQL +MGL F+ T +Y +LL LS RLI
Sbjct: 1180 ERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLI 1239

Query: 1203 EGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSC 1262
             G+L+H WFEESLRQA++NKAFK+YTIDKV QS+VKHAH+I++D K A +M+L E+DR  
Sbjct: 1240 TGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLK 1299

Query: 1263 ATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWK 1322
              T++KDQILYRL+ R+ M  ++NMFRIE+N  S ++SIQY+ +DDLTL EP+  +EKW 
Sbjct: 1300 RDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWD 1359

Query: 1323 YYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPKGVSQSDLKIKI 1382
            YY+TSY+LSHPTEG+ QE+I  PFL KI+             NDK+SP+GVSQS LK+ I
Sbjct: 1360 YYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQ-NDKFSPEGVSQSKLKVNI 1418

Query: 1383 SPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLS 1442
             PE Y L  E GS D F+R S+NK+P         ++      +++ FLN   GWK++LS
Sbjct: 1419 HPETYELTFECGSTDVFTRKSVNKFP--------SSQSTQPASKMDKFLNSSKGWKKNLS 1470

Query: 1443 EDEINNINLKYSHIKKYGSLK-NYVVPVVAAI--PNKPL 1478
             + I     K   +K+ G L+ +  + + A I  PN+P+
Sbjct: 1471 TEIIGRAESKMKILKEQGKLEIDQTLTITAKIEEPNEPI 1509

 Score =  180 bits (457), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK QFSSRPD+YNHFLDIMKDFKSQ+IDTPGVI+RV+TLF+G+P+
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKP 242
           LIQGFNTFLP GY IEC+ NPNDPIKVTTP G+     A P
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGP 301

 Score =  103 bits (257), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/59 (79%), Positives = 53/59 (89%)

Query: 347 EKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           +K  +VEFS A+SYVNKIK RF D+PDIYK FLEILQTYQ+EQKPIHEVY+QVTILFQN
Sbjct: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 210 LP 211
           LP
Sbjct: 490 LP 491

 Score = 38.9 bits (89), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +VT LFQ 
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQG 257

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/988 (55%), Positives = 689/988 (69%), Gaps = 64/988 (6%)

Query: 479  VTIQSLPPLGNFLPPSXXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQ 538
            V  Q+LPP+G+F PP+                 S +H   D+ Q QQ++        P+ 
Sbjct: 554  VPQQNLPPIGSFSPPTN---------------GSTVH---DNYQDQQHMQPPHLVPLPSM 595

Query: 539  QQSTTQL-----TNEAMQISELRGSPMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXX 593
             Q    +      NE + IS+LR S + D            +P  ++             
Sbjct: 596  VQHGPNMVHQGIANENLPISDLRTS-LTDQYAPSTFQQQQQNPPSISPIT---------- 644

Query: 594  XXXXXXXXXXXXXXXXXXXDGGYPQDISVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEET 653
                               D  Y  D+ VRPEIDLDPS             D++SL EE 
Sbjct: 645  -------------------DLQY-GDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEV 684

Query: 654  NFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGY 713
             FF+KAK++I NK +Y EFLKILNLYSQ+IL++++LVEKV +YLGSNKELF WFK FVGY
Sbjct: 685  TFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGY 744

Query: 714  QDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHP 773
            Q+K K IENIVHEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRD+MCWE+LND+WVGHP
Sbjct: 745  QEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHP 804

Query: 774  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEER 833
            VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE E+
Sbjct: 805  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEK 864

Query: 834  ANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWR 893
            ++FKLP GLGHTS+TIY+KVIRKVY KERGFE+IDALHE+PAV  P++LKRLKQKDEEWR
Sbjct: 865  SDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWR 924

Query: 894  RAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHW 953
            RAQREWNKVWREL+QKV++KSLDHLGLTFKQADKKLLTTKQLISEI+SIKVDQTNKK+HW
Sbjct: 925  RAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHW 984

Query: 954  LTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPL 1013
            LTPKPKSQLD+   D+ I YDIL L D FI+HT+ YSNPDKERL+D            PL
Sbjct: 985  LTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPL 1044

Query: 1014 ADIKAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLD 1073
              I+ A++      +  ++S  S        +KR  +  ++S  DIL + +YQK+K+  D
Sbjct: 1045 EKIEKALQFHK---ENVSESSGSDDGGSSTSRKRPYQ-QEMSLLDILHRNRYQKLKRSND 1100

