Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003706.25ON74374337390.0
Kpol_1037.296.25ON74673520090.0
KAFR0G026606.25ON73572619240.0
SAKL0E01452g6.25ON73772618910.0
NCAS0H008606.25ON75573818320.0
Suva_15.1766.25ON74573218190.0
ZYRO0C07678g6.25ON74172518150.0
TDEL0G044406.25ON73572718080.0
NDAI0D008506.25ON79075117930.0
KNAG0M012306.25ON73873117840.0
KLLA0D01309g6.25ON74473917730.0
Skud_15.1626.25ON73473017670.0
YOR001W (RRP6)6.25ON73373117560.0
Smik_15.1706.25ON77372917580.0
CAGL0E02585g6.25ON73772617390.0
Kwal_56.224476.25ON73572916910.0
ACL001C6.25ON74573216900.0
TBLA0A071706.25ON77173316810.0
KLTH0C11066g6.25ON73569816550.0
Ecym_30306.25ON74773816430.0
ZYRO0G04840g1.493ON63368725.3
Ecym_50207.21ON79056725.6
TPHA0C031202.244ON53133716.9
YPR179C (HDA3)7.535ON655152709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00370
         (743 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...  1444   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   778   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   745   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   733   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   710   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   705   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   703   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   701   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   695   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   691   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   687   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   685   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   681   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   681   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   674   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   655   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   655   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   652   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   642   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   637   0.0  
ZYRO0G04840g Chr7 (385234..387135) [1902 bp, 633 aa] {ON} simila...    32   5.3  
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    32   5.6  
TPHA0C03120 Chr3 complement(689473..691068) [1596 bp, 531 aa] {O...    32   6.9  
YPR179C Chr16 complement(893797..895764) [1968 bp, 655 aa] {ON} ...    32   9.8  

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score = 1444 bits (3739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/743 (95%), Positives = 707/743 (95%)

Query: 1   MNADEXXXXXXXXXXXXXXXXXQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDEN 60
           MNADE                 QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDEN
Sbjct: 1   MNADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDEN 60

Query: 61  SEGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFES 120
           SEGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFES
Sbjct: 61  SEGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFES 120

Query: 121 DNVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPY 180
           DNVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPY
Sbjct: 121 DNVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPY 180

Query: 181 ETEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHD 240
           ETEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHD
Sbjct: 181 ETEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHD 240

Query: 241 FRSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRD 300
           FRSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRD
Sbjct: 241 FRSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRD 300

Query: 301 LGLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYAR 360
           LGLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYAR
Sbjct: 301 LGLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYAR 360

Query: 361 ADTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDM 420
           ADTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDM
Sbjct: 361 ADTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDM 420

Query: 421 PWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGV 480
           PWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGV
Sbjct: 421 PWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGV 480

Query: 481 ISVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKF 540
           ISVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNI        AKDKETSSNDLSTSQIKF
Sbjct: 481 ISVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKF 540

Query: 541 IVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLS 600
           IVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLS
Sbjct: 541 IVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLS 600

Query: 601 DRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDE 660
           DRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDE
Sbjct: 601 DRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDE 660

Query: 661 IIVLKDTKDXXXXXXXXXXXSADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNN 720
           IIVLKDTKD           SADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNN
Sbjct: 661 IIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNN 720

Query: 721 ENALQGAKRRRPTAKNRNVSFKR 743
           ENALQGAKRRRPTAKNRNVSFKR
Sbjct: 721 ENALQGAKRRRPTAKNRNVSFKR 743

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/735 (52%), Positives = 525/735 (71%), Gaps = 28/735 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFYR+LDKEI++SL  +S+++T+MIN+++ S++EN+E L  GKE L++ WKD  N++
Sbjct: 26  QDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELESGKEGLEQYWKDFSNVM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+LFE +D S+D ++++   + N  + +YL+DS   +S+   R++KPQL FS PVDNSE+
Sbjct: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
            PF PLL DKP+++    + L I+  +E+ P HY  PYE EIDKQEYN  VLQ ++P+ S
Sbjct: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           + W  +E+ WVD  E+L +ML++LK  TE+AVDLEHHD+RSYYGI CLMQISTR  D+LV
Sbjct: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DT+ALRD+L +LN VF DP I K+LHGAFMDIIWLQRDLGLY+VSLFDTYHASRALGFPR
Sbjct: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE++A+FKTSK+YQLADWR RPLSK M+AYARADTHFLLNI+DQ+RN LI+E+K
Sbjct: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L ESR VAKRRFEYS+++P +PS AVF+P E + PWR+++YQYN+PS K+EL+KR+
Sbjct: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           WEWRD IARRDDESPRYIMPNQL+ SLVEY P +PAGVISV+ +MTD VRSN+K IANLI
Sbjct: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504

Query: 503 KSTLEDMKN---------NNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYS 553
           K +LEDMK+          NI        A DK      L+ SQI+ + + F+ I    +
Sbjct: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDK------LTISQIQNMTALFKEI----A 554

Query: 554 SNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQA 613
           SN S +    SK+  D ++FS IF S+++I+ YD   +H++T +QL+ R +EV+  M +A
Sbjct: 555 SNPSIIEKDVSKK-IDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEA 613

Query: 614 EEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQ-----EDLDEIIVLKDTK 668
                ++ ++ + +  +++P  + +  +    +   E+         ED+++IIVLKD K
Sbjct: 614 NNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVK 673

Query: 669 DXXXXXXXXXXXSADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNNENALQGAK 728
                           +  VIDYSK D ILS++ +R    KRK DPF  +N     + AK
Sbjct: 674 KRTNIKDHKKKQGM-PNKEVIDYSKLDTILSKE-KRENSKKRKGDPFGEENGLEGPKAAK 731

Query: 729 RRRPTAKNRNVSFKR 743
           +R+   + +NVSFKR
Sbjct: 732 KRKQINRGKNVSFKR 746

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/726 (51%), Positives = 496/726 (68%), Gaps = 22/726 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFYRSLD E++ S+   + ++ DM+NSII S+DEN E L EGKE L ESWK + N++
Sbjct: 26  QDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLDEGKEELTESWKSLSNIV 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+LFE +D S+D L   ++K   +P  +Y  ++   E+    R++KPQL F  P+DNSE+
Sbjct: 86  DNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKRINKPQLKFVPPIDNSES 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF PLL +KPNA+  +DE  K+++  E+ P+HY  PYE EID Q YN+ +LQ  +PIPS
Sbjct: 146 HPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEIDNQPYNDSILQVREPIPS 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K W ETE +WVDN ESL  MLN++K  TE+A+DLEHHD+R+YYGI CLMQISTR TDYLV
Sbjct: 206 KSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYYGIVCLMQISTRETDYLV 265

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALR+ L+VLN VFTDP + K+LHGAFMDIIWLQRDLGLYIVSLFDT+HASRALGFPR
Sbjct: 266 DTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGFPR 325

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE FA+FKTSK+YQLADWR RPLSKAM AYARADTHFLLNI+DQLRN L++ +K
Sbjct: 326 HSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHFLLNIYDQLRNRLVETNK 385

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           L  +L+ESR VAKRRFEYSK++P +PS  V+S  E + PWR++++QYNIPS++ +L+K L
Sbjct: 386 LVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTLMFQYNIPSEREDLLKGL 445

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRD IARRDDESPRYIMPNQL+ +LV Y PT+PAGVIS ++++TD VRSN+K IANLI
Sbjct: 446 FEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQVVTDYVRSNSKIIANLI 505

Query: 503 KSTLEDMKNNNIXXXXXX-XXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLND 561
           K+ L   K+ N           ++   S++ ++ SQIK   S F  I EK  + N++   
Sbjct: 506 KNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETASVFIQIAEKLGTCNND--- 562

Query: 562 VTSKEGKDSLVFSKIFNS---RDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIAF 618
              ++   S   S  F S   + DII Y  G KH + +QQL  R       + +   + +
Sbjct: 563 ---QQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVSRFNTYTKQVNELTNVRY 619

Query: 619 SMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXX 678
            + V     +  K    E ++ I    +PA    + + DLDE++VLK             
Sbjct: 620 ELPVHKEPPQLQKDDVEEVKKTIIADSIPA----KPEIDLDEVVVLKKVNRQPNKTKLEE 675

