Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003906.28ON38038018590.0
Kpol_1037.236.28ON37837911621e-158
Suva_15.1726.28ON39838111051e-149
NDAI0C026506.28ON38939010961e-148
NCAS0D021406.28ON37638010801e-146
YOL003C (PFA4)6.28ON37837910791e-146
Smik_15.1676.28ON37837910791e-146
TDEL0G044106.28ON38138010691e-144
CAGL0E02497g6.28ON37637910631e-143
Skud_15.1596.28ON37938010441e-141
ZYRO0C07546g6.28ON37737910341e-139
SAKL0E01518g6.28ON37938010071e-135
Ecym_30326.28ON3773809951e-133
ACL003C6.28ON3753799391e-125
KLTH0C10978g6.28ON3773809331e-124
Kwal_56.224596.28ON3833809261e-123
KLLA0C06204g6.28ON3773799141e-121
KNAG0F029306.28ON3863859081e-120
KAFR0A051306.28ON3964018821e-116
TBLA0B004806.28ON3774124772e-55
Kpol_1014.293.12ON3261142035e-17
TBLA0H001503.12ON3451462029e-17
NCAS0E013003.12ON327632001e-16
TPHA0P015603.12ON331702001e-16
KNAG0K025703.12ON3281401964e-16
TDEL0A003103.12ON3291091948e-16
SAKL0C13596g3.12ON333791948e-16
Kwal_55.221263.12ON360711941e-15
CAGL0D02508g3.12ON332701931e-15
KAFR0A085903.12ON331791931e-15
Ecym_20143.12ON339751885e-15
ZYRO0C03410g3.12ON3271271885e-15
NDAI0G013403.12ON335511877e-15
Smik_14.63.12ON3341211878e-15
KLLA0E02069g3.12ON325711832e-14
YNL326C (PFA3)3.12ON3361211814e-14
Suva_14.153.12ON330811814e-14
KLTH0F19580g3.12ON342751815e-14
Skud_14.153.12ON3361881798e-14
NCAS0B035908.286ON329751789e-14
KAFR0B053708.286ON329711753e-13
ZYRO0C04092g8.389ON366781736e-13
SAKL0H16434g8.286ON555771747e-13
CAGL0B01991g8.286ON330741718e-13
ADL197C3.12ON3901071711e-12
NCAS0C029208.389ON374951692e-12
Skud_12.3218.389ON356601682e-12
TPHA0C010708.286ON333601673e-12
YLR246W (ERF2)8.389ON3591571673e-12
NDAI0J010008.286ON339911673e-12
Smik_12.3068.389ON359601673e-12
TDEL0F051308.389ON359851665e-12
ZYRO0D06600g8.286ON330491647e-12
SAKL0H13860g8.389ON3521541647e-12
TBLA0D040408.286ON329491639e-12
Suva_10.3428.389ON356601631e-11
TPHA0C023608.389ON404751631e-11
Skud_4.3878.286ON336731621e-11
TDEL0F041308.286ON328931621e-11
KLTH0F08668g8.389ON358841584e-11
YDR126W (SWF1)8.286ON336491576e-11
KNAG0A027108.389ON354931576e-11
Smik_4.3728.286ON335661567e-11
Ecym_42828.286ON3401261567e-11
KLLA0D18370g8.389ON355811568e-11
NDAI0G022508.389ON389851569e-11
Ecym_41788.389ON3681201541e-10
Kpol_1033.168.286ON321681532e-10
Suva_2.2898.286ON335491532e-10
Kwal_56.236978.286ON338691513e-10
KAFR0H019808.389ON361601523e-10
Kwal_23.33028.389ON353581495e-10
CAGL0G08217g8.389ON326601487e-10
KLTH0G13112g8.286ON349701479e-10
KLLA0F19690g8.286ON324701452e-09
AGL125C8.389ON367611452e-09
TBLA0H009208.389ON360601433e-09
AGR065W8.286ON326441381e-08
KNAG0H031108.286ON331681372e-08
Skud_4.7345.579ON380651274e-07
YDR459C (PFA5)5.579ON374621231e-06
NCAS0F013905.579ON374661231e-06
TBLA0E028305.579ON3861041231e-06
KAFR0I011105.579ON370731212e-06
Ecym_41145.579ON372851202e-06
TDEL0A044405.579ON365721193e-06
Suva_2.6345.579ON388651177e-06
NDAI0H018905.579ON406661142e-05
Kwal_47.183665.579ON356661132e-05
KLTH0G04972g5.579ON367741122e-05
Kpol_1004.575.579ON362951122e-05
Smik_4.7375.579ON378621122e-05
KNAG0C028305.579ON354531113e-05
NCAS0C052805.626ON757961124e-05
SAKL0G06160g5.579ON364571096e-05
TPHA0C003705.626ON7591011106e-05
Suva_2.4325.626ON763681098e-05
CAGL0K06347g5.579ON352611071e-04
NDAI0H008505.626ON786681071e-04
ZYRO0C11132g5.626ON7591031043e-04
ZYRO0D13860g5.579ON365721024e-04
KAFR0H005705.626ON757651025e-04
Skud_4.5275.626ON764681025e-04
KLTH0E02420g5.626ON734581018e-04
Kpol_526.325.626ON77757990.001
KLLA0D06149g5.579ON34993970.002
Smik_4.5155.626ON76453980.002
TBLA0J008305.626ON739104960.003
TDEL0A049205.626ON75099960.003
CAGL0M08712g5.626ON76356960.003
YDR264C (AKR1)5.626ON76453950.004
KNAG0C062305.626ON75256940.005
ABR203W5.579ON35949930.006
Suva_8.875.626ON73076920.008
Ecym_13305.626ON73977910.011
Smik_15.2135.626ON74456890.018
YOR034C (AKR2)5.626ON74954890.021
AER388C5.626ON72470870.031
SAKL0G07326g5.626ON73754860.049
Skud_15.1995.626ON74142790.30
KNAG0B031405.626ON68253790.34
ACL040C7.281ON34260770.41
TBLA0H022505.102ON55737760.69
KLLA0E16721g5.626ON75256722.2
Smik_7.2674.97ON66743687.6
YGL023C (PIB2)4.97ON63543679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00390
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   720   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   452   e-158
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   430   e-149
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     426   e-148
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   420   e-146
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   420   e-146
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   420   e-146
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   416   e-144
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   414   e-143
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   406   e-141
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   402   e-139
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   392   e-135
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   387   e-133
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   366   e-125
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   363   e-124
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   361   e-123
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   356   e-121
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   354   e-120
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   344   e-116
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   188   2e-55
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    83   5e-17
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    82   9e-17
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    82   1e-16
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    82   1e-16
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    80   4e-16
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    79   8e-16
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    79   8e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    79   1e-15
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    79   1e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    79   1e-15
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    77   5e-15
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    77   5e-15
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      77   7e-15
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    77   8e-15
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    75   2e-14
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    74   4e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    74   4e-14
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    74   5e-14
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    74   8e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      73   9e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    72   3e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    71   6e-13
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    72   7e-13
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    70   8e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    70   1e-12
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     70   2e-12
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    69   2e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    69   3e-12
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    69   3e-12
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    69   3e-12
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    69   3e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    69   5e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    68   7e-12
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    68   7e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    67   9e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    67   1e-11
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    67   1e-11
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    67   1e-11
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    67   1e-11
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    65   4e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    65   6e-11
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    65   6e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    65   7e-11
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    65   7e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    65   8e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     65   9e-11
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    64   1e-10
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    64   2e-10
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    64   2e-10
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    63   3e-10
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    63   3e-10
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    62   5e-10
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    62   7e-10
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    61   9e-10
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    60   2e-09
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    60   2e-09
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    60   3e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    58   1e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    57   2e-08
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    54   4e-07
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    52   1e-06
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    52   1e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    52   1e-06
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    51   2e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    51   2e-06
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    50   3e-06
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    50   7e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    49   2e-05
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    48   2e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    48   2e-05
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    48   2e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    48   2e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    47   3e-05
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    48   4e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    47   6e-05
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    47   6e-05
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    47   8e-05
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    46   1e-04
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    46   1e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    45   3e-04
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    44   4e-04
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    44   5e-04
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    44   5e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    44   8e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    43   0.001
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    42   0.002
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    42   0.002
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    42   0.003
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    42   0.003
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    42   0.003
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    41   0.004
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    41   0.005
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.006
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    40   0.008
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    40   0.011
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    39   0.018
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    39   0.021
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    38   0.031
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    38   0.049
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    35   0.30 
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    35   0.34 
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    34   0.41 
TBLA0H02250 Chr8 (543632..545305) [1674 bp, 557 aa] {ON} Anc_5.1...    34   0.69 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    32   2.2  
Smik_7.267 Chr7 complement(442158..444161) [2004 bp, 667 aa] {ON...    31   7.6  
YGL023C Chr7 complement(450197..452104) [1908 bp, 635 aa] {ON}  ...    30   9.6  