Query: 1074 ---KNETFSNDI-SSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNT 1129
               K    S  +   + +++++ELI +EA+ PWL G++V++ANS GIIQNRS +N+F NT
Sbjct: 1101 EEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANT 1160

Query: 1130 NIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTD 1189
            NIY+F RH  T+YERL E KQMN ++T+E+  RS V FAKDL+L+S QL  MGLDF G D
Sbjct: 1161 NIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGED 1220

Query: 1190 SYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKT 1249
            +YKQ+L LS RLI G+LEH WFEESLRQA+ NKAFKLYTIDKVTQS+VKHAHT+M+D KT
Sbjct: 1221 AYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKT 1280

Query: 1250 AEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDL 1309
            AEIM L  KDR+  TTS+KDQI+YRLQ RS+MS  +NMFRIE NK S ++S+QYI +DDL
Sbjct: 1281 AEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDL 1340

Query: 1310 TLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYS 1369
            TL EPK  E+KWKYY+TSY L HPTEG+  E+++IPFLE+++            +++++S
Sbjct: 1341 TLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTDGRE--VDEEFS 1398

Query: 1370 PKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNA 1429
            P+G+S S L+IKI P  Y L IE GS+D F+R ++NKYP     D +K         ++ 
Sbjct: 1399 PEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISR 1458

Query: 1430 FLNGKFGWKQSLSEDEINNINLKYSHIK 1457
            FL      +  L+E   + +  K + +K
Sbjct: 1459 FLENAIRSRNDLNEATKSGMQEKLALLK 1486

 Score =  185 bits (469), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 109/170 (64%), Gaps = 30/170 (17%)

Query: 94  FDNPLPVKTETT--------------------------PAISAETSIPNVNXXXXXXXXX 127
           FDNPLP+ T                              A SA  S P+ N         
Sbjct: 154 FDNPLPINTSVCTKDSKSYNGVQEEEKANQQQIQDQRPAAHSANASEPSSNYVDTSYSVN 213

Query: 128 XXXXNDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPG 187
               ND    ++  YRPLNVKDAL+YLEQVK QFSSRPDIYN FLDIMKDFKSQ+IDTPG
Sbjct: 214 NENSND----EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPG 269

Query: 188 VIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237
           VIERVSTLFRGYP LIQGFNTFLPQGY IEC+ NP+DPI+VTTP+G+ T+
Sbjct: 270 VIERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV 319

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 68/92 (73%), Gaps = 4/92 (4%)

Query: 319 SESVIQSSANAPIQPNMHNMTQ-DTMKITE---KPADVEFSQAVSYVNKIKNRFVDEPDI 374
           + SV  SS + P  P  H + Q  ++ + E   K  DVEFSQA+SYVNKIK RF D+PDI
Sbjct: 377 ANSVGLSSIHPPEIPPHHQILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDI 436

Query: 375 YKTFLEILQTYQKEQKPIHEVYSQVTILFQNA 406
           YK FLEILQTYQ+EQKPI+EVY+QVT LFQNA
Sbjct: 437 YKHFLEILQTYQREQKPINEVYAQVTHLFQNA 468

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 210 LP 211
           LP
Sbjct: 479 LP 480

 Score = 36.6 bits (83), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404
           A+SY+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1051 bits (2717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/877 (59%), Positives = 646/877 (73%), Gaps = 54/877 (6%)

Query: 622  VRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQ 681
             RPEIDLDPS             ++++LVEET+FF+K KKFI++K IYMEFLK+LNLYSQ
Sbjct: 716  TRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQ 775

Query: 682  NILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPS 741
            ++L+ NELV +V YY+GSNKELFDWFK FVGY + P  IENI+HEKHKLDLDLCEAYGPS
Sbjct: 776  DLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPS 835

Query: 742  YKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 801
            YKKLPKTDTFMPCSGRD MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 836  YKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 895

Query: 802  HEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKE 861
            HEYDF+IESNLRTIQTLETIA+KI NMT EE+ NFKLP+GLGHTS TIY+KVIRKVY KE
Sbjct: 896  HEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKE 955

Query: 862  RGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLT 921
            RGFE+IDALHE+PA AVPIIL+RLK+KDEEWRRAQREWNKVWREL+QKVYYKSLDHLGLT
Sbjct: 956  RGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 1015

Query: 922  FKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDV 981
            FKQADKKLLTTKQLISEISSI+VDQ NK++HWLTPKPKSQLD+   D  IL DIL L +V
Sbjct: 1016 FKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANV 1075