Query: 679 XXSADSDHTVIDYSKGDKILSQDNRR--RTPNKRKYDPFSADNNENALQGAKRRRPTAKN 736
               D     IDYSK +KIL  D +R  R   KR++DPF+A N     + A++R+   + 
Sbjct: 676 NEKID----FIDYSKSEKILKGDKQRKKRESKKRQFDPFAASN--EGPKAARKRKSGTRG 729

Query: 737 RNVSFK 742
           RN+S+K
Sbjct: 730 RNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/726 (51%), Positives = 506/726 (69%), Gaps = 21/726 (2%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QD+DF++SLD  I+ S+  +S K+ ++IN ++ S+DEN++ +  GK+N  ESWKDIG+++
Sbjct: 26  QDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDTIEYGKDNFQESWKDIGDIM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+LFE +DH+ DAL + S    N   ++YL+DS     +   R+ KPQLNF  P+DN+E+
Sbjct: 86  DNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSRSNLNPSKRIEKPQLNFKTPIDNTES 144

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF+PLL +KP+A+ PL E+LK    TE+ P HYP PY  EID QEYNE +LQ  DPIPS
Sbjct: 145 HPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEIDTQEYNESILQIRDPIPS 204

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           + WE+T+ +WVD +ESL  +LNEL++A E+AVDLEHHD+RSYYGI CLMQISTR  D+LV
Sbjct: 205 QPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSYYGIVCLMQISTRERDWLV 264

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALR++L VLN +FTDP + K+ HGAFMDIIWLQRDLG+Y+VSLFDTYHASR+LG PR
Sbjct: 265 DTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIYVVSLFDTYHASRSLGLPR 324

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE+FA FKTSK+YQLADWR RPL+K M AYARADTHFLLNI+DQLRN LI+++K
Sbjct: 325 HSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTHFLLNIYDQLRNSLIEQNK 384

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA++LH+SR VAKRRFEY+ ++P + S+ VFSP E D PWR+++YQYNIP  +  L+++L
Sbjct: 385 LAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWRNLMYQYNIPLSREPLMRKL 444

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRDTIARRDDESPRY+MPNQL+ SLV   PT+PAGV+SV+  +TD VRSN+K ++NLI
Sbjct: 445 YEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNFITDYVRSNSKMLSNLI 504

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLNDV 562
           K TLE +KN ++          +++  S  LS SQI+ +  QF ++  K    NS  N +
Sbjct: 505 KKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQIQNMCLQFNSLASKVKKANSATNSM 564

Query: 563 TSKEGKDSLVFSK--IFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIAFSM 620
                K S++F    IF S D  + Y K +K +I E QL +R+ EV   +K+ +E  F +
Sbjct: 565 P----KVSILFDGDHIF-SNDRAVLYSKNSKIVIDENQLQERKLEVSEKLKEVQEPDFRL 619

Query: 621 EVQDTHKES--MKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXX 678
            V  T KE+  + +   E ++V   S     E  +     DEIIVLK  K          
Sbjct: 620 HVNVTTKETDEVSKDVSEKDDVNRASETDPLETNK-----DEIIVLKKKKRHEPQDRKKV 674

Query: 679 XXSADSDHTVIDYSKGDKILSQ--DNRRRTPNKRKYDPFSADNNENALQGAKRRRPTAKN 736
             S D +   +DY   +K+L     + ++   KR++DP++++N     Q AK+R+     
Sbjct: 675 GNSTDVEP--MDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSEN--VGPQSAKKRKKPTPG 730

Query: 737 RNVSFK 742
           +N+SFK
Sbjct: 731 KNMSFK 736

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/738 (50%), Positives = 502/738 (68%), Gaps = 28/738 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFYRS+DK+IA SL  +S ++ DMINS++ S+DENSE +   KENL++ WKD GNL+
Sbjct: 29  QDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQVDGTKENLEDIWKDFGNLM 88

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVT---RLSKPQLNFSVPVDN 139
           D+LFE +D SID +++    S+    M+Y+++   F   ++T   ++ KPQL F+ P+DN
Sbjct: 89  DNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE---FSGRDLTPGKQILKPQLKFTTPIDN 145

Query: 140 SETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDP 199
           +E+HPF PLL +KP A+ PL+E ++++   E +P HYPQPYE EID QEYN+ +LQ  DP
Sbjct: 146 TESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEIDHQEYNDLILQKKDP 205

Query: 200 IPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTD 259
           IPS  W + E IWVD    L +++ +L+ +TE+AVDLEHHD+R+YYGITCLMQISTR  D
Sbjct: 206 IPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTYYGITCLMQISTRKND 265

Query: 260 YLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALG 319
           YL+DT+ALR+ LQ+LN VF +P ITK+ HGAFMDIIWLQRDLGLY+V LFDT+HASRA+G
Sbjct: 266 YLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLYVVGLFDTFHASRAMG 325

Query: 320 FPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQ 379
            P+HSLAYLLE+FA FKTSK+YQLADWR RPLSKAM+AYARADTHFLLNIFDQ+RN LI+
Sbjct: 326 LPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTHFLLNIFDQMRNSLIE 385

Query: 380 EDKLASMLHESRKVAKRRFEYSKYKPTL--PSSAVFSPTESDMPWRSMIYQYNIPSQKVE 437
           ++KLA +L ESR VAKRRFEYS ++P +   +  V+SP E D PW+++++QYNIP QK  
Sbjct: 386 QNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPWKTIMFQYNIPPQKEP 445

Query: 438 LVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKA 497
           L+K L++WRD IARRDDESPR++MPNQL+ SLV Y P +  GV+SV+  +TD VRSN+K 
Sbjct: 446 LLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVSVSNSVTDYVRSNSKI 505

Query: 498 IANLIKSTLEDMK-----NNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKY 552
           +ANLIK+ L  MK     +NN+         +     S  L+  Q++ + S+F+ + +K+
Sbjct: 506 LANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQKLTIHQLQNLKSKFQLLSDKF 565

Query: 553 SSNNSNLNDVTSKEGKDSL-VFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMK 611
             NNS     T     D L +F  I  + D  I Y    K   T +Q  +R ++ D AMK
Sbjct: 566 --NNSV---KTRLSNHDQLYLFDGISFADDVTIKYFADGKIQTTAEQYKERSEQFDDAMK 620

Query: 612 QAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXX 671
           Q EE+ + + V + +K++  Q    P  V + +     E  E+ EDLDE+IVL+ T +  
Sbjct: 621 QLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIEKPEDLDEVIVLRKT-NKN 679

Query: 672 XXXXXXXXXSADSDHTVIDYSKGDKILSQD-----NRRRTPNKRK-YDPFSADNNENALQ 725
                      + +  +IDY K  K+L+ D      R    NKRK +DP+SA N   A  
Sbjct: 680 KSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGNKRKRFDPYSAANEGPA-- 737

Query: 726 GAKRRRPTAKNRNVSFKR 743
             K+R+   + +NVSFKR
Sbjct: 738 APKKRKNVTRGKNVSFKR 755

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/732 (49%), Positives = 496/732 (67%), Gaps = 41/732 (5%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFYR+LD++ +  L + S K+T+M+N I+ S+DE+ + L   +E + + WKD GN++
Sbjct: 44  QDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIM 103

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+L E +DHS+D L++ S  +++   ++YL D    +S    R+ KPQL F  P+DNSE+
Sbjct: 104 DNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSES 163

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF PLL +KPNA+ PL + L++++  E++P HYP PYE EID QEYN  +LQ    IPS
Sbjct: 164 HPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPS 223

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K W+ +E IW++++ +L +ML +LK A E+AVDLEHHD+RSYYG+ CLMQ+STR  DYLV
Sbjct: 224 KPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLV 283

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DT+ LR+ L +LN VFT+P I K+ HGAFMDIIWLQRDLGLY+V LFDTYHAS+A+G PR
Sbjct: 284 DTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 343

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE FA+FKTSK+YQLADWR RPLSK M AYARADTHFLLNI+DQLRN LI+ +K
Sbjct: 344 HSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNK 403

