Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003506.22ON55955929050.0
Kpol_1037.276.22ON54654422020.0
KAFR0A050706.22ON56454620480.0
NCAS0D021606.22ON56354820360.0
CAGL0E02629g6.22ON54854620160.0
NDAI0C026306.22ON58054920000.0
KNAG0F028906.22ON56355919660.0
ZYRO0C07744g6.22ON54754619620.0
YOR002W (ALG6)6.22ON54453119530.0
Smik_15.1716.22ON54453119410.0
Suva_15.1776.22ON54453119370.0
KLLA0D01221g6.22ON56656819310.0
Skud_15.1636.22ON54453119280.0
TDEL0G044706.22ON54254619200.0
KLTH0C11176g6.22ON53653119120.0
SAKL0E01364g6.22ON54152619110.0
Kwal_56.224376.22ON53652919070.0
TBLA0G009706.22ON55954518810.0
Ecym_30276.22ON54955818330.0
ACR004W6.22ON56352918180.0
TBLA0A093105.669ON5463963066e-29
TPHA0J013805.669ON5753813067e-29
YOR067C (ALG8)5.669ON5772722996e-28
Kpol_1018.735.669ON6212662926e-27
Smik_15.2475.669ON5772662901e-26
Kwal_55.217425.669ON5554092881e-26
CAGL0L10450g5.669ON5502662862e-26
Suva_8.1185.669ON5762722863e-26
KLTH0F17666g5.669ON5554172845e-26
Skud_15.2345.669ON5772722836e-26
ADR210C5.669ON5722702811e-25
ZYRO0A11506g5.669ON5562632801e-25
KNAG0L019205.669ON5682702802e-25
NCAS0G004505.669ON5703732773e-25
TDEL0B025405.669ON5692702748e-25
NDAI0F005105.669ON5704182685e-24
KLLA0F16621g5.669ON5613752651e-23
SAKL0G00836g5.669ON5612672651e-23
KAFR0D024405.669ON5752702651e-23
Ecym_40515.669ON6042682581e-22
KAFR0J016202.242ON57021689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00350
         (559 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...  1123   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   852   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   793   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   788   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   781   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   775   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   761   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   760   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   756   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   752   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   750   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   748   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   747   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   744   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   741   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   740   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   739   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   729   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   710   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   704   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   122   6e-29
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   122   7e-29
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   119   6e-28
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   117   6e-27
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   116   1e-26
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   115   1e-26
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   114   2e-26
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   114   3e-26
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   114   5e-26
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   113   6e-26
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   112   1e-25
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   112   1e-25
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   112   2e-25
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   111   3e-25
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   110   8e-25
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   107   5e-24
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   106   1e-23
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   106   1e-23
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   106   1e-23
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   103   1e-22
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    31   9.9  

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/559 (97%), Positives = 547/559 (97%)

Query: 1   MGKSGKHNSKKFVKQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVL 60
           MGKSGKHNSKKFVKQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVL
Sbjct: 1   MGKSGKHNSKKFVKQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVL 60

Query: 61  FALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLT 120
           FALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLT
Sbjct: 61  FALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLT 120

Query: 121 AYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVG 180
           AYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVG
Sbjct: 121 AYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVG 180

Query: 181 KQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISF 240
           KQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISF
Sbjct: 181 KQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISF 240

Query: 241 VMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG 300
           VMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG
Sbjct: 241 VMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG 300

Query: 301 GKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLP 360
           GKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLP
Sbjct: 301 GKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLP 360

Query: 361 AMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVS 420
           AMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEK            YTSTDWNVLSLVS
Sbjct: 361 AMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVS 420

Query: 421 WINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNT 480
           WINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNT
Sbjct: 421 WINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNT 480

Query: 481 HYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSF 540
           HYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSF
Sbjct: 481 HYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSF 540