Query: 982  FINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADIKAAIKIRSPLDDTKTDSEESSGDSD 1041
            FI+HTS YSN +KERL+D                ++  I +   +  ++ D + S  + +
Sbjct: 1076 FIDHTSTYSNSEKERLKDF---------------LRVFIGLFFSIPSSEIDKKLSGKNDE 1120

Query: 1042 KF----------------PKKRSIEDDDISFHDILDKVKYQKVKQG-LDKNETFSNDI-- 1082
            KF                 KKRS+E  DI   D+L K KYQK+K+  +++ E  SN+   
Sbjct: 1121 KFEKGSSSSSSTSNSTPSAKKRSLE-LDIPLADVLRKYKYQKIKEKVINELENNSNEYDE 1179

Query: 1083 -----------SSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNI 1131
                             ++D +I +E +KPWLLGS++D  +  G+I+NR  +N+F NTNI
Sbjct: 1180 RDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNI 1239

Query: 1132 YVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSY 1191
            YVF RH  T+YERL E KQ+N +VT EI +R + PFAKDL L+STQL  MGLDF+ +DSY
Sbjct: 1240 YVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSY 1299

Query: 1192 KQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAE 1251
            K+LL+L+ RLI+ ++EH WFEESLRQA+ NKAFKLYT DKV Q++VKHA++I++D+K +E
Sbjct: 1300 KELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASE 1359

Query: 1252 IMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTL 1311
            IM L EKDR  ++T+++DQI+YRLQ R+HM+ T+NMFRIEFN++++++ IQYI ++DLTL
Sbjct: 1360 IMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTL 1419

Query: 1312 GEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXX------XXXXVIN 1365
                T +E W+YY+TSYAL HPTEGVPQE +++PFLEK L                    
Sbjct: 1420 KPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFI 1479

Query: 1366 DKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSID 1425
            +K SP+G+S S LKIKI  E Y L++EPGSFD FSR S+NK+P D    +   K+K   +
Sbjct: 1480 EKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSIKEKS--E 1537

Query: 1426 RVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSL 1462
              N FL+ K GW      D++  I   +   ++ G  
Sbjct: 1538 AFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEF 1574

 Score =  175 bits (443), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 90/95 (94%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLNVKDAL+YLEQVK+QF+S+P IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+GYP 
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSET 236
           LIQGFNTFLPQGYTI C++NP+DP++VTTP+G+ T
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (87%)

Query: 351 DVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNA 406
           +VEFSQA++YVNKIK R+ D+P IYK FLEILQTYQ+E+KPI EVY QVT+LF +A
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDA 519

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A+ Y+ ++K +++ +P IY HFL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 210 LPQ 212
           LP+
Sbjct: 530 LPE 532

 Score = 33.1 bits (74), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404
           A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/995 (54%), Positives = 688/995 (69%), Gaps = 95/995 (9%)

Query: 482  QSLPPLGNFLPPSXXXXXXXXXXXXLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQS 541
            Q+LPPLGNF PP              + + ++  P +D    QQ    Q   +  AQ   
Sbjct: 578  QNLPPLGNFSPPINGRDNEAQ-----VNLPAVQPPALDFPPQQQ---SQSHRHVVAQG-- 627

Query: 542  TTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNXXXXXXXXXXXXXXXXXXXXX 601
               +TN ++ +S++RG   +DG          ++P  L                      
Sbjct: 628  ---MTNNSLPVSDMRGP--VDG---------GFAPQPL---------------------- 651

Query: 602  XXXXXXXXXXXDGGYPQDI-----SVRPEIDLDPSXXXXXXXXXXXXXDSLSLVEETNFF 656
                          Y QD+     + RPEIDLDPS             +  +L+EET+FF
Sbjct: 652  --------------YSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFF 697

Query: 657  DKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDK 716
            DKAKK++ NKQ+Y EFLKILNL+SQ++++ +ELV+KV++YLG N ELFDWFK FV Y ++
Sbjct: 698  DKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVER 757

Query: 717  PKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWA 776
            PKHIEN+VHEKH+LDLDLCEA  PSYKKLPK DTFMPC GRDEMCWEVLND+WVGHPVWA
Sbjct: 758  PKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWA 817

Query: 777  SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANF 836
            SEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETIA+KI+NMT EE+  F
Sbjct: 818  SEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTF 877

Query: 837  KLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQ 896
            KLP GLGHTS TIY+KVIRKVY K+RGFE+IDALHE PAV+VPI+L+RLKQKDEEWRRAQ
Sbjct: 878  KLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQ 937