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/380 (92%), Positives = 351/380 (92%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTP        
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                    FNQIINGKTQIEDWEMDRLENRFY            WELYPELKSAKHDEE
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 361 WFNEWGENLEDFGVDVEMEN 380
           WFNEWGENLEDFGVDVEMEN
Sbjct: 361 WFNEWGENLEDFGVDVEMEN 380

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 276/379 (72%), Gaps = 1/379 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK K+PWMGIAIPC LISFI Y +HY+IL   LS+ KQ +FE S+TMIW+SYY+AI  
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPGKPG N+ P  ++W+N+CKKCN YKPER+HHCKTC QCVLMMDHHCPWTMNC+G+ NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL W++ TT +LL++ I RI+++W +RNLPSYLF +SE+I L + TP        
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQ+++G+TQIE WE +RLE+ FY            WE +PELK+  ++ +
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           AE+++ K+ IR+D +V+FPYDLG+  NIT ++G P+ WLW +G PSG+GM F+KNE +LF
Sbjct: 241 AEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           + DS L    L+LPWPPD G+H  +   ++ +++E  T DGE V+R R+     + SR +
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 361 WFNEWGENLEDFGVDVEME 379
           W+N+WGENLEDFGVD+++E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  430 bits (1105), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 199/381 (52%), Positives = 265/381 (69%), Gaps = 5/381 (1%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M VK KWPW+GIAIP  LISFIGY +HY+IL   LS+ KQ  FE SL+MIWVSYY+AI  
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPGKP   ++P P+ W N+CKKC NYKPERSHHCK CNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RF+ W++ATTGFL   Q+KR+ ++W  R+LP YLF++SE++ L + TP        
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                    FNQIING++QIE W+MDRLE+ F             W +YPE +S + + +
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           AE+L+ +  IR++ +VNFPY++ +F N T  +G    WLWP G P+G+G +F+KN+I+ +
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSN--VEFITTDGEQVVRNRTHAKNPILSR 358
           + +SSL    L+LPWPPD G+    KT +  SN  +E     GEQVVR+R        +R
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGK---IKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATR 377

Query: 359 EEWFNEWGENLEDFGVDVEME 379
           E+W+N+WGE+L+DFGVDV+ME
Sbjct: 378 EKWYNDWGESLDDFGVDVDME 398

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  426 bits (1096), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/390 (53%), Positives = 268/390 (68%), Gaps = 14/390 (3%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M +K K+PW+G+AIP  +ISFIGY SHY+IL   LS+ KQ +F+FSL+MIWVSY +AI  
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGKPGKNFKPL----PHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIG 116
           NPGKP KN KP+      +W   CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNC+G
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 FNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXX 176
           + NFPHF+RFL+WI+ TTGFLL + +KR + MWN R+LPSY+F+R+E+I L +  P    
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 XXXXXXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAK 236
                         NQI+ G TQIE WE++RLEN FY            WE+YP  ++  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 HDEEAERLI-EKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKN 295
            D  A+ L+  +K +R+++IVNFPYD+ I+ N+  ++G    W+W FG P  NG+ FEKN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 296 EIALFDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPI 355
           EI+L++P SS+    L+LPWPPDKGR+  S   N D++VE +  DGEQVVRNR      I
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFIS---NKDTSVESLVYDGEQVVRNRASNDTNI 357

Query: 356 ------LSREEWFNEWGENLEDFGVDVEME 379
                 +SREEW N+WGE+L DFGVD+E E
Sbjct: 358 STINKDISREEWNNDWGESLVDFGVDIEAE 387

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  420 bits (1080), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/380 (51%), Positives = 265/380 (69%), Gaps = 5/380 (1%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK K+PWMG+ IPC+L SFIGY +H ++L   +S   Q +F+ SLTM+W+SY +AI  
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG+P K+FKPL  EW +FCKKC  +KPER+HHCKTCNQCVLMMDHHCPWTMNC+GF NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL W++ TTGFLL+  +KR IY+W  ++LPSYLFE++E+  L +  P        
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQII GKTQIE WE++RLEN +Y            WE+YP  K+ ++   
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AERLIEK-KGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIAL 299
           A++L E+ + +R+++IV FPYDL I+ N   ++G P+ WLW FGGP  +GM+F+KNE+AL
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 300 FDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSRE 359
           ++  +++    L+LPWPPD GR+   +     +NVE IT +GEQV+R R   +N    R+
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQ---KGTNVESITENGEQVIRQRNF-ENDNSYRK 356

Query: 360 EWFNEWGENLEDFGVDVEME 379
            W N+WGENLEDFGVDV++E
Sbjct: 357 TWNNDWGENLEDFGVDVDVE 376

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 197/379 (51%), Positives = 257/379 (67%), Gaps = 1/379 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK +WPW+GIAIP  LISFIGY +HY+IL   LS+ KQ  FEF L+MIW+SYY+AI  
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG+P  N+KP P  WRNFCKKC +YKPERSHHCKTCNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL WI+ TT  L   Q KRI ++W  R+LP Y F++SE+I L + +P        
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                    FNQI+NG++QIE W+MDRLE+ F             W +YPE +S ++ ++
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           AE  + KK  R+D +VNFPYD  ++ N    +G    WLWP+G P+G+G NF KN I+ +
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           + +SSL    L+LPWPPD G+  N+   +  S +E     GEQ++R R        SRE+
Sbjct: 301 EANSSLEDHILSLPWPPDGGK-TNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359

Query: 361 WFNEWGENLEDFGVDVEME 379
           W+N+WGE+L+DFGVDV+ME
Sbjct: 360 WYNDWGESLDDFGVDVDME 378

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/379 (51%), Positives = 253/379 (66%), Gaps = 1/379 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M VK +WPW+GIAIP +LISFIGY +HY+IL   L + KQ  FEFSL+MIW SYY+AI  
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG+P  N++P P  W NFCKKC NYKPERSHHCKTCNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL WI+ TT  L   Q+KRI ++W  RN P YLF++SE+  L + +P        
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                    FNQI+NG++QIE W+MDRLE+ F             W +YPE K+ +H+ +
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           AE L++++   ++ +VNFPY+  +  N    +G    WLWP+G P+GNG NF KN+I+ +
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           + DS L    L+LPWPPD G         T S +E     GEQVVR+R        SRE+
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKT-STIETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 361 WFNEWGENLEDFGVDVEME 379
           WFN+WGE+L+DFGVDV+ME
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  416 bits (1069), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 253/380 (66%), Gaps = 1/380 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK KWPW+GIAIPCVL+SFIGY  H++IL   LS  KQ +F+ +L +IW+SYY AI  
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG+P  NF+   +EW+N+CKKC NYKPER+HHCKTCNQCVLMMDHHCPWTMNC+G NNF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL+W++  T FLL+  + RII +W +RNLP Y+F RSE++ L + TP        
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQI NG +QIE WE++RL+  F             W+++P  +   ++  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           A  L   K +R + +VNFPYDL  + N   L+G PL WLWPFG P G+GM+F KNEI+ +
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
              +S     L+LPWPPD GR   +   +  S++E IT  GEQ++R R +  + ++ R +
Sbjct: 301 SSRASYEDLLLSLPWPPDGGR-TRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359