Query: 541 WLWNYYKLFTLTSKNLQYL 559
           WLWNYYKLFTLTSKNLQYL
Sbjct: 541 WLWNYYKLFTLTSKNLQYL 559

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/544 (74%), Positives = 468/544 (86%), Gaps = 3/544 (0%)

Query: 18  KNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGM 77
           K  IS +++ ++ E F+ASPLY FLSPF+  +NQWL+ YIIV+FALI+RCAIGLG YSGM
Sbjct: 4   KKKISRINKPVE-ESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGM 62

Query: 78  NEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPA 137
              PMFGDFEAQRHWMEITQHLPIS+WYF+DL+YWGLDYPPLTAYHSY+ G+IG F N +
Sbjct: 63  GNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKS 122

Query: 138 WFELETSRGMEMK--ELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAA 195
           WF L  SRG E +  +LKT+MR T I+SE+IFYIP +IYFT WVG+ R+QS +GQYIAAA
Sbjct: 123 WFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAA 182

Query: 196 AILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAP 255
           AILFQP LMLIDHGHFQYNSVMLGLTVYAINNLLD+ YAPAA+ FV+SICFKQM+LYYAP
Sbjct: 183 AILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAP 242

Query: 256 IFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPF 315
           IFF YLLGRSLF ++FFN+SRFL+IAI+T+ +FF+++APLYVFGGG RN+IQSVHRIFPF
Sbjct: 243 IFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPF 302

Query: 316 ARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLP 375
           ARG+FEDKVANFWCVTN+ +KYK+ YTQ ELQLYSLI TVVGFLPA+VTIL++PKKHLLP
Sbjct: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362

Query: 376 YSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLK 435
           Y+LAAC+MSF+LFSFQVHEK            YTSTDWNVLS VSW+NNV LFTLWPLLK
Sbjct: 363 YALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422

Query: 436 KDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWK 495
           KDG+ LQYGVCF LSNWLIGNFSF TP+FLPK+LTPGPP+QN    Y RRSLLP+NI+WK
Sbjct: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482

Query: 496 IIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKN 555
           IIIV SYIVM+ I   E+FV PPP+YPDI+VL+NC LGF CF  FWLWNYYK+FTL +K 
Sbjct: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542

Query: 556 LQYL 559
           LQYL
Sbjct: 543 LQYL 546

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/546 (68%), Positives = 439/546 (80%)

Query: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73
            +++    S L+     E FYASPLY FL PF+   NQWL+ YIIV FALIIRCAIGLG 
Sbjct: 19  SKSNPKKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGS 78

Query: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133
           YSGM  +PMFGDFEAQRHWMEITQHLPIS+WY++DLQYWGLDYPPLTAYHSYI G IG F
Sbjct: 79  YSGMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSF 138

Query: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193
             P WF L  SRG+EM+ +K++MR T ++SE +FY PAIIYF+ W GK R QSP+GQYIA
Sbjct: 139 IYPKWFTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIA 198

Query: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253
           A AILFQP LMLIDHGHFQYNSVMLGLTVYAINNLLDD Y+ A++ FV+SICFKQMSLYY
Sbjct: 199 ATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYY 258

Query: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313
           APIFF YLL +SLF  + FN+ R + IA  T+V+F  +++PLY+FGGG  N+IQSVHRIF
Sbjct: 259 APIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIF 318

Query: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373
           PFARGIFEDKVANFWCVTN+++KYK+ +TQD+LQLYSL  TV+GFLPA+V I+ +PKKHL
Sbjct: 319 PFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHL 378

Query: 374 LPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPL 433
           LPY+LAAC+MSFFLFSFQVHEK            YTSTDWNVLS+V WINNVALFTLWPL
Sbjct: 379 LPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPL 438

Query: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493
           LKKDG++LQY VCF LSNWL+GNFSF TP+FLPK+LTPGP I  ++ +Y RRSLLP+NI+
Sbjct: 439 LKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNIL 498