Query: 897  REWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTP 956
            REWNKVWREL+QKV+YKSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ NK+++  T 
Sbjct: 938  REWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTS 997

Query: 957  KPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDXXXXXXXXXXXXPLADI 1016
            KPKSQLD+ ++D+ +L+DIL L D FI+H++ YSNPDKE+L              PL D 
Sbjct: 998  KPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTD- 1056

Query: 1017 KAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDIL---DKVKYQKVKQGLD 1073
                     LD+   + +  +GDS    +KRS  DDD  F D+L    K   +K  Q  D
Sbjct: 1057 ---------LDNPSEEHKVENGDST---RKRS-RDDDQFFRDLLKSKHKQAKKKTSQQED 1103

Query: 1074 KNETFSNDISSATSVD--DDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNI 1131
            ++ +   D ++ TS D   +E +R +A+KPWLLG+I+D+AN+ G + NR  YN+F NTNI
Sbjct: 1104 ESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNI 1163

Query: 1132 YVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSY 1191
            YVF RHL T+Y+RL+EAK +N EVT+EI +R +V FAKDLNL STQL +MGLDF+G D+Y
Sbjct: 1164 YVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAY 1223

Query: 1192 KQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAE 1251
            +QLL L  RLI+ ++EH WFEESLRQA++NKAFK+YT+DKV QS+VKHAH+I++D KTAE
Sbjct: 1224 EQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAE 1283

Query: 1252 IMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTL 1311
            IM+L EKDR   TTS+++QILYRLQ RS M  T+NMFRIE N +S ++SIQ++ +DDLTL
Sbjct: 1284 IMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTL 1343

Query: 1312 GEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXXXXXXXXVINDKYSPK 1371
             +P + +++W+YY+TSY+LSHPTEGVP EEI+ PFLEK L                YSP 
Sbjct: 1344 NQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEW----YSPG 1399

Query: 1372 GVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDV---TSDDYKNKKKLSIDRVN 1428
            G S S L+I+I+PE+YAL+IEP S D F+R ++NK+P  +   +  D K  +K   D VN
Sbjct: 1400 GQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLADMVN 1459

Query: 1429 AFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSLK 1463
            +    + GWK+ L  + I       + +K  G L+
Sbjct: 1460 S----EHGWKKGLQNESIGKAESIINFVKARGFLE 1490

 Score =  228 bits (582), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 155/266 (58%), Gaps = 21/266 (7%)

Query: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201
           YRPLN KDAL+YLEQVK QF++RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP 
Sbjct: 249 YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPV 308

Query: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPIPSAAXXXXXXXXXXXXXX 261
           LIQG NTFLPQGY IECT+NP+D             P++  + +                
Sbjct: 309 LIQGLNTFLPQGYKIECTSNPHD-------------PHSIKVTTPFDTTRELSLDHNTGG 355

Query: 262 XXXXXXXXXXXXXXXXXXXIPNITRNKETNAIENVATAAQPSLLPNLGTPSHTEVTKSES 321
                              IP     ++  A+        P  LP     +  +V  +ES
Sbjct: 356 SAVGGHLAGPATVSTSPSQIP-----RQETAVSETKQEETPVDLPASAAFAQDQVHHAES 410

Query: 322 VIQSSANAPIQPNMHNMTQDTMKITEKP-ADVEFSQAVSYVNKIKNRFVDEPDIYKTFLE 380
             Q          +    QD    T +P  DVEFS A+SYVNKIK RF D+PDIYK FLE
Sbjct: 411 DTQREIQK--SAQLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLE 468

Query: 381 ILQTYQKEQKPIHEVYSQVTILFQNA 406
           ILQTYQ+EQKPIHEVY+QVT LFQNA
Sbjct: 469 ILQTYQREQKPIHEVYTQVTSLFQNA 494

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V++LF+  P L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 210 LP 211
           LP
Sbjct: 505 LP 506

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  248 bits (632), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 196/329 (59%), Gaps = 17/329 (5%)

Query: 655 FFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVG-Y 713
           F    +  + ++ IY EFLK++NL++Q+++++N   ++   + GS+  L   F   +  Y
Sbjct: 206 FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 714 QDKPKHIENIVHEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGH 772
           +D  + ++  +      D+ D     GPSYK+L   +T   C GRD +C EVLND+WVGH
Sbjct: 266 KDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 773 PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEE 832
           PVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S    I         +    ++ 
Sbjct: 326 PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDG 385

Query: 833 RANFKLP------IGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLK 886
           R   ++       I L     +I +KVIR++YG E G  LIDA+   P   VP ILK  K
Sbjct: 386 RRRNRVSSPKEPMISLN----SITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAK 441

