Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003806.26ON35635615640.0
Kpol_1037.306.26ON3672897491e-96
TDEL0G044306.26ON3472446792e-86
KNAG0I017506.26ON3242486573e-83
ZYRO0C07634g6.26ON3822576562e-82
Smik_15.1696.26ON2912556447e-82
Skud_15.1616.26ON2932486352e-80
SAKL0E01408g6.26ON3072426327e-80
YOL001W (PHO80)6.26ON2932486318e-80
Suva_15.1746.26ON2952546273e-79
Kwal_56.224436.26ON2802436072e-76
KLTH0C11110g6.26ON2802456053e-76
TBLA0A071606.26ON2682466035e-76
CAGL0E02541g6.26ON3422486044e-75
KLLA0D01287g6.26ON3452365827e-72
ACR001C6.26ON3462435705e-70
Ecym_30296.26ON3512395671e-69
NCAS0D021506.26ON3692335273e-63
NDAI0C026406.26ON4272284424e-50
Smik_9.1407.240ON2851661547e-11
KNAG0D016307.240ON4381871551e-10
KAFR0I018407.240ON3251181522e-10
Suva_9.1497.240ON2861661493e-10
NCAS0E032207.240ON341891495e-10
YIL050W (PCL7)7.240ON2851661432e-09
KLLA0C08305g7.240ON409601442e-09
Skud_9.1197.240ON2851691422e-09
KAFR0L008807.240ON313601423e-09
ADL075W7.240ON2071101393e-09
Kpol_1033.137.240ON250601361e-08
TBLA0D040707.240ON661601401e-08
SAKL0F08602g7.240ON474601391e-08
ZYRO0C08118g7.240ON405601381e-08
TPHA0C010907.240ON385601372e-08
Kwal_23.58077.240ON465601372e-08
NDAI0E047707.240ON303571352e-08
Ecym_43367.240ON3851101362e-08
CAGL0M12342g7.240ON457601372e-08
NCAS0A134807.240ON448601363e-08
TDEL0H020207.240ON363601353e-08
KLTH0A04268g7.240ON580601363e-08
Smik_5.1897.240ON415601336e-08
Suva_5.1677.240ON424601328e-08
YER059W (PCL6)7.240ON420601311e-07
NDAI0A025607.240ON503601311e-07
Skud_5.1737.240ON420601311e-07
KNAG0L014707.240ON354601301e-07
CAGL0E02233g3.70ON26664860.031
Kpol_2000.147.289ON31065850.042
Kpol_1020.87.289ON29661840.057
NCAS0A137707.289ON31265830.066
YDL179W (PCL9)7.289ON30461820.11
Smik_4.607.289ON30555810.13
TBLA0J006507.289ON36374810.14
KNAG0A014903.70ON26253790.19
YDL127W (PCL2)7.289ON30865790.20
NCAS0D040706.236ON47352800.20
TPHA0A005803.70ON28962770.34
Suva_14.503.70ON27953770.35
ZYRO0C02068g3.70ON33064770.37
Skud_4.797.289ON30955770.38
TBLA0C048507.289ON36853770.39
Suva_4.687.289ON30555770.40
Kpol_1020.163.70ON28253760.48
ZYRO0C09284g7.289ON31165760.57
Smik_4.1107.289ON30865750.64
Ecym_80387.289ON31465750.65
NDAI0A022707.289ON33055750.69
Skud_14.483.70ON27953750.71
Suva_4.1187.289ON30961750.74
YNL289W (PCL1)3.70ON27953740.77
Kwal_23.60067.289ON30465740.80
Smik_14.423.70ON27953740.80
TPHA0P008107.289ON24753740.83
Skud_4.1287.289ON30863740.89
KAFR0H002105.702ON1454120750.96
Ecym_12013.527ON44453741.0
KNAG0B029307.289ON31255741.0
TPHA0A032507.289ON28955731.1
KLTH0A05346g7.289ON30165731.2
KAFR0A082803.70ON24155721.3
CAGL0J09328g7.289ON29755731.3
SAKL0F09856g7.289ON33555721.5
TDEL0H015507.289ON30965712.4
AFR159C7.289ON30859693.3
KAFR0L012007.289ON27974693.5
KLLA0C03179g1.127ON1478132704.5
TDEL0E007903.70ON25453667.2
KNAG0F018706.236ON48339678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00380
         (356 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   607   0.0  
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   293   1e-96
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   266   2e-86
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   257   3e-83
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   257   2e-82
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   252   7e-82
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   249   2e-80
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   248   7e-80
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   247   8e-80
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   246   3e-79
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   238   2e-76
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   237   3e-76
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   236   5e-76
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   237   4e-75
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   228   7e-72
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   224   5e-70
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   223   1e-69
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     207   3e-63
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   174   4e-50
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    64   7e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    64   1e-10
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    63   2e-10
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    62   3e-10
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    62   5e-10
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    60   2e-09
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    60   2e-09
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    59   2e-09
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    59   3e-09
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    58   3e-09
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    57   1e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    59   1e-08
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    58   1e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    58   1e-08
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    57   2e-08
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    57   2e-08
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    57   2e-08
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    57   2e-08
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    57   2e-08
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    57   3e-08
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    57   3e-08
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    57   3e-08
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    56   6e-08
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    55   8e-08
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    55   1e-07
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    55   1e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    55   1e-07
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    55   1e-07
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    38   0.031
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    37   0.042
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    37   0.057
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    37   0.066
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    36   0.11 
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    36   0.13 
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    36   0.14 
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    35   0.19 
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    35   0.20 
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     35   0.20 
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    34   0.34 
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    34   0.35 
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    34   0.37 
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    34   0.38 
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    34   0.39 
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    34   0.40 
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    34   0.48 
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    34   0.57 
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    33   0.64 
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    33   0.65 
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      33   0.69 
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    33   0.71 
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    33   0.74 
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    33   0.77 
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    33   0.80 
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    33   0.80 
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    33   0.83 
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    33   0.89 
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    33   0.96 
Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar t...    33   1.0  
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    33   1.0  
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    33   1.1  
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    33   1.2  
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    32   1.3  
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    33   1.3  
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    32   1.5  
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    32   2.4  
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    31   3.3  
KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {O...    31   3.5  
KLLA0C03179g Chr3 complement(282251..286687) [4437 bp, 1478 aa] ...    32   4.5  
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    30   7.2  
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    30   8.6  