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L+ESR VAKRRFEYSKY+P  PSS V+SPTE + PWR ++YQYNI  ++ ELVK L
Sbjct: 404 LAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDL 463

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRD IARRDDESPR+IMPNQL+A+LV Y P +  GV+S++  +TD VR NAK +ANLI
Sbjct: 464 YEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLI 523

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFI-VSQFENILEKYS--SNNSNL 559
           KS L  MK+ +          +  E  S+   ++ ++ I VSQ  +I++++S  S+NS  
Sbjct: 524 KSALRSMKDTH---------KESAEIVSSKFKSASLEAITVSQIRDIMDRFSVFSSNSVT 574

Query: 560 NDVTSKEGKDSLVFSKIFNSRD-DIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIAF 618
            D +      S++F KI    + DI+  D G  H +  + + DR +  ++A+   E+I F
Sbjct: 575 EDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKF 634

Query: 619 SME--VQDTHKESMK-QPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXX 675
            +E  V     E +K +  PEP   I              ED DE++VLK  +       
Sbjct: 635 EVEKPVNVEKSEMVKIETTPEPPTKI--------------EDPDEVVVLKKKRIHKKQVA 680

Query: 676 XXXXXSADSDHTVIDYSKGDKILS----QDNRRRTPNKRKYDPFSADNNENALQGAKRRR 731
                +A+     +DYSK   +LS    Q+N+++   KR++DP  + N+    +  K++R
Sbjct: 681 KRSDVAAEE---AVDYSKIPNVLSSKPGQNNKQQ--RKRRFDP--SFNDSEGPRAPKKKR 733

Query: 732 PTAKNRNVSFKR 743
           PT + +NVSFKR
Sbjct: 734 PTTRGKNVSFKR 745

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/725 (50%), Positives = 493/725 (68%), Gaps = 13/725 (1%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFYRSLDK +A SL  TS ++  MINS +  +D+NS  L  GKE L++S KD  NL+
Sbjct: 26  QDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRLLEGGKEKLEDSRKDFSNLM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+LFE +D S+D L +          + YL+D+   +     R+ KPQ+ F  P+DN+ET
Sbjct: 86  DNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAARSDMIPAKRILKPQVRFQRPIDNTET 144

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF+PLL +KP+A+ PL + +++V   ED P+HYPQPYE EI+ QEYNE +L+ ++PIPS
Sbjct: 145 HPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPYEYEIENQEYNESILKIAEPIPS 204

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K W+ +E +WVDN+ESL +ML +LK +TE+AVDLEHHD+RSYYGI CLMQ+STR TDYLV
Sbjct: 205 KPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRSYYGIVCLMQVSTRQTDYLV 264

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DT+ALRD L VLN VF +P I K+ HGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR
Sbjct: 265 DTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 324

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE FA FKTSK+YQLADWR RPLSKAM+AYARADTHFLLNI+DQLRN LI E+K
Sbjct: 325 HSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADTHFLLNIYDQLRNKLIIENK 384

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L ESR VAKR F+YSKY+P +P+S+V+SP +    W+ ++ QYNIP +K  LVK L
Sbjct: 385 LAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADGWKVLMNQYNIPLEKEILVKNL 444

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRDTIARRDDESPRY+MPNQL+A LV+Y P +P GVISV+  +TD VR+NAKA+ANLI
Sbjct: 445 YEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISVSPTVTDHVRTNAKALANLI 504

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLNDV 562
             +L+ + +            KD+   S  L+  QI+  VSQF ++ + +   +      
Sbjct: 505 VKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQIESQVSQFHDLSKAFKGLSQG---T 561

Query: 563 TSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAE-EIAFSME 621
            S     S++F  I ++    + Y +  K  +T++Q+  R+ E+  A++  + E A +++
Sbjct: 562 NSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQIEKRKLELSEALEFIDAETATTIQ 621

Query: 622 VQDTHKESMKQPFPEPEEVISQS---HLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXX 678
            +D   E   +  P  ++ +S++        ++ E +ED +EII LK  KD         
Sbjct: 622 EEDRGSELTHE--PADDKKVSENDESKKEEAKETEPEEDKNEIITLKKVKDRGKKSKRSN 679

Query: 679 XXSADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNNENALQGAKRRRPTAKNRN 738
               +     IDY K  KIL  + + ++  KR +DP++A N+       K++R  A+ ++
Sbjct: 680 ESEPEEP---IDYKKSKKILETEKKSKSTKKRAFDPYAASNDAGNAPKPKKKRRMARGKS 736

Query: 739 VSFKR 743
            SFKR
Sbjct: 737 ASFKR 741

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/727 (50%), Positives = 502/727 (69%), Gaps = 23/727 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDF+RSL + I  SL  TS ++  +INS++SS+D+NSE LVEGKE L+E WKD  N++
Sbjct: 26  QDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEPLVEGKETLNEYWKDFSNMM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+LFEL+D S D L++A     +  K+K+L++S + +S    R+SKPQLNF  PV+N+E 
Sbjct: 86  DNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPSKRISKPQLNFKNPVNNTEI 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
            PF PLL +KP A+ PL  +  IV G +  P+HY QPYE EI+ QEY E V+  S+PIPS
Sbjct: 146 QPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYEIEHQEYGESVIVKSEPIPS 203

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K WE TEA+WVDN E L  M+++LK+ TE+AVDLEHHD+RSYYGI CLMQISTR  DYL+
Sbjct: 204 KPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRSYYGIVCLMQISTRERDYLI 263

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALRD LQ+LN VF +PKI K+ HGAFMDIIWLQRDLGLY+VSLFDT+HASRA+G PR
Sbjct: 264 DTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGLYVVSLFDTFHASRAIGLPR 323

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE+FA+FKTSK+YQLADWR RPLSKAMNAYARADTHFLLNI+DQLRN LI+++K
Sbjct: 324 HSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADTHFLLNIYDQLRNTLIEQNK 383

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L ESR VAKRRFEYSK++P  PS  V+ P +   PW+ +++QY+I   + ELVK+L
Sbjct: 384 LAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWKVLMFQYSISPNREELVKKL 443

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           ++WRDTIARRDDESPRY+MPNQL+  L    PT P  VISVN ++TD VRSN+  +A+LI
Sbjct: 444 YDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISVNSIVTDHVRSNSLVLAHLI 503

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKET-SSNDLSTSQIKFIVSQFENILEKYSSNNSNLND 561
           K+TL    +++         A +  T +++ L+  QI+ + + F  +   ++   +    
Sbjct: 504 KNTL---ASSDKESDKGTFEADNNSTDAASLLTVPQIQKLAACFAGVSRAFTILQNEY-- 558

Query: 562 VTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEE-IAFSM 620
              K+G+ S +F+ I  S DD + Y       IT+++L  R  +   +M+Q +E  ++ M
Sbjct: 559 ---KDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKRAAKALQSMEQFDEATSYYM 615

Query: 621 EVQDTHKES--MKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXX 678
            + +  KES  M++  P   E + +S  P       +ED+DEII LK  K          
Sbjct: 616 PIPEIAKESNTMEEIRPPAPEEVKESPSPP------KEDMDEIITLKKIKKQKSQSPKEL 669

Query: 679 XXSADSDHTVIDYSKGDKILSQDN-RRRTPNKRKYDPFSADNN-ENALQGAKRRRPTAKN 736
             S + +   +DY+K  K+L+ +  + +   KRK+DP++A N+  +A +  K+R+P  + 
Sbjct: 670 GIS-EREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNHSSDAPRAPKKRKPVNRE 728

Query: 737 RNVSFKR 743
           RNVSFKR
Sbjct: 729 RNVSFKR 735

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/751 (49%), Positives = 504/751 (67%), Gaps = 35/751 (4%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFYRS+DK  A +L  T+ ++ DMINS++ +VDENSE L   KENL+++WKD  NL+
Sbjct: 45  QDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSNLM 104

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTR--LSKPQLNFSVPVDNS 140
           D+L E +D S+D L ++   ++N+  M+YL++    +  +  R  + KPQL F VPVDN+
Sbjct: 105 DNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSSKRRAIGKPQLEFDVPVDNT 164