Query: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553
           WK++IV SY+ M     L+ FVEPP  YPDI++ LNC +GF  F  FW+W YY LFTL +
Sbjct: 499 WKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRN 558

Query: 554 KNLQYL 559
           K L  L
Sbjct: 559 KTLMDL 564

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/548 (68%), Positives = 445/548 (81%), Gaps = 2/548 (0%)

Query: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73
           K++ K   +S    +  E FYASPLY  L PF+   +QW++ Y IVLF+LIIRCA+GLGP
Sbjct: 16  KKSGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGP 75

Query: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133
           +SG    PMFGDFEAQRHWMEITQHLPI +WY++DL+YWGLDYPPLTAYHSYICG IG F
Sbjct: 76  FSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSF 135

Query: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193
           FNP WF L++SRG E ++LKTFMRLT +VSE +FYIP ++YF  W+GK R+QSP+GQ+IA
Sbjct: 136 FNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIA 195

Query: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253
           AAAIL QP L+LIDHGHFQYNSV LGLTVYAINNLLD+ YA AA+ FV+SICFKQM+LYY
Sbjct: 196 AAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYY 255

Query: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG--GKRNIIQSVHR 311
           +PIFFAYLL +SLF  + FN+ RFL IAIAT+ SF  ++ PLYVFGG  G  N++QS+HR
Sbjct: 256 SPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHR 315

Query: 312 IFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKK 371
           IFPFARGIFEDKVANFWCVTNVI KYK+ +TQ ELQLYSL+LTVVGFLPAM+ IL++PKK
Sbjct: 316 IFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKK 375

Query: 372 HLLPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLW 431
           +LLPY+L+AC+M+F+LFSFQVHEK            YTSTD NVLS VSW+NN+ LFTLW
Sbjct: 376 YLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLW 435

Query: 432 PLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNN 491
           PLLKKDG+ LQY VC +LSNWLIGNFSF TP FLPK+LTPGP +  +  +Y  RSLLP N
Sbjct: 436 PLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRN 495

Query: 492 IIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTL 551
           I WK+IIVLSYI M AI  L+ FV PP  YPD++V+LNCTLGF CF  FW+WNYYKLF++
Sbjct: 496 IFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSM 555

Query: 552 TSKNLQYL 559
             K+L +L
Sbjct: 556 IKKSLHHL 563

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/546 (66%), Positives = 448/546 (82%), Gaps = 1/546 (0%)

Query: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73
           ++  K  +S  +     E FYASPLY FL PF+   +QWL+ +II++FA+IIRCAIGLGP
Sbjct: 4   EKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGP 63

Query: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133
           YSG  + PM GDFEAQRHWMEITQHLPIS+WY+YDL+YWGLDYPPLTA+HSY+ G +G F
Sbjct: 64  YSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTF 123

Query: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193
            NP WF L++SRG+E + LK +MR T ++SE IFY+PA++YFT W+G++R QSP+GQ+IA
Sbjct: 124 CNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIA 183

Query: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253
           AAAILFQP LMLIDHGHFQYNS+MLG TVYAINNLLD+ YAPAAI FV+SICFKQMSLYY
Sbjct: 184 AAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYY 243

Query: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313
           APIFFAYLLGRS+F  + FN+ RF++I+IAT+V+F  +F+P Y+F GG   + Q+V RIF
Sbjct: 244 APIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIF-GGLDGLAQTVRRIF 302

Query: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373
           PFARGIFEDKVANFWCV N I+K+KV +T D+L++YSLILTVVGF PAM+ I+ +P+KHL
Sbjct: 303 PFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHL 362

Query: 374 LPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPL 433
           LPY+LAAC+MSF+LFSFQVHEK            +TS DWNVLS+VSWINNVALFTLWPL
Sbjct: 363 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPL 422

Query: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493
           LK++G+ LQY VCF LSNWLIGNFSF TPRFLPK +TPGP I +V+ +YRRRSLLP++I 
Sbjct: 423 LKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIF 482