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/356 (85%), Positives = 306/356 (85%)

Query: 1   MAEHLTFKXXXXXXXXXXXXXXXXXXXXXXXIETIMLPTSFLKCSRSDLVVLISRMLTFL 60
           MAEHLTFK                       IETIMLPTSFLKCSRSDLVVLISRMLTFL
Sbjct: 1   MAEHLTFKTNNIPNICNNTNHNDSDNNNDENIETIMLPTSFLKCSRSDLVVLISRMLTFL 60

Query: 61  IQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLTRFHSRVPPNISVNNYLIRLTKYAS 120
           IQINDRNEILTENNSAMIPTQTDV          LTRFHSRVPPNISVNNYLIRLTKYAS
Sbjct: 61  IQINDRNEILTENNSAMIPTQTDVNNKNNNNMINLTRFHSRVPPNISVNNYLIRLTKYAS 120

Query: 121 LEHXXXXXXXXXXXXXXXXXPEFKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGG 180
           LEH                 PEFKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGG
Sbjct: 121 LEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGG 180

Query: 181 VRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKKSSQFTLDLGDLLAANIQPELTHPN 240
           VRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKKSSQFTLDLGDLLAANIQPELTHPN
Sbjct: 181 VRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKKSSQFTLDLGDLLAANIQPELTHPN 240

Query: 241 SGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYIIQTNYNDTNISDIDDNRKVIQIYAQHI 300
           SGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYIIQTNYNDTNISDIDDNRKVIQIYAQHI
Sbjct: 241 SGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYIIQTNYNDTNISDIDDNRKVIQIYAQHI 300

Query: 301 TPQKRNYDDHVNILTKGEQIQQTDKSVMSKPEDGLPKVPKYSPEYAPKYNILNSNE 356
           TPQKRNYDDHVNILTKGEQIQQTDKSVMSKPEDGLPKVPKYSPEYAPKYNILNSNE
Sbjct: 301 TPQKRNYDDHVNILTKGEQIQQTDKSVMSKPEDGLPKVPKYSPEYAPKYNILNSNE 356

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  293 bits (749), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 155/289 (53%), Positives = 190/289 (65%), Gaps = 21/289 (7%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           IETI LP  F+ CSRSDLV LI+RML+FLI++ND N+    N     P    V       
Sbjct: 43  IETITLPPKFIDCSRSDLVALIARMLSFLIEMND-NDPANTNYLNEEPNNRSVMN----- 96

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHSRVPPNISV NYLIRLTKY+SLEH                 PEFKINSLTVH
Sbjct: 97  ---LTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVH 153

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATT+ASKGL DSFCTNSHY+KVGGV CSELNILET+FLRR+NYRIIPRDDNIKLC
Sbjct: 154 RFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271
           K+E + ++FT+D  DL    +  +  H NSG+N+L+IYY K+VQ+VG    S+DKS+K N
Sbjct: 214 KIEHQQNKFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKAN 273

Query: 272 YIIQTNYN------------DTNISDIDDNRKVIQIYAQHITPQKRNYD 308
           Y +  + N            ++N  +I ++ + I        P KRN++
Sbjct: 274 YTLLLSGNNMEKEVSNNIKENSNGQNIGESEQAISSKLSRDPPPKRNFE 322

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  266 bits (679), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 164/244 (67%), Gaps = 17/244 (6%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I TI LP  F KCSR+DL VLISRMLTFLIQIND   +    N+                
Sbjct: 30  ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENA---------------- 73

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHSRVPP ISV NYLIRLTKY+SLEH                 P F ++SLTVH
Sbjct: 74  -RGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVH 132

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVASKGL DSFCTN+HYAKVGGV  SELNILE +FL+R+NYRI+PRDDNI  C
Sbjct: 133 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWC 192

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271
           KLE K  +FTL     +  N +P+ +  NSGYNVL+ Y+RK+VQ+VG   +S DKSK VN
Sbjct: 193 KLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVN 252