Query: 141 ETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPI 200
           ETHPF PLL  KPNA+  LDE ++++   E+ P+HY QPYE EID Q YN+++LQ SDPI
Sbjct: 165 ETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDKILQLSDPI 224

Query: 201 PSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDY 260
           PS+ W ET AIWVD  ESL +M+ +L   TE AVDLEHHD+R+YYGI CLMQISTR  DY
Sbjct: 225 PSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQISTRTQDY 284

Query: 261 LVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGF 320
           +VDT+ LR  LQ LN  FT+P+ITK+LHGAFMDIIWLQRDLGLYIVSLFDT+HASRALGF
Sbjct: 285 IVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGF 344

Query: 321 PRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQE 380
           P++SLAYLLE+F++FKTSK+YQ+ADWR RPLSKAMN+YAR+DTHFLLNIFDQ+RN L+Q+
Sbjct: 345 PKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQMRNKLVQD 404

Query: 381 DKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVK 440
            KLA +L ESR VAKRRFEY KY+P + SSAV+SP E   PW++++YQYNIP  K  L+K
Sbjct: 405 GKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIPLAKELLLK 464

Query: 441 RLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIAN 500
            L++WRD IARRDDESPRYIMPNQL+ SLV Y P  PAGV+SV+ M+TD VRSN+K +AN
Sbjct: 465 ELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDHVRSNSKILAN 524

Query: 501 LIKSTLEDMKN----NNIXXXXXXXXAKDKETSSN-----DLSTSQIKFIVSQFENILEK 551
           LIK+ L  +K+    +++             T++N      LS  Q+  + SQF ++  K
Sbjct: 525 LIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQLSIHQLNTLKSQFLSLYSK 584

Query: 552 YSSNNSNLNDVTSKEGKDSLVFSK---IFNSRD--DIITY----DKGTKHLITEQQLSDR 602
            +      N+  + E K+S +       FN  D  + I Y    DK  K  IT ++L  R
Sbjct: 585 VNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDK--ITTEELLKR 642

Query: 603 QKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEII 662
           ++  D AM+Q +++ +S+ + +     ++    EP    + + +       ++EDLDEII
Sbjct: 643 EEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAEITTAVASRKKEDLDEII 702

Query: 663 VLKDTKDXXXXXXXXXXXSADSDHT---VIDYSKGDKILSQD-------NRRRTPNKRKY 712
           VLK T +           S D D     VIDYSK +K+L                 ++++
Sbjct: 703 VLKKT-NRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDNSNTKRNQNKNNNGNKRKRF 761

Query: 713 DPFSADNNENALQGAKRRRPTAKNRNVSFKR 743
           DP++  NNE   +  K+R+   + +NVSFKR
Sbjct: 762 DPYNV-NNEGP-RAPKKRKAMTRGKNVSFKR 790

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/731 (49%), Positives = 488/731 (66%), Gaps = 28/731 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDV F+ +LD  +ASS+     +V +MIN I+ S+DENS+   E  E + ESW+D  NL 
Sbjct: 26  QDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPFAESAEQVGESWRDFTNLT 85

Query: 83  DSLFELADHSIDALSKASQKSSN-DPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSE 141
           D+LFE +D S+D +++ ++K+     +++YL+D +  +S +  R++KPQL+FS PVDNSE
Sbjct: 86  DNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDSSSGKRITKPQLHFSRPVDNSE 145

Query: 142 THPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIP 201
           + PF+PLLT+KPNA+ PL E L++V  TE+ P HYP PY+ EI  QEYN  +L+   PIP
Sbjct: 146 SQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYDYEISNQEYNNDILETRAPIP 205

Query: 202 SKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYL 261
           S  W E+E +WVD+ E L ++L +LK   ELA+DLEHHD+RSYYGI CLMQISTR+TDYL
Sbjct: 206 STPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDYRSYYGIVCLMQISTRDTDYL 265

Query: 262 VDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFP 321
           VDTIALRD+L +LN VFTDP +TK+ HGAFMDIIWLQRDLGLYIVSLFDT+HAS+ALGFP
Sbjct: 266 VDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDLGLYIVSLFDTFHASKALGFP 325

Query: 322 RHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQED 381
           +HSLAYLLE  A+FKTSK+YQLADWR RPLSK M+ YARADTHFLLNIFDQ+RN LI+++
Sbjct: 326 KHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARADTHFLLNIFDQMRNQLIKDN 385

Query: 382 KLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKR 441
           KLA +L ESRKVAKRRFEYSK++P L    VF+P E + PWR++++QYN+  +K ELVK 
Sbjct: 386 KLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKESPWRTLMFQYNVTPEKEELVKA 445

Query: 442 LWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANL 501
           L+EWRDTIARRDDESPRYIMPNQL+ SL  Y PT+P  ++SVN  +TD VRSN+K +ANL
Sbjct: 446 LYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLVSVNSYVTDCVRSNSKVLANL 505

Query: 502 IKSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLND 561
           IKS +E  K   +          +  ++   L+ SQIK I  +F  + E + S       
Sbjct: 506 IKSFVESSK---LGPQSSYTPNTENTSTPFVLTLSQIKDIGMRFTKLTENFQS------- 555

Query: 562 VTSKEGKDSLVFSKIFN--SRDDI-ITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIAF 618
            +S +    L  S  F   S+  + ++Y+      +++  L  R K+ +  MK   +I +
Sbjct: 556 -SSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRSKQFNEYMKAFGDIEY 614

Query: 619 SMEVQDTHKESMKQPFPEPEEVISQSHLPAFED--KEEQEDLDEIIVLKDTKDXXXXXXX 676
             ++    +  M  P P        +     E   K  +ED+DEI+VLK  K        
Sbjct: 615 --KIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDMDEIVVLKKVK---RELPK 669

Query: 677 XXXXSADSDHTVIDYSKGDKILSQ----DNRRRTPNKRKYDPFSADNNENALQGAKRRRP 732
                 D++  ++DYSK DK+L Q      ++   NK+++DPFSA +     +  K+R+ 
Sbjct: 670 PKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFSAIS--EGPKAPKKRKA 727

Query: 733 TAKNRNVSFKR 743
             K +N SFKR
Sbjct: 728 VTKGKNASFKR 738

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/739 (49%), Positives = 499/739 (67%), Gaps = 38/739 (5%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QD+DFY+SLD  I +SL +TS  +  +IN ++ S+D N++ + +GK++  +SWK I N++
Sbjct: 26  QDIDFYKSLDSNINASLEDTSTNILSLINDLLLSIDPNNDVIQQGKDSFVDSWKSISNIM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+LFE +DH++D +   +  ++  P +KYLND     +    R+ KPQL+F  PVDN+E 
Sbjct: 86  DNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDRSNNKPSKRIEKPQLSFKTPVDNTEL 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF+PLL  KP+++ P +  LK+V   E  P HYP PYE EID Q+YN+ +L  ++PIPS
Sbjct: 146 HPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPYEYEIDHQKYNDSILVATEPIPS 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K W+ETEAIWVD  E L  M +EL  ATELA+DLEHHD+RSYYGI CLMQIS R  D++V
Sbjct: 206 KDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHDYRSYYGIVCLMQISDREHDWIV 265

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALR++L +LN +FTDP +TK+LHGAFMDIIWLQRDLGLYIV LFDTYHASR LGFP+
Sbjct: 266 DTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRDLGLYIVGLFDTYHASRMLGFPK 325

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLERFA+FKTSK+YQLADWR RPL+K M AYARADTHFLLNIFD+LRN L++++K
Sbjct: 326 HSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYARADTHFLLNIFDKLRNSLLEQNK 385

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           ++ +LHESRKVAKRRFEYS ++P +PSSAVFSP E D PW+++++QYNIP+ K  L++RL
Sbjct: 386 MSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEKDEPWKNIMFQYNIPASKELLLRRL 445

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRDTIARRDDESPRY+MPNQL+ SLV   PT P  V+SV+  +++ +R+N+K IANLI
Sbjct: 446 YEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINVLSVSSYVSEHLRTNSKVIANLI 505