Query: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553
           WK+IIV SYI M A   L+LF+E PP++PD++V+LNCT+GF  F+ FWLW YYK  TL  
Sbjct: 483 WKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLK 542

Query: 554 KNLQYL 559
           KN+Q L
Sbjct: 543 KNIQDL 548

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/549 (66%), Positives = 443/549 (80%), Gaps = 3/549 (0%)

Query: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73
           K    N+   L+     E FYASPLY FL PF+   +QW++ YIIVLFA+IIRCA+GLGP
Sbjct: 32  KSKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGP 91

Query: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133
           YSG N  PMFGDFEAQRHWMEITQ+LPISQWY++DLQYWGLDYPPLTA+HSY+CG IG F
Sbjct: 92  YSGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSF 151

Query: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193
           F P WF L  SRG E ++LKTFMRLT + SE + YIPA++YFT W+GK+R QSP+GQ+IA
Sbjct: 152 FQPNWFTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIA 211

Query: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253
            AAILFQP L+LIDHGHFQ+NSVMLGLTVY +NNLLD+ YA AA+ FV+SICFKQM+LYY
Sbjct: 212 VAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYY 271

Query: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFG---GGKRNIIQSVH 310
           +PIFFAYLL +SLF  + FN+ RF  I+ AT+ +F ++F P+Y FG   GG  N++QS+ 
Sbjct: 272 SPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIK 331

Query: 311 RIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPK 370
           RIFPFARGIFEDKVANFWCVTNVI KYK N+TQ++LQLYSLILT++ FLPAM+ IL +P+
Sbjct: 332 RIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPR 391

Query: 371 KHLLPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTL 430
           K+LL Y+L+AC+MSF+LFSFQVHEK            YTSTD NVLS VSW+NN+ LFTL
Sbjct: 392 KYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTL 451

Query: 431 WPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPN 490
           WPLLKKDG+ LQY VC ILSNWLIGNFSF TPRFLPK+LTPGP I  +  +YRR +LLP+
Sbjct: 452 WPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPS 511

Query: 491 NIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFT 550
           N IWK+IIVLSY++M  I  ++ F+EPP  YPD++V+LNCTLGF CF  FWLWNYYKLF+
Sbjct: 512 NWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFS 571

Query: 551 LTSKNLQYL 559
           +T KN+  L
Sbjct: 572 MTKKNIHQL 580

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/559 (65%), Positives = 441/559 (78%), Gaps = 6/559 (1%)

Query: 2   GKSGKHNSKKFVK-QTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVL 60
           G+     +K   K Q +K++ +   E    E FYASP+Y FL PF+S  +QW++ YIIV+
Sbjct: 10  GEDASSKTKSLSKLQRNKDEAAPEVE----ECFYASPIYDFLYPFRSPGSQWVTEYIIVV 65

Query: 61  FALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLT 120
           F LII+ AIGLG YSG    PMFGDFEAQRHWMEITQHLP+SQWY++DLQYWGLDYPP T
Sbjct: 66  FLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFT 125

Query: 121 AYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVG 180
           AYHSY+ G IG F  P WFEL+ SRGME   +K++MR T ++SE IFYIPAI+YFT WVG
Sbjct: 126 AYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVG 185

Query: 181 KQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISF 240
           +++KQSP+GQ++AAAAILFQP LMLIDHGHFQYN VMLGLTVYAINNLLD  YA AA+ F
Sbjct: 186 RRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCF 245

Query: 241 VMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG 300
           V+SICFKQM+LYYAPIFFA LL +SLF  + FN+ RFL++A AT+ S F +FAPLY+F G
Sbjct: 246 VLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF-G 304

Query: 301 GKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLP 360
           G  N++QS+HRIFPFARGIFEDKVANFWCVTNV  KYK  +TQ ELQ YSL+ TVVGF P
Sbjct: 305 GVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFP 364