Query: 272 YIIQ 275
           Y+++
Sbjct: 253 YVLR 256

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  257 bits (657), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 163/248 (65%), Gaps = 7/248 (2%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQIND----RNEILTENNSAMIPTQTDVXXX 87
           I+T+ LP++F  CSR DL+ LISRML FLIQIND    +   L ++        TD    
Sbjct: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKG---EATDAADT 77

Query: 88  XXXXXXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINS 147
                  LTRFHS VPP ISV NYLIRLTKY++LE                  P F INS
Sbjct: 78  DGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINS 137

Query: 148 LTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDN 207
           LTVHRFLL ATTVASKGL DSFCTN+HYAKVGGV+ SELNILE++FL++INYR++PRDDN
Sbjct: 138 LTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDN 197

Query: 208 IKLCKLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKS 267
           I  CK E ++ +FT+     L    +P  T  NSGYNVL +YY K++Q+VG   +S DKS
Sbjct: 198 ITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKS 257

Query: 268 KKVNYIIQ 275
           KK NY+ +
Sbjct: 258 KKANYVFE 265

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  257 bits (656), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 167/257 (64%), Gaps = 24/257 (9%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           + T++LP  F +CSR+DLV+LISRMLTFLIQ+ND     + + SA+              
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMND-----SSSTSAL------------DS 84

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LT+FHS+VPP ISV NYL+RLTKY+SL+H                 P F +NSLTVH
Sbjct: 85  VTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVH 144

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVASKGL DSFCTN+HYAKVGGV CSELN+LE + LRRINYRIIPRDDNI  C
Sbjct: 145 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWC 204

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTH-----PNSGYNVLNIYYRKMVQIVGLLKNSTDK 266
            LE +   F LD  D    +  P L++      NSGYNVL+ YY K+VQ+VG LK++ DK
Sbjct: 205 NLESQHRHFVLDTQD--GDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDK 262

Query: 267 SKKVNYIIQTNYNDTNI 283
           SK VNY        TNI
Sbjct: 263 SKLVNYTFANTLKPTNI 279

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  252 bits (644), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 132/255 (51%), Positives = 168/255 (65%), Gaps = 19/255 (7%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I+ ++LPT F KCSR+DLVVLISRML  LI IN       EN+ + IP            
Sbjct: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAIN-------ENSVSKIPEN---------- 60

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTR+HS++PPNIS+ NY IRLTK++SLEH                 P+F +NSLT H
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATT+A+KGL DSF TN+HYAKVGGVRC ELNILE DFL+R+NYRIIPRD NI LC
Sbjct: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180

Query: 212 KLEKKSSQFTLDLGDLLAANIQ--PELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKK 269
            +E+K  +F +D   L + ++        P SGYNVL+ YYR++VQ+VG    S DKSKK
Sbjct: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 270 VNYIIQTNYNDTNIS 284
           ++Y++ +N +  N S
Sbjct: 241 IDYVLPSNIDKDNES 255

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  249 bits (635), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 162/248 (65%), Gaps = 19/248 (7%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I  ++LP  F KCSR+DLVVLISRML  LI IN       EN++   P            
Sbjct: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAIN-------ENSTTKKPDD---------- 60

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTR+HS+VPPNIS+ NY IRLTK++SLEH                 P+F +NSLT H
Sbjct: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVA+KGL DSF TN+HYAKVGGVRC ELNILE DFL+R+NYRIIPRD NI LC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 212 KLEKKSSQFTLDLGDLLAANIQ--PELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKK 269
            +E+K  +F  D     + ++     ++ P SGYNVL+ YYR++VQ+VG    S DKSKK
Sbjct: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 270 VNYIIQTN 277
           V+Y++ +N
Sbjct: 241 VDYVLPSN 248

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  248 bits (632), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 160/242 (66%), Gaps = 29/242 (11%)

Query: 35  IMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXX 94
           IMLP  FLKCSR+ LVVLISRML+ LIQ+ND   +  + N                    
Sbjct: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMND--SMCKDKN------------------LK 86

Query: 95  LTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVHRFL 154
           LTRFHSRVPP ISV NYLIRL KY+SLE                  P F +NSLTVHRFL
Sbjct: 87  LTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFL 146

Query: 155 LAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLE 214
           L ATTVASKGLSDSFCTN HYAKVGGV+CSELN+LET+FL+R+NYRIIPRDDNI  CK E
Sbjct: 147 LTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEE 206

Query: 215 KKSSQF-TLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYI 273
            +   F T  L D        ++  PN+G+NVL+ YY+KM+Q+VG   +S DK+ KV+Y+
Sbjct: 207 YQQGVFITFPLAD--------KIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYV 258

Query: 274 IQ 275
           ++
Sbjct: 259 LE 260

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  247 bits (631), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 163/248 (65%), Gaps = 19/248 (7%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I  ++LP  F KCSR+DLVVLISRML  LI IN+        NSA   +   +       
Sbjct: 18  IPKVILPADFNKCSRTDLVVLISRMLVSLIAINE--------NSATKKSDDQIT------ 63

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTR+HS++PPNIS+ NY IRLTK++SLEH                 P+F +NSLT H
Sbjct: 64  ---LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVA+KGL DSF TN+HYAKVGGVRC ELNILE DFL+R+NYRIIPRD NI LC
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 212 KLEKKSSQFTLDLGDLLAANIQ--PELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKK 269
            +E+K  +F +D   L + ++     +  P SGYNVL+ YYR++VQ+VG    S DKS+K
Sbjct: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240