Query: 361 WFNEWGENLEDFGVDVEMEN 380
           W N+WGENLEDFGVDV+ E 
Sbjct: 360 WQNDWGENLEDFGVDVDTEQ 379

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  414 bits (1063), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 257/379 (67%), Gaps = 3/379 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK KWPW+GIAIP  LI+ IGY +HY+IL   LSL KQ +++F  TMIW+SYY+AI  
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
            PGKP  NFKP  +EW+ +CKKC  YKPERSHHCKTCNQCVLMMDHHCPWTMNC+G+NNF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL W++  T  L  +   RI  +W +R+ PSYL+ +SE+I L + TP        
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                    FNQI NG++QIE WEMDRLE                W ++P L++   + +
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           AE L+ KK +  D +VNFPYDLG F+N   L+G P  WL+PF GP  +G++F+KNE ++ 
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           +  +SL    L LPWPPD  +H NS + +T SNV+ I+ +GEQV+R RT  K   LSR E
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHT-SNVQIISEEGEQVIRIRTPEKK--LSRSE 357

Query: 361 WFNEWGENLEDFGVDVEME 379
           W N+WGE+LEDFGVDV++E
Sbjct: 358 WLNDWGESLEDFGVDVDVE 376

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  406 bits (1044), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 255/380 (67%), Gaps = 2/380 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M VK KWPW+GIAIP  LISFIGY +HY+IL   LS+ KQ  FE SL+MIWVSYY+AI  
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           N G+P  N++P P  W NFCKKC +YKPERSHHCK CNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL W++ TT  L   Q+KRI ++W  R+LP YLFE+SE+I L + +P        
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQIING++QIE W+MDRLE+               W +YPE +S++H+ +
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AERLIEKKG-IRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIAL 299
           A++L+ ++G  R+D +V+FPY+     N    +G    WLWP+G P+G+G +F KN+I+ 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 300 FDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSRE 359
           ++ +S L    L+LPWPPD G    + + + +S +E     GEQ+VR+R         RE
Sbjct: 301 YEVNSPLEDIILSLPWPPD-GNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIRE 359

Query: 360 EWFNEWGENLEDFGVDVEME 379
           +W+N+WGE+L+DFGVDV+ME
Sbjct: 360 KWYNDWGESLDDFGVDVDME 379

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  402 bits (1034), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/379 (51%), Positives = 254/379 (67%), Gaps = 2/379 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPV+ KWP++GIAIPC LISFIGY +HY+IL   LS  KQ +FEFSLTMIW SYY+AI  
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
            PG+P  NF+P  + W+++CKKC NYKPER+HHCKTCNQCVL MDHHCPWT NC+G+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHFMRFL W++ATTG+LL+    R  ++ +N N P+YL+ +SE+I L +  P        
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQI  G+TQIE WE +RLE  +Y            WELYPEL++ + ++E
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           A RL  ++ I  D +VNFPYD+  + N    +G PL+WLWPFG P G+GM F KN+I+ F
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           + +++L    LALPWPPD G+ +   +++  + VE    DGEQV+R R        SR +
Sbjct: 301 E-ETNLTDMLLALPWPPDGGK-DKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358

Query: 361 WFNEWGENLEDFGVDVEME 379
           W N WGENLEDFGVDV+ E
Sbjct: 359 WQNTWGENLEDFGVDVDAE 377

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  392 bits (1007), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 192/380 (50%), Positives = 243/380 (63%), Gaps = 2/380 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M VK KWPW+GIAIP  LISFIGY +HY+IL   L   KQ +FEFSL MIW+SYY+AI  
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPGKP   F+P   EW NFC KCNNYKPER+HHCK CNQCVL MDHHCPWTMNC+G  NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
            HF+RFL W++ TT FLL Y +KRI+++WN R++P+Y   RSE+I L + TP        
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQI+ G TQIE WEMDR+EN F+             E+ P   S   D++
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLS-NQDDD 239

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
             +L+ +  +  D IVNFPYDL  + N    +G    W+ P+G   GNGM FEKNE++++
Sbjct: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSN-VEFITTDGEQVVRNRTHAKNPILSRE 359
           +P+  +    L+LPWPPD GRH        D N VE  T DGE+VVR R       + R+
Sbjct: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359

Query: 360 EWFNEWGENLEDFGVDVEME 379
           +W+N+WGENL DFGVD++ E
Sbjct: 360 KWYNDWGENLADFGVDLDEE 379

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  387 bits (995), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 249/380 (65%), Gaps = 3/380 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK KWPW+GIAIPC LI+FIGY +  ++L+  LS+ +Q +F+FSLTMIW+SYY AI  
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG P   F+PL HEW+N+CKKC N+KPER+HHCKTC QCVL+MDHHCP+TMNC+G+NNF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHFMRFL WI+ TT +L     KR  ++WN R+  + L  + E+I L + TP        
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQ++NG TQIE WEMDR+E+ FY             ELYP      H  E
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG-HKGE 239

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
            +R++  + I ++ +VNFPYD   ++N+   +G  L WL PFG P+GNGM FEKNE++ +
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           +  S+L    L+LPWPPD  R  NS   N+   VE  T +GE ++R R+      LSR E
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERAPNSS--NSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357

Query: 361 WFNEWGENLEDFGVDVEMEN 380
           W+N+WGENL  FGVDV+ ++
Sbjct: 358 WYNDWGENLAHFGVDVDADD 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  366 bits (939), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 236/379 (62%), Gaps = 4/379 (1%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M V  KWPW+G+AIPC LISF GY +H+++L   LS  +  +F+ SL+MIW+SY+ AI  
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG+P K F+PL +EW+N+C KC  YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
                   WI+ATTG LL Y +KRI + W NR   + L  + E+I L + TP        
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQI+NG+TQIE WEMDR+EN FY             E+YP     + ++E
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
            E  +      +D ++NFPYD+  + N+   +G PL WL PFGGP  +GM F+KNEI+ +
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           D  +S+    LALPWPPD  RH  +    + S+VE  T  GEQVVR R H    +  R E
Sbjct: 300 DEATSIQDKLLALPWPPDDTRHGIA--FPSVSHVEKDTQGGEQVVRRR-HVPIAVPPRNE 356

Query: 361 WFNEWGENLEDFGVDVEME 379
           W+N+WGE+LE FGVDVE+E
Sbjct: 357 WYNDWGESLEHFGVDVEVE 375

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  363 bits (933), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 173/380 (45%), Positives = 235/380 (61%), Gaps = 3/380 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPV+ KWPW+GIA+P  LI++IGY SHY+IL+   S  +Q +FEFSLT+IWVSY  AI  
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG+P  NF+P  H+W+N+CKKC+NYKPER+HHCKTC QCVL MDHHCPWTMNC+G NNF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL W++ TT +L     +R    W +RN   ++   SE+  LFV  P        
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQ +NG TQIE WE DR+EN F+             EL+PE      +  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPE--DTFDEGA 237

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           A++L+  K +  + I+NFPYD+ I +N+ + +G    W  P G P   G  F  N+++ +
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           D  +S+    L+LPWPPD GR  + ++ +  S +E  ++ GE  +RNR+      + R E
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 361 WFNEWGENLEDFGVDVEMEN 380
           W N+WGENL DFGVDV+ E 
Sbjct: 358 WHNDWGENLSDFGVDVDAET 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  361 bits (926), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 237/380 (62%), Gaps = 3/380 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPVK KWPW+GIAIP  LI+FIGY SHY+IL   LSL +Q +F+  L+MIW+SY +AI  
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPGKP   F+PLPH+W+N C+KC  YKPER+HHCKTC+QCVL+MDHHCPWTMNC+G NNF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHF+RFL+W++ TT +L F   KRI   W  R+   Y+ ++ E++ +F+ TP        
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                     NQ + G TQIE WE +R+EN+F              E+Y +     +   
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
           A++LI  + ++ + IVNFPYDL I  N    +G  L  + P+  P GNG+ F KN+++ +
Sbjct: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           D   ++    L+LPWPPD GR   +      S +E  ++ GE V+R R       + R E
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 361 WFNEWGENLEDFGVDVEMEN 380
           W+N+WGENL DFGVDVE E 
Sbjct: 358 WYNDWGENLSDFGVDVESET 377