Query: 361 AMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVS 420
           A + ++++PKK L+PY LAAC+M+FFLFSFQVHEK            +TST+WN LS+V 
Sbjct: 365 AFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVF 424

Query: 421 WINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNT 480
           W+NNVALFTLWPLLKKDG+ LQY VC ++ NWL+GNFSF TPRFLPKILTPGP I N+  
Sbjct: 425 WVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAE 484

Query: 481 HYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSF 540
           +YRRRSLLP+NIIWKIII++SY+ M+ I  LE  +  P QYPD++V LNCT+GF CF  F
Sbjct: 485 NYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLF 544

Query: 541 WLWNYYKLFTLTSKNLQYL 559
           W+W YYKL TL +K +Q L
Sbjct: 545 WMWTYYKLITLRNKTIQEL 563

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/546 (67%), Positives = 441/546 (80%), Gaps = 2/546 (0%)

Query: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73
           K + K + +  D T + E FYASPLY FL PFK   +QWL  YII+LFA+IIRCAIGLGP
Sbjct: 4   KTSKKVEKAQADNTAE-ESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62

Query: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133
           YSG +  PM GDFEAQRHW+EITQHLPISQWY++DL+YWGLDYPPLTAYHSYI G +G  
Sbjct: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122

Query: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193
            NP WF L  SRG+E  +LKT+MR T I+SEVIFYIPA++YFT WVG+ R  SP+GQ+IA
Sbjct: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182

Query: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253
           AAAILFQP LMLIDHGHFQYN VMLG TVYAIN+L+D+ YAPAA  FV+SICFKQM+LYY
Sbjct: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242

Query: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313
           +PIFFAYLLGR +FK       RFL+IA+AT+ +F  ++ PLY+ G G +N++QSVHRIF
Sbjct: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIF 301

Query: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373
           PFARGIFEDKVANFWCVTN+ +KYK  +TQ +LQLYSL+ T +GFLPA+V +L +PKKHL
Sbjct: 302 PFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHL 361

Query: 374 LPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPL 433
           +P++LAAC+MSFFLFSFQVHEK            YTST+W+VLSLVSWINNV LFTLWPL
Sbjct: 362 VPFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPL 421

Query: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493
           LKKDG+ LQY VCF   NWLIGNFSF TP FLPK LTPGP + +V+++YRRRSLLP +II
Sbjct: 422 LKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSII 481

Query: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553
           WK+IIV SYI M AI  L++FV PP  YPD++V+LNCTLGF CF  FWLWNYYKLF+L  
Sbjct: 482 WKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAG 541

Query: 554 KNLQYL 559
           ++LQ L
Sbjct: 542 QSLQQL 547

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/531 (68%), Positives = 427/531 (80%), Gaps = 3/531 (0%)

Query: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90
           E FYASP+Y FL PF+   NQWL  YII + A+I+RC IGLGPYSG    P++GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQR 74

Query: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150
           HWMEITQHLP+S+WY+YDLQYWGLDYPPLTA+HSY+ GLIG FFNP+WF LE SRG E  
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESP 134

Query: 151 E--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208
           +  LKT+MR T I+S+++FY PA+IYFT W+G+ R QSP+GQ IAA+AILFQP LMLIDH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDH 194

Query: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268
           GHFQYNSVMLGLT YAINNLLD+ YA AA+ FV+SICFKQM+LYYAPIFFAYLL RSL  
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254

Query: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328
            +F N++R   IA AT+ +F  +FAPLY  GGG +NI Q +HRIFPFARGIFEDKVANFW
Sbjct: 255 PKF-NIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFW 313

Query: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388
           CVTNV +KYK  +T  +LQLYSLI TV+GFLPAM+  L  PKKHLLPY L AC+MSFFLF
Sbjct: 314 CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 389 SFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448
           SFQVHEK            Y+STDWNVLSLVSWINNVALFTLWPLLKKDG+ LQY V F+
Sbjct: 374 SFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL 433