Query: 503 KSTLEDMKNN-NIXXXXXXXXAKDKETS-SNDLSTSQIKFIVSQFENILEKYSSNNSNLN 560
           K TLED+K N N         A+   T  +N ++TSQIK I + F ++  + +S   N  
Sbjct: 506 KRTLEDLKGNSNSSAIPLLESAESNGTDLANIITTSQIKSIQNIFHSLASEINSQKLN-- 563

Query: 561 DVTSKEGKDSLVFSKIFN-SRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIAFS 619
               +  + S++F+ I N   +  + Y   T+ LI + +L  RQ E+   ++Q       
Sbjct: 564 --NEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHELLKRQHEITRTLEQ------- 614

Query: 620 MEVQDTHKESMKQPFPEPE------------EVISQSHLPAFEDKEEQEDLDEIIVLKDT 667
            E  D   +S+  P  E E            EVI+    P+ E+ EE +  DE+I L+  
Sbjct: 615 -EYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSD--PSQEEIEENK--DEVITLR-- 667

Query: 668 KDXXXXXXXXXXXSADSDHTVIDYSKGDKILS---QDNRRRTPNKRKYDPFSADNNENAL 724
           K            S  + H ++DY+ G  +L+    +   +   KR++DP+S ++     
Sbjct: 668 KRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSVEH--VGP 725

Query: 725 QGAKRRRPTAKNRNVSFKR 743
           Q  K++   AK +NVSFKR
Sbjct: 726 QPIKKKSKPAKGKNVSFKR 744

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/730 (48%), Positives = 486/730 (66%), Gaps = 30/730 (4%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFY++L++E ++ L + S K+TDM+N II S+DE+ E     ++ +   WKD GN++
Sbjct: 26  QDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFELKEDEISGLWKDFGNIM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+L E++DHS+D L+  +    +  +++YL D    +S +  RL KPQL F   +DNSE+
Sbjct: 86  DNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKRLEKPQLKFKKSIDNSES 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF PLL +KPNA+ PL E L++ +  E+ P HY  PY  EID QEY+  VLQ    IPS
Sbjct: 146 HPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYAYEIDHQEYSSDVLQIKKEIPS 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K W+++E IW+D +  L  ML +LK A+E+AVDLEHHD+RSYYGI CLMQ+STR  DYLV
Sbjct: 206 KSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYYGIVCLMQVSTRERDYLV 265

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTI LRD L +LN VFTDP I K+ HGAFMDIIWLQRDLGLY+V LFDTYHAS+A+G PR
Sbjct: 266 DTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 325

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE FA+FKTSK+YQLADWR RPLSK M AYARADTHFLLNI+DQLRN LI+ +K
Sbjct: 326 HSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHFLLNIYDQLRNKLIESNK 385

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L+ESR VAKRRFEYSK++P  PSS V+SP E + PWR ++YQYNI S+K ELVK L
Sbjct: 386 LAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVLMYQYNITSEKEELVKDL 445

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           + WRD IARRDDESPR++MPNQL+A+LV Y P +  GV+S+   +T+ VR NAK +ANLI
Sbjct: 446 YLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTNGVTEHVRQNAKVLANLI 505

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYS--SNNSNLN 560
           ++ L ++K+ N             E+  + +S   I   +SQ  +I+E++S  SN+  +N
Sbjct: 506 ENALGNIKDTN----KKTTSITSSESKPDGISLEVI--TISQIRDIMERFSLLSNSGVIN 559

Query: 561 DVT-SKEGKDSLVFSKIFNSRDDIITYD-KGTKHLITEQQLSDRQKEVDAAMKQAEEIAF 618
           + T + +   S++  K     +  I+Y  KGT + +  + +  R ++ ++A+   E I F
Sbjct: 560 NRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDIKARAQKFNSALAGLENIMF 619

Query: 619 SMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXX 678
            +E   T   S+++   E  E+ S   LP+     + E  D+IIVLK  K          
Sbjct: 620 ELEKPVTVPASVEK--GEAVEIESAPELPS-----KAESFDDIIVLKKKK------MHKK 666

Query: 679 XXSADSDHTV---IDYSKGDKILSQ--DNRRRTPNKRKYDPFSADNNENALQGAKRRRPT 733
             +   D TV   +DYSK   +LS      R+   KR++DP S  N+    + AK++RP 
Sbjct: 667 QPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSS--NDSEGPRAAKKKRPA 724

Query: 734 AKNRNVSFKR 743
            + +N+SFKR
Sbjct: 725 PRGKNMSFKR 734

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/731 (48%), Positives = 482/731 (65%), Gaps = 33/731 (4%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFY++LD+  +  L + + K+ DM N II S+DE+ E     +E++ + W + GN++
Sbjct: 26  QDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFELKEEDISDLWNNFGNIM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+L E++DHS+D L+ A    S    ++YL +          R+ KPQL F  P+DNSE+
Sbjct: 86  DNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPTKRVEKPQLKFKSPIDNSES 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF PLL +KPNA+ PL E L++VD  E+ P HYP PYE EID QEY+ ++LQ  + IPS
Sbjct: 146 HPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPEILQIREEIPS 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K W+++  IWVD    L +ML +LK   E+AVDLEHHD+RSYYGI CLMQISTR  DYLV
Sbjct: 206 KSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLV 265

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DT+ LR+ L +LN VFT+P I K+ HGAFMDIIWLQRDLGLY+V LFDTYHAS+A+G PR
Sbjct: 266 DTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 325

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE FA+FKTSK+YQLADWR RPLSK M AYARADTHFLLNI+DQLRN LI+ +K
Sbjct: 326 HSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNK 385

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L+ESR VAKRRFEYSKY+P  PSS V+SP E + PW+ ++YQYNIP ++  LV+ L
Sbjct: 386 LAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWKILMYQYNIPPEREVLVREL 445

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           ++WRD IARRDDESPR++MPNQL+A+LV Y PT+  GV+S+   +T+ VR NAK +ANLI
Sbjct: 446 YQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQNAKLLANLI 505

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSS-NNSNLND 561
           +  L ++KN N             ET ++ +    I   V Q  +++E++S   NSN++ 
Sbjct: 506 RDALRNIKNTN----EEATPIPSSETKADGILLETIS--VPQIRDVMERFSVLCNSNISK 559

Query: 562 VTSKEGKD-SLVFSKIFNSRDDIITYDK-GTKHLITEQQLSDRQKEVDAAMKQAEEIAFS 619
             +K   + S++  KI    +  I Y K G  + +  + +  R +   +A+   E+I F 
Sbjct: 560 SRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIRIRAQNFKSALANLEDIIFE 619

Query: 620 MEVQDTHKESMKQPFPEP---EEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXX 676
           +E          +P   P   EE+ +     A     E ++LD+++VLK  K+       
Sbjct: 620 IE----------KPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLK-KKNIQKKQPA 668

Query: 677 XXXXSADSDHTVIDYSKGDKILS----QDNRRRTPNKRKYDPFSADNNENALQGAKRRRP 732
                 + D   +DYSK   ILS    Q+NR++   KR++DP S+D+  N  + AK+RRP
Sbjct: 669 KEKGVTEKD--AVDYSKIPNILSNKPGQNNRQQ--KKRRFDPSSSDS--NGPRAAKKRRP 722

Query: 733 TAKNRNVSFKR 743
            AK +N+SFKR
Sbjct: 723 AAKGKNLSFKR 733

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/729 (48%), Positives = 477/729 (65%), Gaps = 29/729 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFY++LD+E    L + S K+ DM N II S+DE+ E      E++   W D GN++
Sbjct: 66  QDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWNDFGNIM 125

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVT---RLSKPQLNFSVPVDN 139
           D+L E++DHS+D L++A     N   ++YL D   F   N++   R+ KPQL F  P+DN
Sbjct: 126 DNLLEMSDHSLDKLNRAVTSKPNGADLQYLGD---FSEKNLSPAKRVEKPQLKFKTPIDN 182

Query: 140 SETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDP 199
           SE+HPF PLL +KPNA+ PL + L++++  ++TP HYP PYE EID QEY   +LQ    
Sbjct: 183 SESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIRKE 242

Query: 200 IPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTD 259
           IPSK W ++E IW+D    L +ML ELK   E+AVDLEHHD+RSYYGI CLMQISTR  D
Sbjct: 243 IPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTREKD 302