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  356 bits (914), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 237/379 (62%), Gaps = 2/379 (0%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M +K K  W+G+AIP  L++ IGY SHY+IL   LS  +Q +++   TMIWVSYY+AI  
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           NPG P K+FKP   EW N+CKKC  YKPER+HHCKTCNQCVL MDHHCPWT+NC+G +NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXX 180
           PHFMRFL W++ +T +LLF  I RI  +W+ R+   +    SE+I + + TP        
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 XXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKSAKHDEE 240
                    +NQ ++G TQIE WEMDR+++  Y             E  PE+  AK   E
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQ-HE 239

Query: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300
             +L+ K+ +  +   NFPYD+  + NI   +G    WLWP+  P   G +F KNE+  +
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360
           DP+SS+    ++LPWPPD G  ++S+ L + S++E I + GEQV+R+++      L R  
Sbjct: 300 DPNSSIEDMLMSLPWPPD-GLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358

Query: 361 WFNEWGENLEDFGVDVEME 379
           W+N+WGE+L DFGVD E+E
Sbjct: 359 WYNDWGEDLSDFGVDTELE 377

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 237/385 (61%), Gaps = 13/385 (3%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           MPV+ K PW GIAIPC LI FIGY +H++ILR  LS  +Q  F+F LTMIW+SYYMAI  
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGKP--GKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFN 118
           NPGKP  G   +    +   +C KCN +KPERSHHCKTC QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLP----SYLFERSEVIALFVCTPXX 174
           NFP FMRFL+W++ TT  L +Y + RI  +W  RN+P           E+++L V TP  
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 XXXXXXXXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXXXWELYPELKS 234
                           NQ+I G TQIE WEM+RL+N FY            WE +P  ++
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 AKHDEEAERLIE--KKG-IRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMN 291
            +H+ EAE+L+E  ++G +++ S+VNFPYD+ +  NI   +G P+  LWPF    GNG+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 292 FEKNEIALFDPDSSLPVFTLALPWPPDKGRH-NNSKTLNTDSNVEFITTDGEQVVRNRTH 350
           F+KN+I+ ++ + S+    L L WPPD GR   + +  +    ++    DGE ++R R  
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358

Query: 351 AKNPILSREEWFNEWGENLEDFGVD 375
             +PI SR  W N+WGE LE FGVD
Sbjct: 359 -NSPIESRTTWENQWGETLEGFGVD 382

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 179/401 (44%), Positives = 240/401 (59%), Gaps = 27/401 (6%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M ++ KWPW+GIAIP  LISFIGY +HY+IL  HLS   Q +F+FSL+MIW+SYY+AI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGKPG-----KNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCI 115
           +PG P      ++ K +    R +CKKC+ YKP R+HHCKTCN+C+LMMDHHCPWTMNC+
Sbjct: 61  DPGSPSIADKNEDIKTI----RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCV 116

Query: 116 GFNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXX 175
           GF N+PHF+RFL W++ TT FLL    +RI ++W N    S L +R E++ L + TP   
Sbjct: 117 GFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDA 176

Query: 176 XXXXXXXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXXXXX-----XWELYP 230
                          NQI +G +QIE WEM+RLE+ FY                 + ++ 
Sbjct: 177 FILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFS 236

Query: 231 ELKSAKHDEEAERLI---EKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSG 287
                 + EE   L+   +K+ + + SI+NFPYD+ I  N T ++G    WL PFG P G
Sbjct: 237 IESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEG 296

Query: 288 NGMNFEKNEIALFDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSN-VEFITTDGEQVVR 346
           +GM+FE NEIA  +  S+L    L+LPWPPD       K+++  +  VE     GE V+R
Sbjct: 297 DGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLR 355

Query: 347 NRT--------HAKNPILSREEWFNEWGENLEDFGVDVEME 379
           NRT         A    LSR+ W NEWGENL+ FGVD+E E
Sbjct: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  188 bits (477), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 132/412 (32%), Positives = 201/412 (48%), Gaps = 71/412 (17%)

Query: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60
           M ++F  PW G+AIP  +I  +  +S++ IL+  L+  +  ++  +  MI  SYY+AI+ 
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGKPGKNFKPLPHEW-RNFCKKCNNYKPE----------------RSHHCKTCNQCVLM 103
            P        P P    ++F     N + +                R+HHCKTCN CV+M
Sbjct: 61  PP-------TPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVM 113

Query: 104 MDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFE--R 161
           MDHHCPWTMNC+G+ N+PHF+RFL W++ +T  LL   IK+   ++  RN P +L++  +
Sbjct: 114 MDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVK 173

Query: 162 SEVIALFVCTPXXXXXXXXXXXXXXXXXFNQIINGKTQIEDWEMDRLENRFYXXXXXXXX 221
            ++I L +  P                  NQI NG TQIE W+ + +EN+++        
Sbjct: 174 YKIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVA 233

Query: 222 -----XXXXWELYPELKSAKHDEEAERLIE--KKGIRYD----SIVNFPYDLGIFKNITA 270
                       Y +  S     + ++LI   + G R++    SI+NFPYDLG+  NIT 
Sbjct: 234 LQLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITT 293

Query: 271 LVGQ--PLYWLWPFGGPSGNGMNFEKNEIALFDPDSS---LPVFTLALPWPPDKGRHNNS 325
            +G   PL W  P+  P     N + NE A++D + +   +    L LPWP         
Sbjct: 294 TMGSLNPLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWP--------- 343

Query: 326 KTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREEWFNEWGENLEDFGVDVE 377
             LN  +N  F   DGE VV++               N++GE L+DFGVD +
Sbjct: 344 --LNYSNNSTF--QDGELVVKS---------------NDYGETLQDFGVDYD 376

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 82.8 bits (203), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 57/114 (50%), Gaps = 26/114 (22%)

Query: 53  SYYMAIIINPGKP-------GKNFK------------------PLPHEWR-NFCKKCNNY 86
           +YY  II+ PG P        +N K                   L H+ R   C+ CN +
Sbjct: 53  TYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFRVCRTCNVW 112

Query: 87  KPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLFY 140
           KP+R HHC  C++C+L MDHHCPW   C+GF N  +F++FL++       ++ Y
Sbjct: 113 KPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMTY 166

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 67/146 (45%), Gaps = 36/146 (24%)

Query: 38  IKQCYFEFSLTMIW-------VSYYMAIIINPGKP----------------GKNFKP--- 71
           IK   + F +TM+W        +Y  A ++ PG P                G  F P   
Sbjct: 31  IKWINYTFMITMLWSLYLIGYYAYVQAFMVGPGSPSDFPELRVNSIEAAEAGTEFPPEYL 90

Query: 72  ------LPHEWR-NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
                 L H+ R   C+ C  +KP+R HHC +C++C+L MDHHCPW   CIGF N  +F+
Sbjct: 91  SQKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFI 150

Query: 125 RFLLWIMATTGFLLFYQIKRIIYMWN 150
            FL++      F+     K    +WN
Sbjct: 151 NFLIYNSLYATFVCLISSKE---LWN 173

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 44/63 (69%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFL 137
             C+ C  +KP+R HHC TC++C+L MDHHCPW   CIGF N  +F++FL++  A +  +
Sbjct: 99  RLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTAYSIVV 158

Query: 138 LFY 140
           LF+
Sbjct: 159 LFF 161

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ CN +KP+RSHHC TCN+CVL MDHHCPW   CIGF N   F++FL++   T  +++ 
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY-NTTYAYVIA 168

Query: 140 YQIKRIIYMW 149
               + +Y W
Sbjct: 169 ILTSKQMYNW 178

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 30/140 (21%)