Query: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508
           LSNWLIGNFSF TPRFLPK LTPGP I ++N+ YRRRSLLP N++WK  I+ +YI M   
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY 493

Query: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559
             L+ FV PP +YPD++VLLNC +GF CF+ FWLW+YYK+FT  SK+++ L
Sbjct: 494 HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/531 (67%), Positives = 427/531 (80%), Gaps = 3/531 (0%)

Query: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90
           E FYASP+Y FL PF+   NQWL  YII + A+I+RC IGLGPYSG    P+ GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQR 74

Query: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150
           HWMEITQHLP+S+WY+YDLQYWGLDYPPLTA+HSY+ GLIG FFNP+WF L+ SRG E  
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFESP 134

Query: 151 E--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208
           +  LKT+MR T I+S+++FY PA+IYFT W+G+ R QSP+GQ IAA+AILFQP LMLIDH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDH 194

Query: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268
           GHFQYNSVMLGLT YAINNLLD+ YA AA+ FV+SICFKQM+LYYAPIFFAYLL RSL  
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254

Query: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328
            +F N++R   I+ AT+ +F  + APLY  GGG +NI Q +HRIFPFARGIFEDKVANFW
Sbjct: 255 PKF-NIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDKVANFW 313

Query: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388
           CVTNV +KYK  ++  +LQLYSL+ TV+GFLPAMV  L  PKKHLLPY L AC+MSFFLF
Sbjct: 314 CVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 389 SFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448
           SFQVHEK            Y+STDWNVLSLVSWINNVALFTLWPLLK+DG+ LQY V F+
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVSFL 433

Query: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508
           LSNWLIGNFSF TPRFLPK LTPGP I ++N+ YRRRSLLP N++WK  I+ +YI M   
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY 493

Query: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559
             L+LFV PP +YPD++VLLNCT+GF CF+ FW+W+YYK+FT  SK+++ L
Sbjct: 494 HFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/531 (67%), Positives = 429/531 (80%), Gaps = 3/531 (0%)

Query: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90
           E FYASP+Y FL PF+   NQWL  YII + A+I+RCAIGLGPYSG    P+ GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQR 74

Query: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150
           HWMEITQHLP+S+WY+YDLQYWGLDYPPLTA+HSY+ GLIG FFNP+WF L+ SRG E  
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFESP 134

Query: 151 E--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208
           +  LKT+MR T I+S+++FY PA+IYFT W+G+ R QSP+GQ IAAAAILFQP LMLIDH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDH 194

Query: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268
           GHFQYNSVMLGLT YAINNLLD+ YA AA+ FV+SICFKQM+LYYAPIFFAYLL RSLF 
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLFF 254

Query: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328
            +F N++R   IA AT+ +F  +FAPLY  GGG RNI Q +HR+FPFARGIFEDKVANFW
Sbjct: 255 PKF-NIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDKVANFW 313

Query: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388
           CV+N+ +KYK  ++  +LQLYSL+ TV+GFLPAM+  L  PKKHLLPY L AC+MSFFLF
Sbjct: 314 CVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 389 SFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448
           SFQVHEK            Y+STDWNVLSLVSWINNVALFTLWPLLKKDG+ LQY V F+
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVSFL 433

Query: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508
           L+NWLIGNFSF TPRFLPK LTPGP I ++N+ YRRRSLLP N++WK  I+ +YI M   
Sbjct: 434 LTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY 493

Query: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559
             L+LFV PP +YPD++VLLNC +GF CF+ FW+W+YYK+FT  +K+++ L
Sbjct: 494 HFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/568 (62%), Positives = 436/568 (76%), Gaps = 11/568 (1%)

Query: 1   MGKSGKHNSKKFVKQTHKNDISSLDETLDT---------EPFYASPLYTFLSPFKSTTNQ 51
           MG   K   K  VK+T  +  ++ + T  T         E F+ASP+Y FL+PF+   NQ
Sbjct: 1   MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQ 60