Query: 270 VNYIIQTN 277
           V+Y++  N
Sbjct: 241 VDYVLPPN 248

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  246 bits (627), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 129/254 (50%), Positives = 167/254 (65%), Gaps = 21/254 (8%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I  I+LP+ F KCSR+DLVVLISRML  LI IN       EN+S   P            
Sbjct: 18  IPKIILPSEFKKCSRTDLVVLISRMLVSLIAIN-------ENSSTKRPDD---------- 60

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTR+HS++PPNIS+ NY IRLTK++SLEH                 P+F +NSLT H
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVA+KGL DSF TN+HY+KVGGVRC ELNILE DFL+R+NYRI+PRD NI LC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPN---SGYNVLNIYYRKMVQIVGLLKNSTDKSK 268
            +E+K   F +D   L + ++    ++ N   SGYNVL+ YY+++VQ+VG    S DKS+
Sbjct: 181 SIEQKQKTFVIDKNALGSVDLG-SYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSR 239

Query: 269 KVNYIIQTNYNDTN 282
           +VNY + +N+++ N
Sbjct: 240 RVNYALPSNFDEDN 253

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  238 bits (607), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 157/243 (64%), Gaps = 27/243 (11%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           +  + LP  F +CSR+DLV+LISRML+FL +IND            +P            
Sbjct: 29  VPEVALPEDFSQCSRTDLVILISRMLSFLTRINDS-----------VPKD---------D 68

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHSRVPP ISV +Y++RLT+Y+SLE                  P F +NSLTVH
Sbjct: 69  AKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVH 128

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVASKGL DSFCTNSHYAKVGGV+CSEL++LE++FL+++NYRI+PRDDNI  C
Sbjct: 129 RFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271
           K EKK+  F       +          PN+G+NVL+ YYRK+++IVG   +S DK+K+ +
Sbjct: 189 KAEKKAGLF-------VTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAH 241

Query: 272 YII 274
           Y++
Sbjct: 242 YVM 244

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  237 bits (605), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 161/245 (65%), Gaps = 27/245 (11%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           +  + LP  F +C R+DLV+LISRML+FLI+IND   I  +N+S                
Sbjct: 29  VPEVALPNDFSQCPRTDLVILISRMLSFLIRIND--SIPKDNSS---------------- 70

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHSRVPP ISV +YL+RLT+Y+SLE                    F +NSLTVH
Sbjct: 71  --ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVH 128

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTV SKGL DSFCTNSHYAKVGGV+CSEL++LE++FL+R+NYRI+PRDDNI  C
Sbjct: 129 RFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNC 188

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271
           K E++   F       + A    E   PN+G+NVL+ YY+K+++IVG   +S DK+K+ +
Sbjct: 189 KAERREGLF-------VTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAH 241

Query: 272 YIIQT 276
           Y+++T
Sbjct: 242 YVMKT 246

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  236 bits (603), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 162/246 (65%), Gaps = 19/246 (7%)

Query: 33  ETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTE-NNSAMIPTQTDVXXXXXXX 91
           + ++L  +F+KCS+ DL+ LISRML+F I IND + I     N+ + P            
Sbjct: 10  QLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSP------------ 57

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHS+VPPNIS+ +YLIRLTKY+SLE                  PEF +NSLTVH
Sbjct: 58  -LFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVH 116

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           R+LL ATT+ASKGL DSFCTNSHYAKVGG+RC+ELN+LET+FL R+ YR+IPRD+ IKLC
Sbjct: 117 RYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLC 176

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271
           KLE K S       D+   +I  EL   NSGYNVL+ YY KMVQ+VG  K+S +  + VN
Sbjct: 177 KLEYKYSPIEDINNDI---HIPDELQ--NSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVN 231

Query: 272 YIIQTN 277
           YI   N
Sbjct: 232 YIFSIN 237

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  237 bits (604), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 159/248 (64%), Gaps = 25/248 (10%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I TI LP  FLKC + DLV+LI+RML F+IQIND N  + EN                  
Sbjct: 14  IPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSN--IKENERKY-------------- 57

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHS++ PNISV NY  RLTKY+ LEH                 P F +NSLT H
Sbjct: 58  --GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAH 115

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATT+ASKGL DSFCTN+HY+KVGGV+C+ELN+LE +FLR++NYRIIPRD+NI  C
Sbjct: 116 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTH-----PNSGYNVLNIYYRKMVQIVGLLKNSTDK 266
           K+E + + F   L + + +++ P L        N+GYNVL  YY K++++VG   +S DK
Sbjct: 176 KMEVQKNFFI--LPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDK 233

Query: 267 SKKVNYII 274
           +KKVNY I
Sbjct: 234 TKKVNYDI 241

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  228 bits (582), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 125/236 (52%), Positives = 153/236 (64%), Gaps = 27/236 (11%)

Query: 33  ETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXX 92
           + I LP  +L+CSR+ LVV+ISRML+FLIQIND N      N  M               
Sbjct: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANN---AGNQTM--------------- 58