Query: 29  YILRQHLSLIKQCYFE----FSLTMIWVSYYMAIIINPGKP-------------GKNFKP 71
           Y+  +H+ ++  C  +      +++   +Y+  I + PG P              +    
Sbjct: 22  YLCLEHVDVLSPCVVDPIVFLMVSLALYTYFRVINVGPGYPSDFPALKVLDMSAAEAGTE 81

Query: 72  LPHEWRN-------------FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFN 118
           LP E+                C+ C  +KP+R HHC +C++C+L MDHHCPW   C+GF 
Sbjct: 82  LPPEYLTKRSLTVKKDGRFRVCQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFR 141

Query: 119 NFPHFMRFLLWIMATTGFLL 138
           N   F++FLL+  A   F+L
Sbjct: 142 NQKLFIQFLLYTTAYAIFVL 161

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 55  YMAIIINPGKPGKNFKPLPHEWRN-------------FCKKCNNYKPERSHHCKTCNQCV 101
           Y  +++      +N   LP E+ +              C+ C+ +KP+R HHC  CN+C+
Sbjct: 70  YSELVVRDVAAAENGTELPPEFLSRRSITSKRDGRFRLCRTCHVWKPDRCHHCSACNRCI 129

Query: 102 LMMDHHCPWTMNCIGFNNFPHFMRFLLW-IMATTGFLLFYQIKRIIYMW 149
           L MDHHCPW  +C+GF N  +F++FL++  +     L+F  I+  +Y+W
Sbjct: 130 LRMDHHCPWLPDCVGFRNQKYFIQFLMYATLYAFNVLIFDTIQ--LYIW 176

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 72  LPHEWR-NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           L H  R   C+ C  +KP+RSHHC +CN+C L MDHHCPW  +CIGF N   F++FLL+ 
Sbjct: 96  LKHNGRFRICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY- 154

Query: 131 MATTGFLLFYQIKRIIYMW 149
             TT + +F  +   + +W
Sbjct: 155 --TTWYAVFVFMTTGLQLW 171

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           FC+ C  +KP+R HHC  CN+C L MDHHCPW  +C+G+ N  +F+ FLL+  A +  L+
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYS-ILV 190

Query: 139 FYQIKRIIYMW 149
           F+     + MW
Sbjct: 191 FFLTGADLLMW 201

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           CK C+++KP+R HHC TCN CVL MDHHCPW   C+G+ N   F++FL++    +  +L 
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVLI 165

Query: 140 YQIKRIIYMW 149
                 IY W
Sbjct: 166 LSSME-IYTW 174

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query: 72  LPHEWR-NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           + H+ R   C+ C  +KP+R HHC +CN+C+L MDHHCPW   CIGF N  +F++FL + 
Sbjct: 97  MKHDGRFRICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYC 156

Query: 131 MATTGFLLFYQIKRIIYMW 149
            + +  +LF    + IY W
Sbjct: 157 TSYSIIVLFVTSIQ-IYHW 174

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C  C  +KP+RSHHC +CN+C L  DHHCPW  +CIGFNN   F++FL++    +  + 
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 FYQIKRIIYMWNNRN 153
                +I+  + N+N
Sbjct: 169 IAATLQIVSWFRNQN 183

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 26/127 (20%)

Query: 53  SYYMAIIINPGKP-------------GKNFKPLPHEWRN-------------FCKKCNNY 86
           +YY  II  PG P              ++   LP E+ +              C+ C+ +
Sbjct: 54  TYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFLSRRSITTKRDGRFRVCRTCHVW 113

Query: 87  KPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLFYQIKRII 146
           KP+R HHC  C++C+L MDHHCPW   CIGFNN   F+++LL+    +  +  +   +++
Sbjct: 114 KPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIFLFSSIQLL 173

Query: 147 YMWNNRN 153
           + +N + 
Sbjct: 174 HWFNTKQ 180

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 37/51 (72%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLW 129
            C+ C  +KP+R HHC TCN+C+L MDHHCPW   CIGF N   F++FL++
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIY 158

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 55/121 (45%), Gaps = 26/121 (21%)

Query: 46  SLTMIWVSYYMAIIINPGKP-------------------------GKNFKPLPHEWR-NF 79
           +LT+   +YY  I   PG P                          K    L H+ R   
Sbjct: 46  TLTVALYTYYKVISRGPGSPLDFPDLIVHDLKAAENGLELPPEYISKRCMTLKHDGRFRV 105

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C+ +KP+R HHC +C+ CVL MDHHCPW   C GF N   F++FL++       +L 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLVLI 165

Query: 140 Y 140
           Y
Sbjct: 166 Y 166

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           FC+ C  +KP+R HHC  CN+C L MDHHCPW  +C+GF N   F++FL +    + ++L
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 139 FYQIKRIIYMW 149
                + +Y W
Sbjct: 164 LMTSAQ-LYSW 173

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 54/121 (44%), Gaps = 26/121 (21%)

Query: 46  SLTMIWVSYYMAIIINPGKP-------------------------GKNFKPLPHEWR-NF 79
           +L +   +YY  I   PG P                          K    L H+ R   
Sbjct: 46  TLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRV 105

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C+ +KP+R HHC +C+ C+L MDHHCPW   C GF N   F++FL++       +L 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLI 165

Query: 140 Y 140
           Y
Sbjct: 166 Y 166

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 62  PGKPGKNFKPLPHEWR-NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120
           P    K    L H+ R   C+ C+ +KP+R HHC +C+ C+L MDHHCPW   C GF N 
Sbjct: 87  PEYMSKRCMTLKHDGRFRVCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQ 146

Query: 121 PHFMRFLLWIMATTGFLLFYQ 141
             F++FL++       +L Y 
Sbjct: 147 KLFIQFLMYTTFYAFLVLIYS 167

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 9/75 (12%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLW--------- 129
           FC+ C  +KP+R HHC  C +C L MDHHCPW  +C+G+ N  +F++FL++         
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIF 164

Query: 130 IMATTGFLLFYQIKR 144
           +++ T  LL+++ +R
Sbjct: 165 LLSGTELLLWFKNQR 179

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 74/188 (39%), Gaps = 31/188 (16%)

Query: 46  SLTMIWVSYYMAIIINPGKP-------------GKNFKPLPHEWRN-------------F 79
           +L +   +YY  I   PG P              +N   LP E+ +              
Sbjct: 46  TLMVALYTYYKVISTGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCMTLKRDGRFRV 105

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C+ +KP+R HHC +C+ C+L MDHHCPW   C GF N   F++FL++      FL+ 
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYT-TFYAFLVL 164

Query: 140 YQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPXXXXXXXXXXXXXXXXXFNQIINGKTQ 199
                 +  W N    S  F R  +    + T                    Q+ N +T 
Sbjct: 165 IDTCYELGTWFN----SGSFSRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTT 220

Query: 200 IEDWEMDR 207
           IE   M R
Sbjct: 221 IELHSMRR 228

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C +YKP RS HC  C++CVL+ DHHC W  NC+G  N+ +F  FL+    T  F L 
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLI----TNTFSLT 192

Query: 140 YQIKRIIYMWNNRNL 154
           Y   R++ ++   N+
Sbjct: 193 YAFIRLLTIFYTTNV 207

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFL 137
            FC  C   KP RS HC  CN+CVL+ DHHC W  NCIG  N+ +F  FL+    +   L
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV----SNTLL 190

Query: 138 LFYQIKRIIYM 148
           L Y   RII +
Sbjct: 191 LGYAFLRIILL 201

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C  C  ++P R+ HC TC  C+L  DHHC W  NCIG  N+ +F+ FL   + ++ FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLI 239

Query: 139 FYQIKRIIYMWNNRNLPS 156
                  I+++++RNLPS
Sbjct: 240 ---ANCSIHIYHHRNLPS 254

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C+  KP RS HC  CN+C+LM+DHHC W  NCIG  N+ +F  FLL  +    +  F
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY-SF 190