Query: 52  WLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQY 111
           W + Y+IV+FALIIRCA+GLG YSGMN  PMFGDFEAQRHWMEITQHLP+ +WY+YDLQY
Sbjct: 61  WCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQY 120

Query: 112 WGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPA 171
           WGLDYPPLTAYHSY+ G +G FF   WF+LE+SRG E   LK++MR T I+SE++ YIPA
Sbjct: 121 WGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPA 180

Query: 172 IIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDD 231
           +IYFT WVGK R QSP+GQYIAAAAILFQP L+L+DHGHFQYN VMLG+TVY +NNLLD 
Sbjct: 181 VIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDG 240

Query: 232 MYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTV 291
            YA  AI FV+S+CFKQM+LYY+PIFFAYLL +S +     N+ R   I+++T ++F   
Sbjct: 241 FYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG-INLPRLFAISVSTALAFIGS 299

Query: 292 FAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSL 351
           F P+Y+FGG K N++QS+HRIFPFARGIFEDKVANFWCV+N+ +KY+  +TQ +LQLYSL
Sbjct: 300 FGPIYIFGGYK-NLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSL 358

Query: 352 ILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTST 411
           + TV+G LP+ +    +PK+HLLPY+LAAC+MSFFLFSFQVHEK            YTS 
Sbjct: 359 LATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKTILLPLLPITLLYTSR 418

Query: 412 DWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTP 471
           DWNVLSLV WINNVALFTLWPLLKKD +VLQYGV F+ SNWLIGNFSF TPRFLPK LTP
Sbjct: 419 DWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTP 478

Query: 472 GPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCT 531
           GP I +++  YRR SLLP ++IW++IIV SYI M  I  L+ +V PP +YPD++VL NC+
Sbjct: 479 GPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCS 538

Query: 532 LGFCCFTSFWLWNYYKLFTLTSKNLQYL 559
           LGF CF +FW+WN YKLF + +  LQ L
Sbjct: 539 LGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/531 (67%), Positives = 427/531 (80%), Gaps = 3/531 (0%)

Query: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90
           E FYASP+Y FL PF+   NQWL  YII + A+I+RCAIGLGPYSG +  P+ GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQR 74

Query: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150
           HWMEITQHLP+S+WY+YDLQYWGLDYPPLTA+HS + GLIG FFNP+WF L+ SRG E  
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFESP 134

Query: 151 E--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208
           +  LKT+MR T I+S+++FY PA+IYFT W+G+ R QSP+GQ IAAAAILFQP LMLIDH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDH 194

Query: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268
           GHFQYNSVMLGLT YAINNLLD+ YA AA+ FV+SICFKQM+LYYAPIFFAYLL RSL  
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254

Query: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328
            +F N++R   IA AT+ +F  + APLY  GGG RNI Q ++RIFPF+RGIFEDKVANFW
Sbjct: 255 PKF-NIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFW 313

Query: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388
           CVTN+ +KYK  +T  +LQLYSL+ TV+GFLPAM+  L  PKKHLLPY L AC+MSFFLF
Sbjct: 314 CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 389 SFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448
           SFQVHEK            Y+STDWNVLSLVSWINNVALFTLWPLLKKDG+ LQY V F+
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL 433

Query: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508
           LSNWLIGNFSF TPRFLPK LTPGP I ++N+ YRRRSLLP N++WK  I+ +YI M   
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY 493

Query: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559
             L+LFV PP +YPD++VLLNC +GF CF+ FW+W+YYK+FT  +K+++ L
Sbjct: 494 HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/546 (65%), Positives = 430/546 (78%), Gaps = 9/546 (1%)

Query: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73
           K+  +N +         E FYASPLY FL PF+   +QWL+ Y+IVLFALII CA+G G 
Sbjct: 6   KEAKRNTVE--------ESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGS 57

Query: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133
           YSG    PMFGDFEAQRHWMEITQHL  SQWY++DL+YWGLDYPPLTAYHSY+ G IG F
Sbjct: 58  YSGQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSF 117