Query: 93  XXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVHR 152
             LTRFHS+  P+I+V  YLIRLTKY+SLEH                 PEF +NSLTVHR
Sbjct: 59  -ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHR 117

Query: 153 FLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCK 212
           FLL ATT+ASKGL DSFCTN+HY+KVGGV+CSELNILE +FL R+ YRIIPRDDNI+ CK
Sbjct: 118 FLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCK 177

Query: 213 LEKKSSQFTLDLG-DLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKS 267
           +E+K       LG ++L          P++G+NVL  YYRK+VQ+VG   NS DK+
Sbjct: 178 IEQK-------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  224 bits (570), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 151/243 (62%), Gaps = 22/243 (9%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           +  + LP  FL CSR+ LVVLISRMLT LI +ND               Q D        
Sbjct: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMND--------------AQGD-----KSK 53

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHSRVPP ISV NYLIRLTKY+SLEH                 PEF+++SLTVH
Sbjct: 54  PIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVH 113

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL ATTVASKGL DSFCTN+HYAKVGGV+CSELN+LE +FL R+NYRI+PRDDNI+ C
Sbjct: 114 RFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271
            LE++   F+      +  +    L   N+G+ VL  YY +M+ ++G    S DKS  ++
Sbjct: 174 SLERQERIFSY---SNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLS 230

Query: 272 YII 274
           + +
Sbjct: 231 FTL 233

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  223 bits (567), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 156/239 (65%), Gaps = 23/239 (9%)

Query: 37  LPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLT 96
           LP  FL CSR+ LVVLISRML+ LI++ND     TE+N+                   LT
Sbjct: 25  LPRKFLDCSRTHLVVLISRMLSSLIRLND---AYTESNTLQ-----------------LT 64

Query: 97  RFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVHRFLLA 156
           RFHSRVPP+ISV +YLIRLTKY+SLEH                 PEF+++SLTVHRFLL 
Sbjct: 65  RFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLT 124

Query: 157 ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKK 216
           ATTVASKGL DSFCTN+HYAKVGGV+C+ELN+LE +FL R+NYRI+PRD+NIK C  E +
Sbjct: 125 ATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQ 184

Query: 217 SSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYIIQ 275
              F+    ++ A   Q + +  N  ++VL  YY +M+ ++G L  S DKS  +N+ ++
Sbjct: 185 EGTFS--FANIPADAEQDQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLNFTLE 240

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  207 bits (527), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 142/233 (60%), Gaps = 24/233 (10%)

Query: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXX 91
           I+ I +P  ++KCSRSDLVVL+SRML  LIQ ND     + ++S                
Sbjct: 26  IQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDS-------------- 71

Query: 92  XXXLTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVH 151
              LTRFHSR+PPNIS+ NYL RLTKY  +EH                 P F  NSLT H
Sbjct: 72  NMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAH 131

Query: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211
           RFLL A TVA KGL DSFCT + YAK+GGV+  ELNILET FLR +NYRIIPR  N+ L 
Sbjct: 132 RFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLI 191

Query: 212 KLEKKSSQFTLDLGDLLAANIQPELTH------PNSGYNVLNIYYRKMVQIVG 258
           KLE+ +  FTLD  D+      P+L+       P++GY+VLNIYY+ +V+I G
Sbjct: 192 KLERGNQVFTLDHLDMK----DPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  174 bits (442), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 98/228 (42%), Positives = 130/228 (57%), Gaps = 18/228 (7%)

Query: 35  IMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXX 94
           I LP  F++C R DLVVLISRML  LI+IND     T+ N   +P+              
Sbjct: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKIND-----TKANDNNLPSN------------Y 99

Query: 95  LTRFHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFKINSLTVHRFL 154
            TRFHSRV P IS+ NYL+RLTK+  L+                  P F  NSLT HRF+
Sbjct: 100 ATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFI 159

Query: 155 LAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLE 214
           L A  VASK L DS  + +HYAK GGV+ +EL +LE  FL+ I YR++PRD N  LC +E
Sbjct: 160 LTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSME 219

Query: 215 KKSSQFTLDLGDLLAANIQPELTH-PNSGYNVLNIYYRKMVQIVGLLK 261
                F L+ G +  +         P+SGYNVL++YYR+++ I+G+ +
Sbjct: 220 YHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQR 267

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 20/166 (12%)

Query: 48  DLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLTRFHSRVPPNIS 107
           +L++++S +L  +I +ND     T + S  +P  T+           +  F+ +  P I 
Sbjct: 109 ELIIMVSALLNKIITVNDA----TTDISQQVPGDTE-----EKFLTPILAFYGKNVPEID 159

Query: 108 VNNYLIRLTKYASLEHXXXXXXXX---XXXXXXXXXPE--------FKINSLTVHRFLLA 156
           V  YL R+ KY    +                    PE        F ++S  +HR L+ 
Sbjct: 160 VVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLIT 219

Query: 157 ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
             T+ +K LSD F +NS YAKVGG+   ELN LE  FL   +++++
Sbjct: 220 GITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 27/187 (14%)

Query: 48  DLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLTRFHSRVPPNIS 107
           D++ +++ +L  ++  ND      E N+   P   +           +T F+ +  P I+
Sbjct: 242 DILQMLTALLDKIVSSND------ELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQIT 295