Query: 140 YQIKRIIYMWNNRNLPS 156
            ++  I  M    N+ +
Sbjct: 191 LRLTSIQLMSQTENIKT 207

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C   KP RS HC  CN C+ + DHHC W  NC+G  N+ +F  FL     +   LL 
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL----CSNLLLLS 191

Query: 140 YQIKRIIYMWNNRN 153
           Y   R+I++  N++
Sbjct: 192 YSFIRLIFIQFNKS 205

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 50/107 (46%), Gaps = 26/107 (24%)

Query: 49  MIWVSYYMAIIINPGKP----------------GKNFKP---------LPHEWRN-FCKK 82
           +I  +Y+  I + PG P                G  F P         L    R+ +C K
Sbjct: 114 LILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVK 173

Query: 83  CNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLW 129
           C  +KP+R HHC  C++C L  DHHC W   CIG+NN   F+ FLL+
Sbjct: 174 CKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLY 220

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 49/95 (51%), Gaps = 17/95 (17%)

Query: 60  INPGKPGKNFKPLPHEWRN----------------FCKKCNNYKPERSHHCKTCNQCVLM 103
           ++ G   +NF+ +P E+ N                +CK C  ++P RS HC  C  CVLM
Sbjct: 149 VHLGSVQRNFQ-IPQEYYNQITLPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLM 207

Query: 104 MDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
            DHHC W  NC+G  N+ +F+ FL     T+ FL+
Sbjct: 208 HDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (66%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C+ C  ++P R+ HC TCN CV++ DHHC W  NC+G  N+  F+ FLL  + ++ FLL
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 34/60 (56%)

Query: 69  FKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           F  + +   N C  CN  KP RS HC  C  C+L+ DHHC W  NCIG  N+ +F  FLL
Sbjct: 128 FDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLL 187

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 27/157 (17%)

Query: 9   WMGI--AIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIIINPGKPG 66
           W+G+  AI C ++ F  + +H     Q+   +   +F +   +   S+      +PG   
Sbjct: 77  WLGVLLAIVCPMVLFSIFEAHKLWHTQNGYKVLVIFFYYFWVITLASFIRTATSDPGVLP 136

Query: 67  KNFK--------PLPHEWRN-----------------FCKKCNNYKPERSHHCKTCNQCV 101
           +N           +P E+ N                 +C  C  ++P RS HC TCN CV
Sbjct: 137 RNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNVCV 196

Query: 102 LMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           ++ DHHC W  NCIG  N+  F+ FLL  + ++  LL
Sbjct: 197 MVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C   KP RS HC+ CN C+L+ DHHC W  NCIG  N+ +F  FLL    T    + 
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCIT----MT 194

Query: 140 YQIKRIIYMWNNRNLPSYLFERSEVIALFVC 170
           Y   R+  M+   + PS    R+ +  L +C
Sbjct: 195 YSFIRLFLMYCQGHAPS---SRNILTLLILC 222

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 39/60 (65%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C+ C  ++P RS HC TCN CV++ DHHC W  NCIG  N+  F+ FLL  + ++  LL
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 54  YYMAIIINPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMN 113
           YY +I +    P  N  PL      +C  C  ++P R+ HC TC  CV+  DHHC W  N
Sbjct: 157 YYSSISL--PTPKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNN 214

Query: 114 CIGFNNFPHFMRFLLWIMATTGFLL 138
           C+G  N+ +F+ FL+  +    FL+
Sbjct: 215 CVGQRNYRYFIIFLIGTVLAELFLI 239

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           C+ C   KP RS HC  CNQCVL +DHHC W  NC+G  N+ +F  FL+
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLV 183

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 67/154 (43%), Gaps = 27/154 (17%)

Query: 10  MGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIIINPGKPGKNF 69
           M + IP VL S   + +H      +   +   +F +  T+ +VS+      +PG   +N 
Sbjct: 79  MLVTIPMVLFSI--FETHRLWYSDYGYKVLVVFFYYFWTLCFVSFIKTATTDPGVLPRNV 136

Query: 70  K--------PLPHEWRN-----------------FCKKCNNYKPERSHHCKTCNQCVLMM 104
                     +P E+ N                 +C  C  ++P R+ HC TC  C++  
Sbjct: 137 HVPSVENDYEIPQEYYNMITLPTGNPLIANIEVKYCTTCRIWRPPRASHCSTCEACIITH 196

Query: 105 DHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           DHHC W  NCIG  N+ +F  FL+  +  T F++
Sbjct: 197 DHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFII 230

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           CK C   KP RS HC  C+QC+L+ DHHC W  NCIG  NF +F  FL 
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 38/60 (63%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C  C  ++P RS HC TCN CV++ DHHC W  NCIG  N+  F+ FLL  + ++  LL
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C+ C  ++P RS HC  C+ CV+ +DHHC W  NC+G  N+ +F+ FL   + T  FLL
Sbjct: 195 YCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLL 254

Query: 139 FYQIKRIIYMWNNRN 153
              I   I++  NR+
Sbjct: 255 ---INTGIHIGKNRH 266

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 61  NPGKPGKNFKPLPHEWRNF-----CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCI 115
           N  +PG   K  P+++  +     C  C   KP RS HC  CN+C+L+ DHHC W  NCI
Sbjct: 113 NVHRPGSTEK-YPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCI 171

Query: 116 GFNNFPHFMRFLL 128
           G  N+  F  FL+
Sbjct: 172 GKGNYIQFYLFLI 184

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL--WIMATTGFL 137
           C+ C+  KP RS HC  C +CVL+ DHHC W  NCIG  N+  F  FL+   I  + GFL
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197

Query: 138 LFYQIKRIIYMWNNRNLPSYLFERSEVIALFVC 170
                 R++++   ++    ++ RS +I   +C
Sbjct: 198 ------RVLWISVMKDPSMVVYPRSILIFTILC 224

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 43/84 (51%), Gaps = 8/84 (9%)

Query: 53  SYYMAIIINPGKP-GKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWT 111
           SYY  I +    P GK           +C  C  ++P R+ HC TC  CVL  DHHC W 
Sbjct: 156 SYYNIITLPSAHPEGKTVDV------KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWV 209

Query: 112 MNCIGFNNFPHFMRFLL-WIMATT 134
            NCIG  N+ +F+ FL    +ATT
Sbjct: 210 NNCIGQRNYRYFLTFLASCCLATT 233

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           C  C   KP RS HC  CN+CVL+ DHHC W  NCIG  N+  F  FL+
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 16/93 (17%)

Query: 63  GKPGKNFKPLPHEWRN----------------FCKKCNNYKPERSHHCKTCNQCVLMMDH 106
           G PG+     P E+ N                +C  C  ++P R+ HC+ C  CV   DH
Sbjct: 153 GPPGQTPVQSPQEYYNIVTLPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDH 212

Query: 107 HCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           HC W  NC+G  N+ +F+ FL    AT   L  
Sbjct: 213 HCAWINNCVGQRNYRYFLTFLTATCATCTVLFV 245

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C  C+  KP RS HC  CN+C+L+ DHHC W  NCIG  N+  F  FL+    +  F L 
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLI----SNIFSLL 191

Query: 140 YQIKRI 145
           Y   R+
Sbjct: 192 YAFLRL 197

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (47%), Gaps = 9/126 (7%)

Query: 9   WMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIIINPGKPGKN 68
           + GI I C   SF+ Y+  Y  +R  L  ++       L +  +S Y  I+ +P      
Sbjct: 59  YTGIYIYC---SFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITY 115

Query: 69  FKP-LPHEWRNF-----CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPH 122
             P +P +   F     C+ C   K  RS HC  C +C+L+ DHHC W  NCIG  N+ +
Sbjct: 116 VGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQY 175

Query: 123 FMRFLL 128
           F  FLL
Sbjct: 176 FYLFLL 181

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (50%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C+ C  ++P RS HC  C+ CVL  DHHC W  NCIG  N+  F+ FL+    +   L+
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLI 232