Query: 260 YLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALG 319
           YLVDT+ LR+ L +LN VFTDP I K+ HGAFMDIIWLQRDLGLY+V LFDTYHAS+A+G
Sbjct: 303 YLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIG 362

Query: 320 FPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQ 379
            PRHSLAYLLE FA+FKTSK+YQLADWR RPLSK M AYARADTHFLLNI+DQLRN LI+
Sbjct: 363 LPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKLIE 422

Query: 380 EDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELV 439
            +KLA +L+ESR VAKRRFEYSKY+P +PSS V+SP E + PWR ++YQYNI S+K ELV
Sbjct: 423 SNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEELV 482

Query: 440 KRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIA 499
           K L++WRD IARRDDESPR++MPNQL+A+LV Y P +  GVIS+   +T+ VR NAK + 
Sbjct: 483 KDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKVLV 542

Query: 500 NLIKSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSS-NNSN 558
           NLIK++L  +K+               E+ +N++S   I   + Q  +I+E++S  +NSN
Sbjct: 543 NLIKNSLRHIKDT----YKEDSPVTFSESMTNEVSLEAI--TIPQIRDIMERFSVLSNSN 596

Query: 559 LNDVTSKEGKD-SLVFSKIFNSRDDIITY-DKGTKHLITEQQLSDRQKEVDAAMKQAEEI 616
           +++  +K G   S++  +I    ++ I Y + G  + +  + +  R +  ++A+   E+ 
Sbjct: 597 VSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQSFNSALSNLEDC 656

Query: 617 AFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXX 676
              +E       ++K+      E I+   +P  +     E+ D+I+VLK           
Sbjct: 657 MLEVEKPHILPTNVKKI-----ERINTEDVP--KHSATIENPDDIVVLKKKNIHRTQSMN 709

Query: 677 XXXXSADSDHTVIDYSKGDKILS--QDNRRRTPNKRKYDPFSADNNENALQGAKRRRPTA 734
                 +     IDYSK   +LS   D  RR   KR+ DP    N+ +  + AK++RP  
Sbjct: 710 AKDTMGEK---AIDYSKIPNVLSSKSDQNRRQQKKRRSDPLF--NDSDGPRAAKKKRPAT 764

Query: 735 KNRNVSFKR 743
           + RNVSFKR
Sbjct: 765 RGRNVSFKR 773

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/726 (49%), Positives = 487/726 (67%), Gaps = 19/726 (2%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDV+F++S+D  +A+SL  + + +  ++N+I+ S+D N+E L    ENL+E  K+  N++
Sbjct: 26  QDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D LFE AD S+D L++ S  + N   M++L+D    E+D   R+SKPQLNF  PVDNSE+
Sbjct: 86  DVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSES 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF+PLL +KPNA+  ++E  ++V  TED P+H+ QPYE EI  QEYN  +L+  +PIPS
Sbjct: 146 HPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPS 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
             W +T AIWVDN  SL  M+ ELK ++E+AVDLEHHDFRSYYG+ CLMQISTR  DY+V
Sbjct: 206 TSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYIV 265

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALRD L++LN VFT+P ITK+ HGAFMDIIWLQRDLGLYIVSLFDT+HAS+ALG P+
Sbjct: 266 DTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYIVSLFDTFHASKALGLPK 325

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE++A+FKTSK+YQLADWR RPLSKAM AYARADTHFLLNIFDQ+RN LI   K
Sbjct: 326 HSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIFDQMRNGLISSGK 385

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L ESR VA RRFEYSKYKP +P + +F+P E + PWR+++YQYNIP  K  L++ L
Sbjct: 386 LAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWRTLMYQYNIPVDKEPLIREL 445

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRD +ARRDDESPRY+MPNQL+ SLV Y P +P  V+SV+ ++TD VR N+K +ANLI
Sbjct: 446 YEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSVSSVVTDHVRRNSKTLANLI 505

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVS-QFENILEKYSSNNSNLND 561
           K  LE++K   +          ++  SS D+S  +++F+ S + E +   +    + L  
Sbjct: 506 KKKLEEIKLGEV------KSINNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQ 559

Query: 562 VT-SKEG-KDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIAFS 619
            T SK+    S+V S+I    +  + Y  G+   + E +L DR      A   A     +
Sbjct: 560 ATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNIN 619

Query: 620 MEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXXX 679
           M ++ ++  +   P  E EE  ++         E+QED+DEI+VLK  K           
Sbjct: 620 MVLETSNSNA---PL-ETEETHNKKSDQIQVIPEKQEDMDEIVVLK-KKKIHSNDQKAKH 674

Query: 680 XSADSDHTVIDYSKGDKILSQDNR--RRTPNKRKYDPFSADNNENALQGAKRRRPTAKNR 737
              D     +DYSK + IL+ DNR  ++   KR +DP+S+       + AK+RR   K +
Sbjct: 675 DDGDIVEEPVDYSKAN-ILASDNREVKKKDKKRVFDPYSSTG--EGPKAAKKRRLVTKGK 731

Query: 738 NVSFKR 743
            +SFK+
Sbjct: 732 KISFKK 737

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/729 (47%), Positives = 470/729 (64%), Gaps = 31/729 (4%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFY+SLD  I+ SL  TS K+  +IN ++ S+D+N++ +  G+  L+ SW +IG ++
Sbjct: 29  QDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIEPGRAGLENSWNNIGEVM 88

Query: 83  DSLFELADHSIDALSKASQKSSN--DPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNS 140
           D LFE ++H++ A+ K   K SN     ++YL+DS       +T+++KPQ +FS PVDN+
Sbjct: 89  DLLFEKSEHALAAMKK---KGSNIIGNNLQYLDDSQPLTDTTLTKITKPQASFSRPVDNT 145

Query: 141 ETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPI 200
           E+HPF+PLL  KPNA+ PLD+VL++    E  P HYP PYE EID QEY+E VL+   PI
Sbjct: 146 ESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEIDHQEYDESVLEIRPPI 205

Query: 201 PSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDY 260
           PSK WEET+A WVDN  +L  M+ EL  A ELA+DLEHHD+R+YYGITCLMQISTR  D+
Sbjct: 206 PSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYYGITCLMQISTRENDW 265

Query: 261 LVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGF 320
           LVDTIALRD L VLN +FT+PK+ K+ HGAFMD+IWLQRDLGLY+VSLFDT+HASR LGF
Sbjct: 266 LVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYLVSLFDTFHASRLLGF 325

Query: 321 PRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQE 380
           P+HSLAYLLER+AHFKTSK+YQLADWR RPLSK + AYARADTHFLLNI+DQ+RN LI++
Sbjct: 326 PKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHFLLNIYDQMRNSLIEQ 385

Query: 381 DKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVK 440
            KLA  LH SR VAKRRFEY+K++PT+ +S V+SP E + PWRS+I+ YNIP  K  L+K
Sbjct: 386 GKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSLIFHYNIPQSKSFLLK 445

Query: 441 RLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIAN 500
           RL+EWRDTIARRDDESPRY+MPNQL+ +LV   PT+  G++SV   +T+ VRSNAK+++ 
Sbjct: 446 RLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTSFVTEHVRSNAKSLSQ 505

Query: 501 LIKSTL---EDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNS 557
           LIK TL   +D+  + I          D + S  D+  +   F         ++Y+  + 
Sbjct: 506 LIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKANHQNF---------DQYTRKSR 556

Query: 558 NLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIA 617
            L        +   +F       +  ++Y     H I    L DR++ V      A+ I 
Sbjct: 557 ELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDDRRELV------AQNIT 610

Query: 618 FSMEVQDTHKESM-KQPFPEPEEVISQSHLPAFED---KEEQEDLDEIIVLKDTKDXXXX 673
            +  V +  + ++ K P PE  + + +       D    + +ED DEI+VLK  K     
Sbjct: 611 TTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVVLKRRKALPQS 670

Query: 674 XXXXXXXSADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNNENALQGAKRRRPT 733
                    +    ++D+    KI++        + +++DP++     +   G KRR+ T
Sbjct: 671 SSPPKNAEGNPKE-ILDFKNNKKIMTATASVPRKSTKRFDPYAI--QASGPDGVKRRKKT 727