Query: 108 VNNYLIRLTKYASLE--------------------HXXXXXXXXXXXXXXXXXPEFKINS 147
           +  YL+R+ KY                        H                   F ++S
Sbjct: 296 IEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDS 355

Query: 148 LTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYR-IIPRDD 206
             +HR L+A  TV++K  SD F +N+ YA+VGG+   E+N LE  FL   +++ +IP D+
Sbjct: 356 YNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLIPIDE 415

Query: 207 NIKLCKL 213
             +  +L
Sbjct: 416 LQRYAEL 422

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 10/118 (8%)

Query: 95  LTRFHSRVPPNISVNNYLIRLTKYAS----------LEHXXXXXXXXXXXXXXXXXPEFK 144
           L  FH +  P+I++  Y  R+ KY            +                     F 
Sbjct: 178 LLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFV 237

Query: 145 INSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           ++S  +HRF++A  TV +K LSD F +NS YAKVGG+   E+N LE  FL   ++++I
Sbjct: 238 MDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 75/166 (45%), Gaps = 20/166 (12%)

Query: 48  DLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLTRFHSRVPPNIS 107
           +L++++S +L         N+I+  N+    P+Q  V          +  F+ +  P I+
Sbjct: 110 ELILMVSALL---------NKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIA 160

Query: 108 VNNYLIRLTKYASLEHXXXXXXXX---XXXXXXXXXPE--------FKINSLTVHRFLLA 156
           V  YL R+ KY    +                    P+        F ++S  +HR L+ 
Sbjct: 161 VVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLIT 220

Query: 157 ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
             T+ +K +SD F +NS YAKVGG+   ELN LE  FL   +++++
Sbjct: 221 GITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 142 EFKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRI 201
           +F ++S  +HR +++A TV++K  SD F +NS YAKVGG+   E+N LE  FL   N+ +
Sbjct: 255 KFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDL 314

Query: 202 IPRDDNIKLCKLEKKSSQFTLDLGDLLAA 230
           I   + I+  +     S+F + + DL A+
Sbjct: 315 IISSEEIQ--RYSGLLSKFYISITDLTAS 341

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 48  DLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLTRFHSRVPPNIS 107
           +L+++IS +L  +I  ND     T + S  +  +T+           +  F+ +  P I+
Sbjct: 109 ELILMISALLNRIITANDE----TTDVSQQVSDETE-----DELLTPILAFYGKNVPEIA 159

Query: 108 VNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPE-----------FKINSLTVHRFLLA 156
           V  YL R+ KY    +                              F ++S  +HR L+ 
Sbjct: 160 VVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLIT 219

Query: 157 ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
             T+ +K LSD F +NS YAKVGG+   ELN LE  FL   +++++
Sbjct: 220 GVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 42/60 (70%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++AA TV++K +SD F +NS YA+VGG+   ELN LE  FL   ++R+I
Sbjct: 313 FVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 71/169 (42%), Gaps = 20/169 (11%)

Query: 45  SRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVXXXXXXXXXXLTRFHSRVPP 104
           S  +L+ +IS +L         N I+T N+     +Q             +  F+ +  P
Sbjct: 106 STDELIQMISALL---------NRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVP 156

Query: 105 NISVNNYLIRLTKYASLEHXXXXXXXXXXXXXXXXXPEFK-----------INSLTVHRF 153
            ISV  YL R+ KY    +                   F            ++S  +HR 
Sbjct: 157 EISVVQYLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRL 216

Query: 154 LLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           L+   T+ +K LSD F +NS YAKVGG+   ELN LE  FL   +++++
Sbjct: 217 LITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV++K LSD F +NS YAKVGG+   ELN LE  FL   ++ ++
Sbjct: 232 FVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL 291

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 98  FHSRVPPNISVNNYLIRLTKYASLEHXXXXXXXXXXXXXX----XXXPE-FKINSLTVHR 152
           F  +  P I++ +Y  R+ KY  + +                     P+ F ++S  +HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 153 FLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
            ++AA TV++K  SD F +NS YA+VGG+   ELN LE  F    ++ +I
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV++K  SD F +NS YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TVA+K  SD F +N+ YAKVGG+   ELN LE  FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++AA TV++K  SD F +NS YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 392 FVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A TTV++K  SD F +NS YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 320 FVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLELQFLILCDFELL 379

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++ A TV++K  SD F +NS YA+VGG+   ELN LE  FL   +++++
Sbjct: 289 FVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQELNHLELQFLILCDFQLM 348

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR +++A TV++K  SD F +NS YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 374 FVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%)

Query: 145 INSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRI 201
           +NS TVHR +LA  TV+SK LSD   +N  YA+  G+   ELN LE  FLR  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 98  FHSRVPPNISVNNYLIRLTKYASLEHXXXXXX----XXXXXXXXXXXPE-FKINSLTVHR 152
           F  +  P I++ +Y  R+ KY  + +                     P+ F ++S  +HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 153 FLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
            ++AA TV++K  SD F +NS YA+VGG+   ELN LE  F    ++ +I
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV +K  SD F +NS YA+VGG+  SELN LE  FL   ++ ++
Sbjct: 364 FVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV +K  SD F +NS YA+VGGV   ELN LE  FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR L+A  TV++K  SD F +NS YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 272 FVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFELL 331