Query: 139 FYQIKRIIYMWNNRNLPSYLF 159
                R+ Y    R  P  L 
Sbjct: 233 LLSSFRLSYSPQVRYTPVSLL 253

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 54  YYMAIIINPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMN 113
           YY  + +  G P             +C  C  ++P RS HC  C  C++  DHHC W  N
Sbjct: 197 YYNEVTLPTGNPESTINI------KYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNN 250

Query: 114 CIGFNNFPHFMRFLLWIMATTGFLL 138
           CIG  N+  F+ FLL    T+ FL+
Sbjct: 251 CIGQRNYRFFLTFLLSGTFTSIFLI 275

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 24/120 (20%)

Query: 43  FEFSLTMIWVSYYMAIIINPGKPGKNFK--------PLPHEWRN---------------- 78
           F +S T+ ++S+      +PG   +N           LP E+ +                
Sbjct: 128 FYYSWTLCFLSFIKTATTDPGTLPRNIHLPQLRNDYELPSEYYSIITLPSSSTNSPIQLK 187

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C  C  ++P R+ HC TCN C++  DHHC W  NC+G  N+ +F+ F+   + T   L+
Sbjct: 188 YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIILLV 247

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFL----LWIMATTG 135
           CK C   KP RS HC  C++C+L+ DHHC W  NCIG  N+  F  F+    L ++    
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFT 194

Query: 136 FLLFYQIK 143
            LLF  IK
Sbjct: 195 RLLFISIK 202

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           C  C   K  RS HC  CN+CVL+ DHHC W  NCIG  N+  F  FL 
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C   K  RS HC  C +C  + DHHC W  NCIG  N+ +F  FL    A+  FL  
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL----ASNVFLTV 186

Query: 140 YQIKRIIYM 148
           Y   R++Y+
Sbjct: 187 YGFTRLLYL 195

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C+ C  ++P R+ HC  C  CV+  DHHC W  NC+G  N+ +F+ FL+     + FLL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLL 236

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL--WIMAT 133
            +C  C  ++P R+ HC  C  C+L  DHHC W  NCIG  N+ +F+ FL+  W+ A 
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAV 228

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C  C  ++P R+ HC  C  CVL  DHHC W  NC+G  N+ +F+ FLL        L+
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL--WIMATTGFL 137
           C+ C   K  R+ HC  C+QCV + DHHC W  NCIG  N+ +F  FL+    +   GFL
Sbjct: 133 CRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFL 192

Query: 138 LFYQIKRIIY 147
               ++R ++
Sbjct: 193 RLLFLQRFVH 202

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C   K  RS HC  C +C+ + DHHC W  NC+G+ N+ +F  FLL    +   LL 
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL----SNCLLLT 184

Query: 140 YQIKRIIYMW 149
           Y   R++ ++
Sbjct: 185 YASLRLLTLF 194

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFL 137
            +C  C  ++P R+ HC  C+ C+L  DHHC W  NCIG  N  +F+ FL   + ++ +L
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWL 244

Query: 138 L 138
           L
Sbjct: 245 L 245

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 79  FCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLL 138
           +C  C+ ++P R+ HC  C  C+ + DHHC W  NC+G  N+ +F+ FL+  + ++ F++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 26/44 (59%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHF 123
           C+ C   KP RS HC  C +CV + DHHC W  NC+G  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C+ C+  K  RS HC  C +C+ + DHHC W   CIG  NF +F  FL    A    +L 
Sbjct: 139 CRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL----ACHCLILT 194

Query: 140 YQIKRIIY 147
           Y   R+ +
Sbjct: 195 YAFARLFF 202

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P K ++  PH +  +C  C + K ER+HH      CV   DH+C W    IG +N+  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFLLW 129
           +F+ +
Sbjct: 177 QFVAY 181

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P K ++  PH +  +C +C + K ER+HH      C+   DH+C W    IG +N+  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RF 126
           +F
Sbjct: 176 QF 177

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%)

Query: 64  KPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHF 123
           KP K ++   + +  +C  C + K  RSHH K   +C+L  DH+C W    I  NN+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 MRFLLW 129
           ++++ W
Sbjct: 162 LQYVGW 167

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P   ++  PH +  +C +C + K ER+HH      CV   DH+C W    IG +N+  F+
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 125 RFLLWIMATTGFLLFYQIKRIIYMWNNR-NLPSYLFERSEVIAL 167
           +F+ +       +    +  I  +   R N P + F  + +I L
Sbjct: 168 QFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIIL 211

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P K ++   + +  +C  C   K  RSHH    N C+   DH+C W    IG +N+  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 125 RFLLWIMATTGFL 137
            FL +   + G +
Sbjct: 164 IFLFYCTVSFGIM 176

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P   ++  P  +  +C  C + K ERSHH +    CV   DH+C W    IG  N+  FM
Sbjct: 112 PPDIYQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFM 171

Query: 125 RFLLWI---MATTGFLLFYQIKRII 146
           +++++    + T    +   +KRI+
Sbjct: 172 QYVMYFTIYLVTASLTIALFMKRIV 196

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C  C++ K ER+HH      CV   DH C W    IG +N+  F++F+++ MA     +F
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMY-MAILSLFVF 185

Query: 140 YQ----IKRIIY 147
                 I+RII+
Sbjct: 186 VPICAFIRRIIH 197

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P + ++  PH +  +C  C + K ER+HH      CV   DH+C W    IG +N+  F+
Sbjct: 122 PPRCYQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFV 181

Query: 125 RFLLW 129
           +F+ +
Sbjct: 182 QFVTY 186

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%)

Query: 64  KPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHF 123
           KP   ++  P+ +  +C  C + K ER HH +    C+   DH+C W    IG NN+  F
Sbjct: 101 KPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

Query: 124 MRFLLW 129
           ++++ +
Sbjct: 161 IQYVFY 166

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%)

Query: 64  KPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHF 123
           KP + ++  P  +  +C  C + K  R+HH  T   C+   DH+C W    +G  N+  F
Sbjct: 109 KPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLF 168

Query: 124 MRFLLW 129
           ++F  +
Sbjct: 169 VQFAFY 174

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P + ++  P  +  +C  C + K  R+HH  T   C+   DH+C W    +G  N+  F+
Sbjct: 117 PPRIYQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFV 176

Query: 125 RFLLWIMATTGFLL 138
           +F  +  A   F++
Sbjct: 177 QFAFYFWAFAIFVI 190

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C  C + K  R+HH K    C+   DHHC W    IG +N+  F +F+ +    +  LL 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SCLLLI 180

Query: 140 YQIKRIIYMWNNRNLP--SYLFERSEVIALFVCTP 172
           + I  + Y+    + P   Y  + + ++ L +  P
Sbjct: 181 FWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP 215

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%)

Query: 65  PGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFM 124
           P K ++  P+ +  +C  C + K ERSHH      C+   DH+C W    IG +N+  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RF 126
           +F
Sbjct: 176 QF 177

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
            +C  C + K  R+HH      CV   DH+C W    IG  N+  F++FL+++
Sbjct: 124 TWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYM 176

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATT 134
           + +NFC +    KP RSH        V   DH CPW  N IG  N  +FM F+L      
Sbjct: 452 DIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGI 511

Query: 135 GFLLFYQIKRI-IYMWNNRNLPSYLFERSEVIALFV 169
            F +   +K   I    N ++  +L    E+ A FV
Sbjct: 512 WFFISLTMKYFDILEDTNEDVACFLLGDDELCAGFV 547

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 73  PHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLW 129
           P  +  +C  C + K ER+HH  T   CV   DH+C W    +G  N+  F++F ++
Sbjct: 120 PQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMY 176

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 7/101 (6%)

Query: 74  HEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMAT 133
           ++  NFC +    KP RS +    N  V   DH+CPW  N +G  N   F+ F+L +   
Sbjct: 458 YDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSM--E 515