Query: 734 AKNRNVSFK 742
            +    SFK
Sbjct: 728 -RGIQKSFK 735

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/732 (46%), Positives = 470/732 (64%), Gaps = 24/732 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QD+DFYRSL   +   L +TS  V  +IN ++ SVDEN+  L  G++N ++SWK++ N++
Sbjct: 26  QDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNNELKPGRDNFEDSWKELSNVM 85

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D++FE +DH+ D++   S   +    M+YL DS + +S    R+ KPQL F  PVDN+E 
Sbjct: 86  DNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTPSKRIEKPQLLFKTPVDNTEL 145

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF+PLL +KP+A+ PL+E L +    E+ P HYP PYE EIDKQ YN+ VL+  + I  
Sbjct: 146 HPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEYEIDKQPYNDSVLEVRERIDP 205

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           + WE TE IWVDN ESL+ ML+ELK   ELAVDLEHHD+RSYYGI CLMQIS+R+ D+LV
Sbjct: 206 QPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYRSYYGIVCLMQISSRSKDWLV 265

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALRD L VLNV+  DP + K+ HGAFMD+IWLQRDLGLY+VSLFDTYHASRALGFP+
Sbjct: 266 DTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLGLYVVSLFDTYHASRALGFPK 325

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE FA FKTSK+YQLADWR RPL K +  YAR+DTHFLL+I+D LRN L++  K
Sbjct: 326 HSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSDTHFLLSIYDDLRNALVKAGK 385

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +L+ SR VAKRRFEY+ ++P +P S V+SP ES  PWR ++YQYN+P  K  L+K+L
Sbjct: 386 LAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIESTEPWRKLMYQYNLPPSKEPLLKKL 445

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRDT+ARRDDES RY+MPNQL+ SLV   P+  AGV+SV+  +TD VRSNA+ +ANLI
Sbjct: 446 YEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSETAGVLSVSTYVTDYVRSNARTLANLI 505

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLNDV 562
           K TLE +K             +     +  LS   I+ +   F ++L +    + ++   
Sbjct: 506 KRTLETIKAGTASVAEFSSSERALSNPAATLSLHMIQNLDDHFRSLLMEAQKQSGSI--- 562

Query: 563 TSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKE-VDAAMKQAEEIAFSME 621
              +   SL+F+    +    + Y  G KH+I +  L  R+   +     Q  E    +E
Sbjct: 563 -CSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNVLQTRKHALLQKFTSQPVEPVTDIE 621

Query: 622 VQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLD----EIIVLKDTKDXXXXXXXX 677
              +H+ S +   P+  E IS S     +++ ++++ D    EI+VL+  K         
Sbjct: 622 AP-SHQSSSEN--PQVSEDISPSEPQESQNEVQKDEPDFEKSEIVVLRKKK---KAHAQK 675

Query: 678 XXXSADSDHTVIDYSKGDKILSQDNR-------RRTPNKRKYDPFSADNNENALQGAKRR 730
              ++ S    +DYS   ++L +          +  P KRK+DP+  DN  NA  G K++
Sbjct: 676 PKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKFDPYGQDN--NAPSGVKKK 733

Query: 731 RPTAKNRNVSFK 742
              +K +++SFK
Sbjct: 734 NKPSKGKSISFK 745

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/733 (47%), Positives = 475/733 (64%), Gaps = 24/733 (3%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDVDFY+SLDK+++ SL  T+    D+ NS++ S+DEN   L EGK+ + + W    N++
Sbjct: 51  QDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPDFWNGFSNIM 110

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D+L E +DH IDALSK +  +    +  +L+++    S+   R+ KPQL FS PVDN+++
Sbjct: 111 DNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTNSNPSKRIEKPQLLFSKPVDNTDS 170

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
            PF+PLL +KPNA+ PL + L +V  +   P HY QPYE EID QEYNE+V++  DP P 
Sbjct: 171 RPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYEYEIDNQEYNEEVVEIRDPTPY 230

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
           K WE T AIW+D +ESLA +L +L+  +E+AVDLEHHD RSYYGITCLMQISTR  DY+V
Sbjct: 231 KPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDLRSYYGITCLMQISTREQDYIV 290

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTI+LRD L VLN +FT+P ITK+ HGA MDIIWLQRDLGLYIVSLFDT+HAS+ALG  R
Sbjct: 291 DTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDLGLYIVSLFDTFHASKALGLAR 350

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLE +A FKTSK+YQLADWR RPL+  M AYAR+DTHFLLNIFDQLRN LI+++K
Sbjct: 351 HSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARSDTHFLLNIFDQLRNTLIKQNK 410

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           LA +LHESR VAKRRFEY K++PT+P   +++  E + PW+S++ QYNI  +K  LV++L
Sbjct: 411 LAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKEAPWKSLLIQYNIQDEKEILVQKL 470

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           WEWRD IARRDDESPRYIMP Q++ SL+ Y PT+ +GVISV+ M+T+ VRSN+  +ANLI
Sbjct: 471 WEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVISVSNMVTEHVRSNSTTLANLI 530

Query: 503 KSTLEDMKN--NNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLN 560
           K  LE  K+  N+         ++     ++ +S ++I  I  +F ++ + Y+++     
Sbjct: 531 KKALESTKSIPNSSDSSSTFNMSRTDTNVASLISITEINNICLKFNSLSKHYNTSKF--- 587

Query: 561 DVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAE---EIA 617
            +TS     SL+FS I  S   I  Y K        + +  R   +   +K         
Sbjct: 588 -LTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSEDMIARHIRLSEGLKGLSANNSFI 646

Query: 618 FSMEVQDTH--KESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXX 675
           +   V+D    + + + P P  E   +Q        KE  ED +EIIVLK          
Sbjct: 647 YQPPVEDIKSIEITTENPIPTLEPKSTQKK----TTKEINEDNEEIIVLKKVN----RKY 698

Query: 676 XXXXXSADSDHT-VIDYSKGDKILSQDNRRRTPNKRK---YDPFSADNNENALQGA-KRR 730
                 AD D T V+DYSK  KI  + +     N +K   +DP++ D + + +  A K+R
Sbjct: 699 QKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDPYNNDGDTDKVPRALKKR 758

Query: 731 RPTAKNRNVSFKR 743
           +   + +N+S+KR
Sbjct: 759 QTNTRGKNISYKR 771

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/698 (48%), Positives = 461/698 (66%), Gaps = 19/698 (2%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QDV FY++LD  IA+S+ N S ++  +IN I+ SVDEN++ + +G E L+ +W ++G ++
Sbjct: 29  QDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIEQGSEGLESAWSNVGEVM 88

Query: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142
           D LFE ++H++ A  K      +   ++YL+DS +       ++ KPQL F  P+DNSE+
Sbjct: 89  DLLFEKSEHALAAGEKRDNGELSK-TVQYLDDSPSLHDGAPKKILKPQLLFKRPIDNSES 147

Query: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202
           HPF+PLL  KP+A+  LDE L++    ED P HYPQPYE EID QEYNE VLQ S+P+PS
Sbjct: 148 HPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDHQEYNESVLQISEPVPS 207

Query: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262
             W+ETEA WVDN ++L  MLNEL  A E+A+DLEHHD+R+YYGITCLMQISTR  D+L+
Sbjct: 208 LPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTYYGITCLMQISTREKDWLI 267

Query: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322
           DTIALRD L +LN VFTDPKITK+LHGAFMDIIWLQRDLGLYIVSLFDTYHASR LG P+
Sbjct: 268 DTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIVSLFDTYHASRLLGSPK 327

Query: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382
           HSLAYLLER+AHFKTSK+YQL+DWR RPL KA+ AYARADTHFLLNI+D +RN LI+++K
Sbjct: 328 HSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFLLNIYDNMRNSLIEQNK 387

Query: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442
           L+ +LH+SR VAKRRFE++ ++P + +S VFSP E + PWR++++QYNIP  K  LV+RL
Sbjct: 388 LSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLMFQYNIPQSKSLLVRRL 447

Query: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502
           +EWRD +ARRDDESPRY++PNQL+ SL    PT PA +++ +  +T+ +R NAK++A LI
Sbjct: 448 YEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTFVTEHIRQNAKSLALLI 507