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR +++A TV++K  SD F +NS YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 485 FVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV++K LSD F +NS Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV++K LSD F +NS Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV++K LSD F +NS Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV +K  SD F +NS YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 411 FVMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F ++S  +HR ++A  TV++K LSD F +NS Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           F +NS  +HR ++A   V++K  SD F +N+ YAKVGG+   E+N LE  FL   ++ ++
Sbjct: 272 FVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSLL 331

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T+HR  LA   ++SK  +DS   N H+A+   G     ++N++E   L+ +N+ I   +D
Sbjct: 97  TIHRLFLACLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSED 156

Query: 207 NIKL 210
           ++ L
Sbjct: 157 DLIL 160

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+ K   G +  +++N +E + L  +N+  I + +
Sbjct: 87  TKHRIFLGCLILAAKSLNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQE 146

Query: 207 NIKLC 211
           ++  C
Sbjct: 147 DLIGC 151

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI-IPRD 205
           T HR  L    +ASK L+DS   N H+A+   G ++  E+N +E + L   ++ I I  D
Sbjct: 91  TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTD 150

Query: 206 D 206
           D
Sbjct: 151 D 151

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A+   G ++  E+N +E + L   ++ +  +  
Sbjct: 92  TRHRIFLGCLILAAKTLNDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTK 151

Query: 207 NIKLC 211
           ++ +C
Sbjct: 152 DLIIC 156

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYR 200
           + IN+ T HR  L    +A+K L+DS   N H+     G +R  E+N +E + L  +N+ 
Sbjct: 86  YGINT-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWD 144

Query: 201 I 201
           +
Sbjct: 145 V 145

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +A+K L+DS   N H+     G +R  E+N +E + L   N+ +
Sbjct: 92  TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  +    +A+K L+DS   N H+ +   G  +  E+N +E + L   N+     D 
Sbjct: 89  TRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNW-----DV 143

Query: 207 NIKLCKLEKKSSQF 220
            IKL  L    S F
Sbjct: 144 TIKLPDLYTSLSAF 157

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T+HR  LA   +++K  +DS   N H+AK   G     ++N++E   L  +N+
Sbjct: 102 TIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A+   G +   E+N +E + L   ++ +    D
Sbjct: 91  TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTD 150

Query: 207 NIKLC 211
           ++  C
Sbjct: 151 DLITC 155

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFL 194
           FK     VHR ++A   +A+K L D   ++ ++ KV G+    L+ LE   L
Sbjct: 393 FKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T+HR  LA   +++K  +DS   N H+A+   G     ++N++E   L  +N+ I  +++
Sbjct: 100 TIHRIFLACLILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEE 159

Query: 207 NI 208
           ++
Sbjct: 160 DL 161

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T+HR  LA   +++K  +DS   N H+AK   G     ++N++E   L+ +N+
Sbjct: 97  TIHRIFLACLILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T+HR  LA   +++K  +DS   N H+AK   G     ++N++E   ++ +N+ +   +D
Sbjct: 130 TIHRMFLACLILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTND 189

Query: 207 NIKL 210
           ++ L
Sbjct: 190 DLIL 193

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +A+K L+DS   N H++    G ++  E+N +E + L   N+ +
Sbjct: 90  TRHRIFLGCLILAAKTLNDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T HR  L    +A+K L+DS   N H+AK   G ++  E+N +E + L    +
Sbjct: 95  TRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREILTYFKW 147

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +A+K L+DS   N H+     G ++  E+N +E + L   N+ +
Sbjct: 90  TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T+HR  LA   +++K  +DS   N H+A+   G     ++N++E   L  +N+
Sbjct: 97  TIHRMFLACLIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A    G +   E+N +E + L   ++ +    +
Sbjct: 89  TRHRIFLGCLILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTE 148

Query: 207 NIKLC 211
            +  C
Sbjct: 149 ELVAC 153

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A+   G +   E+N +E + L   ++ +    +
Sbjct: 91  TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTE 150

Query: 207 NIKLC 211
           ++  C
Sbjct: 151 DLITC 155

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCS--ELNILETDFLRRINYRIIPRDD 206
           T HR  L    +ASK L+DS   N H+ +      S  E+N +E + L   N+ ++  + 
Sbjct: 87  TRHRIFLGCLILASKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNK 146

Query: 207 NIKLC 211
           ++  C
Sbjct: 147 DLITC 151

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +A+K L+DS   N H+ K   G +   E+N +E + L    + +
Sbjct: 95  TRHRIFLGCLILAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T+HR  LA   +++K  +DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 97  TIHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI-IPRD 205
           T HR  L    +A+K L+DS   N H+A+   G +   E+N +E + L   ++ + I  D
Sbjct: 91  TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTD 150

Query: 206 D 206
           D
Sbjct: 151 D 151

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T+HR  LA   +++K  +DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 97  TIHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A    G +   E+N +E + L   ++ +     
Sbjct: 89  TRHRMFLGCLIIAAKNLNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQ 148