Query: 134 TGFLLFYQI-----KRIIYMWNNRNLPSYLFERSEVIALFV 169
           TG  LF  +      ++  ++++  L   L    E+ A F 
Sbjct: 516 TGIGLFTSLCLEYFDQLEDLYDDDKLKCLLLGDDELCAGFT 556

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATT 134
           + +NFC +    KP RS      N  V   DH+CPW  N +G  N   FM F+   +   
Sbjct: 466 DTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI--TLMEC 523

Query: 135 GFLLFYQI 142
           G L F+++
Sbjct: 524 GILTFFKL 531

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 69  FKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           ++  PH +  +C  C + K  R+ H      CV   DH+C W    IGF N+  F++F+ 
Sbjct: 105 YQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVF 164

Query: 129 W 129
           +
Sbjct: 165 Y 165

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATT 134
           + +NFC +    KP RS +    N  V   DH CPW  N +G  N  +F+ F+L + A  
Sbjct: 469 DSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEA-- 526

Query: 135 GFLLFYQI 142
           G + F  +
Sbjct: 527 GIITFASL 534

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 15/103 (14%)

Query: 43  FEFSLTMIWVSYYMAIII--NPGK--PGKNFKPLPH-----------EWRNFCKKCNNYK 87
           F   + ++ VSY + +++  +PG+    KN + +             + +NFC +    K
Sbjct: 412 FLLMIIILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGKFDSKNFCIETWVKK 471

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           P RS      N  V   DH+CPW  N IG  N   F+  +L +
Sbjct: 472 PLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 61  NPGKPGKN--FKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFN 118
           N G  G +  ++  P+ +  +C  C + K ER+HH +    CV   DH C +  + IG +
Sbjct: 106 NHGSDGSSICYQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKD 165

Query: 119 NFPHFMRFLLWI 130
           N+  F+++ +++
Sbjct: 166 NYRLFVQYCVFM 177

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATT 134
           + RNFC +    KP RS      N  V   DH+CPW  N IG  N   F+ F+  I    
Sbjct: 458 DTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFI--ISVEI 515

Query: 135 GFLLF 139
           G L+F
Sbjct: 516 GILIF 520

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATT 134
           + +NFC +    KP RS      N  V   DH+CPW  N +G  N   F+ F+   +  +
Sbjct: 467 DTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI--ALMES 524

Query: 135 GFLLFYQI 142
           G   F+ +
Sbjct: 525 GIFTFFAL 532

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMA 132
           + R+FC      KP RS   +     ++  DH CPW  N +G  N   F+ FLL +++
Sbjct: 449 DTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVS 506

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIM 131
           +  NFC + +  KP RS +    +  V   DH CPW  N IG  N   F+ F++ ++
Sbjct: 474 DTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMV 530

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 37/93 (39%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139
           C  C + K  R+HH      CV   DH+C W    +G  N+  F++F  ++      L+ 
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLILMI 187

Query: 140 YQIKRIIYMWNNRNLPSYLFERSEVIALFVCTP 172
               ++  M  + N   Y        AL +  P
Sbjct: 188 SIATQMRQMKGSANGNVYAVFALACCALLMAGP 220

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFL 127
           + ++FC +    KP RS +    N  V   DH+CPW  N +G  N   F+ F+
Sbjct: 467 DTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 41/104 (39%), Gaps = 13/104 (12%)

Query: 43  FEFSLTMIWVSYYMAIIINPGKPGKN-------------FKPLPHEWRNFCKKCNNYKPE 89
           F  S+  +   +Y  I  NPG+  +N              +    + R+FC +    KP 
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPL 477

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMAT 133
           RS         V   DH+CPW  N IG  N   F+ F+ +   T
Sbjct: 478 RSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 74  HEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFL------ 127
           ++ R+FC +    KP RS         +   DH+CPW  N +G  N   F+ F+      
Sbjct: 456 YDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVA 515

Query: 128 LWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIA 166
           +WI A      F +++   Y   N +L  +L   SE+ A
Sbjct: 516 VWIFAHLCLEYFDELED-NYDDYNGDLKCFLIGDSELCA 553

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           + R+FC +    KP RS +    +  +L  DH+CPW  N +G  N   F+ F+L +
Sbjct: 451 DTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILAL 506

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFL 127
           + +NFC +    KP RS      N  V   DH+CPW  N +G  N   F+ F+
Sbjct: 467 DTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           + +NFC +    KP R       ++ VL  DH+CPW  N +G  N   FM +++ +
Sbjct: 455 DTKNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           C  C + K  R+HH      CV  +DH+C W    IG  N+  F +FL+
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 10/76 (13%)

Query: 74  HEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMAT 133
           ++  NFC +    KP RS +       V   +H+CPW  N IG  N   FM F   +   
Sbjct: 425 YDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV--- 481

Query: 134 TGFLLFYQIKRIIYMW 149
                  Q +  ++MW
Sbjct: 482 -------QYEMFLFMW 490

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATT 134
           + ++FC       P RS +    N  +   DH+CPW  N IGF N   F+ F++++    
Sbjct: 451 DAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGV 510

Query: 135 GFLLFYQIKRIIYMWNN 151
              +   I+     W N
Sbjct: 511 FIFVRLSIRYFELEWQN 527

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 24/56 (42%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           +  NFC +    KP RS         V   DH CPW  N IG  N   F+ F L +
Sbjct: 440 DRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTV 495

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%)

Query: 77  RNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
            NFC +    KP RS +       V   DH+CPW  N +G  N   F+ F + +
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 57  AIIINPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIG 116
           A II   + GK      ++ ++FC       P R+ + +  +  +L  DH+CPW  N IG
Sbjct: 431 ATIIELLRVGK------YDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIG 484

Query: 117 FNNFPHFMRF 126
           F N   F+ F
Sbjct: 485 FRNHKIFIYF 494

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 24/54 (44%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128
           + ++FC      KP RS         V   DH CPW  N IG  N   F+ F+L
Sbjct: 447 DAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 19/42 (45%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNN 119
           NFC +    K  RS +       V   DH+CPW  N IG  N
Sbjct: 440 NFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN 481

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%)

Query: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
            FC K    KP R    K   Q V   DH+C W  N +G  N   ++ FL+ +
Sbjct: 403 TFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILL 455

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 12/60 (20%)

Query: 74  HEWRNFCKKCNNYKPERSHHCKTC-----NQCVLMMDH---HCPWTMNCIGFNNFPHFMR 125
           HE    CK C+    +R H  K C     + C LM DH   HCP TM C   N+  H+ +
Sbjct: 63  HEAEAKCKNCS----QRGHIKKNCPHVICSYCGLMDDHYSQHCPRTMRCSHCNDSGHYRQ 118

>TBLA0H02250 Chr8 (543632..545305) [1674 bp, 557 aa] {ON} Anc_5.102
           YHR151C
          Length = 557

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 252 YDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGN 288
           Y  I+N P+DL    NI  L+   L W W F  PS N
Sbjct: 332 YSPIINNPFDLSNITNILPLLNSSLLWSWRFNQPSVN 368

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%)

Query: 75  EWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWI 130
           + ++FC       P RS + +     +   DH CPW  N IG  N   F  F++ +
Sbjct: 463 DAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLL 518

>Smik_7.267 Chr7 complement(442158..444161) [2004 bp, 667 aa] {ON}
           YGL023C (REAL)
          Length = 667

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 72  LPHEWRNFCKKCNNYKP----ERSHHCKTCNQCVLMMDHHCPW 110
           +P   RN C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 482 IPDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 521

>YGL023C Chr7 complement(450197..452104) [1908 bp, 635 aa] {ON}
           PIB2Protein of unknown function; contains FYVE domain;
           similar to Fab1 and Vps27
          Length = 635

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 72  LPHEWRNFCKKCNNYKP----ERSHHCKTCNQCVLMMDHHCPW 110
           +P   RN C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 450 IPDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 489

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.481 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,840,338
Number of extensions: 1842511
Number of successful extensions: 6275
Number of sequences better than 10.0: 139
Number of HSP's gapped: 6220
Number of HSP's successfully gapped: 139
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)