Query: 503 KSTLEDMKNNNIXXXXXXXXAKDKETSSNDLSTSQIKFIVSQFENILEKYSSNNSNLNDV 562
           K +LE   N            ++  +S   +S+  I+     FE  LE +S   +   D 
Sbjct: 508 KKSLESSSNEFGQLLNSANTVQN--SSPTKMSSEDIEKNSRMFEKFLEDFSYEKA--ADC 563

Query: 563 TSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQAEEIA---FS 619
               G  S +F K F   ++ ++Y +    L+    L +R+ +V    +   +IA     
Sbjct: 564 GISLG--SSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQVSKKYEAERDIARPQVH 621

Query: 620 MEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEIIVLKDTKDXXXXXXXXXX 679
           +    +H    K+   E  E   +      E+K  +E++DE+IVLK  K           
Sbjct: 622 IRAASSHAVCDKEAGAEDNESAEE------ENKARKEEMDEVIVLKQRKTLADKEQRAVD 675

Query: 680 XSADSDHTVIDYSKGDKIL-SQDNRRRTPNKRKYDPFS 716
            +  S    +D     KIL +  N  R P KR +DP++
Sbjct: 676 KATPSIEP-LDLQSARKILEAPSNNVRRPKKR-FDPYA 711

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/738 (45%), Positives = 470/738 (63%), Gaps = 33/738 (4%)

Query: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82
           QD+DF R LD  +   L  TSQ +  ++N +I S  + +  L  GK+NL+ +WKD+ N++
Sbjct: 26  QDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDLEVGKDNLEAAWKDLSNII 85

Query: 83  DSLFELADHSIDALSKASQKSSN--DPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNS 140
           D+LFE +DHS+D L K    SS+  D  M+YLN     +     R+ KPQL F +PVDNS
Sbjct: 86  DNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVDSQRDGKLSQRIVKPQLQFKIPVDNS 145

Query: 141 ETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPI 200
           E HPF+PLL  KP+A+ PL+EV  +   TE  P HYP PYE EID Q Y++ VL   +PI
Sbjct: 146 ECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYEYEIDNQPYDDSVLTIKEPI 205

Query: 201 PSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDY 260
               W+E E IWVDN  +L  MLN LK   E+AVDLEHHD+RSYYG+ CLMQISTR +D+
Sbjct: 206 EPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDYRSYYGLVCLMQISTRESDW 265

Query: 261 LVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGF 320
           LVDTIALR  LQVLN +FTDP I K+ HGAFMDIIWLQRDLGLY+VSLFDTYHASRALGF
Sbjct: 266 LVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGF 325

Query: 321 PRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQE 380
           P+HSLAYLLE FA+FKTSK+YQLADWR RPLSK M  YARADTHFLLNI+D+LRN LI+E
Sbjct: 326 PKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARADTHFLLNIYDKLRNSLIKE 385

Query: 381 DKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVK 440
           DKL+ +LH SR VAKRRFEY+ ++P + S  VFSP E D PWR+++ QYN+P  K  L++
Sbjct: 386 DKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEKDDPWRTLMSQYNVPDIKEPLMR 445

Query: 441 RLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIAN 500
           +L++WRD +AR+DDES RY+MPNQL+ SLV   P++P+G+++V   + D VR+NA+ + N
Sbjct: 446 KLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLLTVKSYIPDHVRANARVLCN 505

Query: 501 LIKSTLEDMKNNNIXXXXXXXXAKDKETSSN-DLSTSQIKFIVSQFENILEKYSSNNSNL 559
           +I  T+E++K+ +              ++ + ++S S IK +   F+ +L++  S+    
Sbjct: 506 IINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMSVSLIKTMDRHFKFLLDEVQSHAVEP 565

Query: 560 NDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVD---AAMKQAEEI 616
           + V     +DSL+F      +   + Y+   K L+ +++L DR+ ++    + + +A  I
Sbjct: 566 SSVC----EDSLLFKGFLFDKPKAVAYNSVGKRLVNDRELLDRKSDLSQKFSKVFKAAGI 621

Query: 617 AFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEE-----QEDLDEIIVLKDTKDXX 671
           A       +H E +      P +  S    P+ E+ +      +ED  EIIVLK  +D  
Sbjct: 622 AIG-----SHIEKLSSNSELPADTTSNVESPSKEESKNNSDDLKEDKHEIIVLKRKRD-- 674

Query: 672 XXXXXXXXXSADSDHTVIDYSKGDKILSQDNRRRTPN------KRKYDPFSADNNENALQ 725
                    S       +DY+  + IL   +++  PN      KRK+      + + ++ 
Sbjct: 675 -YGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKFH----SDLQGSIG 729

Query: 726 GAKRRRPTAKNRNVSFKR 743
            A  ++P +K + VS+K+
Sbjct: 730 AAAIKKPRSKGKTVSYKK 747

>ZYRO0G04840g Chr7 (385234..387135) [1902 bp, 633 aa] {ON} similar
           to uniprot|P39682 Saccharomyces cerevisiae YML046W PRP39
           U1 snRNP protein involved in splicing contains multiple
           tetriatricopeptide repeats
          Length = 633

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%)

Query: 376 MLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQK 435
           +L +   L+S+     ++ +++  Y+KY  T  ++ + S    D+P + M+   NIP   
Sbjct: 376 LLKRHQFLSSIDQNDEEILQKQVCYAKYLETAITNYLQSKIAKDIPLQEMLNDINIPIVV 435

Query: 436 VELVKRLW 443
           VEL+K  W
Sbjct: 436 VELIKITW 443

>Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON}
           similar to Ashbya gossypii ADR400W
          Length = 790

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 65  VEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSN--DPKMKYLNDSLNF 118
           +E  E++ ES   + NLL +  +LADH  DAL KA +   N  D K+  L+ +L+ 
Sbjct: 268 MEHTESVTESLNSMSNLLLNKLDLADHERDALKKACELGPNYLDIKINALSKTLSI 323

>TPHA0C03120 Chr3 complement(689473..691068) [1596 bp, 531 aa] {ON}
           Anc_2.244 YIL119C
          Length = 531

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%)

Query: 26  DFYRSLDKEIASSLTNTSQKVTDMINSIISSVD 58
           D  ++ +KE+ + LT+  QK+T+MIN +ISS D
Sbjct: 361 DTSKNNEKEVTAILTSNKQKITNMINDLISSQD 393

>YPR179C Chr16 complement(893797..895764) [1968 bp, 655 aa] {ON}
           HDA3Subunit of a possibly tetrameric trichostatin
           A-sensitive class II histone deacetylase complex that
           contains an Hda1p homodimer and an Hda2p-Hda3p
           heterodimer; required for the activity of the complex;
           has similarity to Hda2p
          Length = 655

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 17/152 (11%)

Query: 525 DKETSSNDLSTSQIKFIVSQFENILEKYSS----NNSNLNDVTSKEGKDSLVFSKIFNSR 580
           D  +  +DL    +KF  ++ E I+++Y +    NN NLN     E +++L FS+I    
Sbjct: 440 DDYSCLDDLQNDHLKFFSNEDEKIIKEYETVLRTNNENLNRSHELEVENNLKFSQIETLE 499

Query: 581 DDIITYDKGTKHLITEQQLSDRQKE-------VDAAMKQAEEIAFSMEVQDTHKESMKQP 633
            DI T  KG+  L+ + +   + K+       V   +++ E ++ S   +DT K+ M+Q 
Sbjct: 500 KDIETL-KGS--LMAQGETLSKLKDAFVKTDNVQDEIEKEERVSVS---RDTEKKYMEQE 553

Query: 634 FPEPEEVISQSHLPAFEDKEEQEDLDEIIVLK 665
                + I ++     +  E+Q  L+  + LK
Sbjct: 554 IKRAVDAIRENEEETHKLNEKQNGLESELKLK 585

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,198,018
Number of extensions: 3726928
Number of successful extensions: 14514
Number of sequences better than 10.0: 180
Number of HSP's gapped: 15225
Number of HSP's successfully gapped: 186
Length of query: 743
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 626
Effective length of database: 40,065,477
Effective search space: 25080988602
Effective search space used: 25080988602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)