Query: 887 QKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ 946
           +K ++W  A+ EWNK WRE++QK YYKSLDHLGL FK A+K+ L  KQL+ E  S K D+
Sbjct: 442 EKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDK 501

Query: 947 TNKKLHWLTPKPKSQLDYKVADRQILYDI 975
             K+ H+       +  Y+  D+ +LYD+
Sbjct: 502 LLKE-HY----DNYEYKYEFFDKSVLYDV 525

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 140/290 (48%), Gaps = 9/290 (3%)

Query: 1119 NRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVST-- 1176
            NR   NIF + NI     ++ TLYER N+ K     + ++++ +   P     +L     
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1177 QLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSI 1236
            QL + GL+    D Y+ +   S + + GNL+H WFEESLR  F NKA+KLYTID+V ++I
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1237 VKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSS 1296
            +    TI       +I+ L+  +    TT+   Q+ YR + R  M    +MFR+E  + S
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1297 DNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILXXXXX 1356
            + I  QYIG+DDL   +    + +   Y   Y  +  T+ +  + +  P+    L     
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858

Query: 1357 XXXXXXVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNK 1406
                    N  +    + +  L + I+P +Y ++I PGS D  S   + K
Sbjct: 859  Q-------NIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITK 901

>CAGL0D01100g Chr4 complement(129293..131713) [2421 bp, 806 aa] {ON}
            similar to uniprot|P40433 Saccharomyces cerevisiae
            YIL107c 6-phosphofructo-2-kinase 1
          Length = 806

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 22/180 (12%)

Query: 1139 ITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVST-----------QLKNMGLDFEG 1187
            + +++  N +K    +V E I+NRS  P  K L L S            +LK  G D++G
Sbjct: 334  VGIFDATNTSKARRKQVLERIRNRS--PHLKVLFLESICTNKAVVESNIRLKLFGPDYKG 391

Query: 1188 TDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDT 1247
             D  K LLD   RL      +   E+     +      +  ID   + I       ++  
Sbjct: 392  KDPKKSLLDFKERLSNYIKAYEPIEDEEDIQY------IKMIDVGKKVIANKIQGFLASQ 445

Query: 1248 KTAEIMMLMEKDRSCATT---SSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYI 1304
                ++    K+R    T    S+D +L +L   SH+++  + +    ++  D    Q++
Sbjct: 446  TVYYLLNFNLKERQIWITRNGESEDNVLGKLGGDSHITSRGDKYAKALSRFIDEQRAQFL 505

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
            similarities with uniprot|P39956 Saccharomyces cerevisiae
            YER169w
          Length = 980

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 76/187 (40%), Gaps = 39/187 (20%)

Query: 1017 KAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNE 1076
            K A K R   D  + D ++ + +   F KKR IED +       D  + ++    +D NE
Sbjct: 351  KKAGKCRCISDSVEVDVDKLAENWSNFKKKREIEDPETE-----DSPQKKRKSSTVDSNE 405

Query: 1077 TFSNDISSATSVDDD----------ELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIF 1126
            T SN   SAT  DD+          +LI+   ++  +  S  DD N+   +Q +S  N F
Sbjct: 406  TISN--VSATKEDDEVKNEDNDDNSKLIKDVKKE--VTDSNEDDLNASVDVQRQSNDNTF 461

Query: 1127 GN------------------TNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFA 1168
            G+                   N+    + L    E LN + Q +  +   +KN     FA
Sbjct: 462  GDNSNPATNIKMESNKTKIEANVPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPF--FA 519

Query: 1169 KDLNLVS 1175
            +D  L S
Sbjct: 520  RDSPLRS 526

>TPHA0B04010 Chr2 (948185..949936) [1752 bp, 583 aa] {ON} Anc_1.460
            YEL023C
          Length = 583

 Score = 32.7 bits (73), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1106 SIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAE 1154
             + D  NS+GII++RS +     +NI   IRH + + ER  + KQ N E
Sbjct: 182  GLFDSVNSVGIIRDRS-FPYTQRSNIVNHIRHALAIDERRGKFKQQNFE 229

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 147,353,443
Number of extensions: 6616235
Number of successful extensions: 20813
Number of sequences better than 10.0: 74
Number of HSP's gapped: 21462
Number of HSP's successfully gapped: 160
Length of query: 1512
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1389
Effective length of database: 39,377,481
Effective search space: 54695321109
Effective search space used: 54695321109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)