Query: 207 NIKLC 211
            + +C
Sbjct: 149 ELAIC 153

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY 199
           T+HR  LA   +++K  +DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 97  TIHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 151 HRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           HR  L    +ASK L+DS   N H+ K   G +   E+N +E + L  +++ +
Sbjct: 89  HRLFLGCLILASKTLNDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI-IPRD 205
           T HR  L    +A+K L+DS   N H+A+   G +   E+N +E + L   ++ + I  D
Sbjct: 91  TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTD 150

Query: 206 DNI 208
           D I
Sbjct: 151 DLI 153

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 224 LGDLLAANIQPELTHPN--------SGYNVLNIYYRKM--VQIVGLLKNSTDKSKKVNYI 273
           LG  LAAN    ++              NV  +  R M  +Q+   L +  +K +KVN  
Sbjct: 451 LGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLK 510

Query: 274 IQTNYNDTNISDIDDNRKVIQIYAQHITPQKRNYDDHVNILTKGEQIQQTDKSVMSKPED 333
             ++  D  I+D  +   V+Q Y+Q +  Q +   D + +  K E+ ++   S MSK ED
Sbjct: 511 QISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAV-QKKEKTEKESISAMSKIED 569

>Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar to
           Ashbya gossypii AER440C
          Length = 444

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%)

Query: 150 VHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRII 202
           +++ L+ A  +A+K   D   TN  +++  G++CS +N  E ++L    +R+ 
Sbjct: 225 IYQNLMVAFVLANKFNDDKTFTNKSWSQATGMKCSVINTYEREWLAVFEWRLF 277

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKVGG--VRCSELNILETDFLRRINYRI 201
           T HR  L    +A+K L+D+   N H++K     +   E+NI+E + L  + +R+
Sbjct: 91  TRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +++K L+DS   N H+AK     +   E+N +E + L   ++ +
Sbjct: 91  TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A    G +   E+N +E + L   ++ +     
Sbjct: 87  TRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQ 146

Query: 207 NIKLC 211
           ++  C
Sbjct: 147 DLVTC 151

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T+HR  LA   +++K  +DS   N H+ K   G     ++N++E   L  +N+ +
Sbjct: 98  TLHRIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +++K L+DS   N H+A+   G +   E+N +E + L   ++ +
Sbjct: 91  TRHRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRI 201
           T HR  L    +A+K L+DS   N H+++   G +   E+N +E + L   ++++
Sbjct: 86  TRHRIFLGCLILAAKNLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +A+K L+DS   N H+A    G +   E+N +E + L   ++ +     
Sbjct: 91  TRHRIFLGCLILAAKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTK 150

Query: 207 NIKLC 211
           ++  C
Sbjct: 151 DLITC 155

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 151 HRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINY--RIIPRD 205
           HR  L    +A+K L+DS   N H+ +   G +   E+N +E + L   N+  RI  +D
Sbjct: 89  HRMFLGCLILAAKNLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQD 147

>KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {ON}
           Anc_7.289 YDL179W
          Length = 279

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKV--GGVRCSELNILETDFLRRINYRIIPRDD 206
           T HR  L    +++K L+D   TN ++++   G +   E+N +E + L+  N+     D 
Sbjct: 89  TRHRIFLGCLILSAKTLNDCSPTNKYWSQHCDGLISVREINKIERELLKYFNW-----DV 143

Query: 207 NIKLCKLEKKSSQF 220
            IK+ +L K   +F
Sbjct: 144 TIKVEELTKSLQRF 157

>KLLA0C03179g Chr3 complement(282251..286687) [4437 bp, 1478 aa]
           {ON} weakly similar to uniprot|P39526 Saccharomyces
           cerevisiae YJL207C Hypothetical ORF
          Length = 1478

 Score = 31.6 bits (70), Expect = 4.5,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 24/132 (18%)

Query: 155 LAATTVASKGLSDSF--------CTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDD 206
           L A  +A +GL +             +   ++  V C +L      FL  + Y+I    D
Sbjct: 423 LPANVIADRGLGEKIQASLLKVSAVENLTVRINSVYCLQL------FLHSVPYKIPGVVD 476

Query: 207 NIKLCKLEKKSSQFTLDLGDLLAAN------IQPELTHPNSGYNVLNIYYRKMVQIVGLL 260
            +    LEK SSQF ++ G   A N      I   +T  +  +   ++  R     VG L
Sbjct: 477 EL----LEKLSSQFQIEKGFSFAGNHGICLLISSIITSRDPDFVSFDLIMRVTAFAVGTL 532

Query: 261 KNSTDKSKKVNY 272
           K+++  +KKV Y
Sbjct: 533 KSNSLSTKKVLY 544

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 149 TVHRFLLAATTVASKGLSDSFCTNSHYAKVGG--VRCSELNILETDFLRRINY 199
           TVHR  LA   +++K  +DS   N H+AK         ++N++E   ++ +N+
Sbjct: 94  TVHRIFLACLILSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 143 FKINSLTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGV 181
           FK+    +HR ++A   +++K L D   ++ +++KV GV
Sbjct: 404 FKLQRDGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,860,817
Number of extensions: 1436638
Number of successful extensions: 5036
Number of sequences better than 10.0: 138
Number of HSP's gapped: 5167
Number of HSP's successfully gapped: 141
Length of query: 356
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 245
Effective length of database: 40,753,473
Effective search space: 9984600885
Effective search space used: 9984600885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)