Query: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193
             P WFEL  SRG+E  +LKTFMR T ++SE +FYIPA++YFT W+GK R++SP+GQ+I+
Sbjct: 118 IKPEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFIS 177

Query: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253
           AAAILFQP LMLIDHGHFQYN VMLGLTVYAIN+L ++ YA AAI FV+SICFKQM+LYY
Sbjct: 178 AAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYY 237

Query: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313
           APIFFAYLL +SLF  +F N  R   IA+AT++SF  ++APLY+FGGG  N+IQSVHRIF
Sbjct: 238 APIFFAYLLSKSLFSPRF-NFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIF 296

Query: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373
           PFARGIFEDKVANFWCVTNV  KYK  + Q++LQLYSLI T++GFLPA++ I  +PKKH+
Sbjct: 297 PFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHI 356

Query: 374 LPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPL 433
           + Y+LA C+MSF+LFSFQVHEK            YTS++W+VLS+ +WINNV LFTL+PL
Sbjct: 357 ICYALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPL 416

Query: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493
           LKKDG+ LQY VCF LSNWL+GNFSF TP+FLPK LTPGP + +V+ +YRRRS LP+N+I
Sbjct: 417 LKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVI 476

Query: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553
           WKIIIV SY  M  +  ++  + PP  YPD++VLLNC LGF CFT FWLW+YY LFT+  
Sbjct: 477 WKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPR 536

Query: 554 KNLQYL 559
           K LQ L
Sbjct: 537 KTLQQL 542

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/531 (64%), Positives = 425/531 (80%), Gaps = 2/531 (0%)

Query: 26  ETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGD 85
           ++L  E F+ASPLY FLSPF+   NQ+ + Y+IV+FAL+IRCA+GLG +SG    PM GD
Sbjct: 5   KSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGD 64

Query: 86  FEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSR 145
           FEAQRHWME+T +LP+SQWY++DLQYWGLDYPPLTAYHSY  G +G   NP WF L +SR
Sbjct: 65  FEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSR 124

Query: 146 GMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLML 205
           G E  ELK +MR T I+SE   YIPA++YFT W G +R+QSP+GQYIAAAAILFQP L+L
Sbjct: 125 GNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184

Query: 206 IDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRS 265
           IDHGHFQYNSVMLGLTVYAINNLLD  + PAAI F++S+CFKQM+L+Y+PIFFAYLL RS
Sbjct: 185 IDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRS 244

Query: 266 LFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVA 325
           LF   F   SRF+++A++T+++F  +F+PLYVFGG K N++QS+HRIFPF+RGIFEDKVA
Sbjct: 245 LFSPSF-KFSRFMSVALSTVITFCLMFSPLYVFGGMK-NVLQSIHRIFPFSRGIFEDKVA 302

Query: 326 NFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSF 385
           NFWCV+NVI+KY  N+TQD+LQ  S   T  GFLP+   ++ +PKKH++PY LAAC+M+F
Sbjct: 303 NFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAF 362

Query: 386 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGV 445
           FLF FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD + LQYG+
Sbjct: 363 FLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGI 422

Query: 446 CFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVM 505
             +LSNWLIGNFSF TPRFLP  +TPGP + NV   YRRRS LPNNI+WKI+I+ SYIVM
Sbjct: 423 MMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVM 482

Query: 506 VAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNL 556
             I  L+LFV+PP + PD++VL+NC LGF CF+ FWLWN YKLFT+ +K++
Sbjct: 483 AVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSI 533

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/526 (67%), Positives = 428/526 (81%), Gaps = 2/526 (0%)

Query: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90
           E F+ASPL+ FLSPF+   NQW + YIIVLFALIIRC +GLG +SGMN  PM GDFEAQR
Sbjct: 15  ESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQR 74

Query: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150
           HWME+T +LP+SQWY+YDL YWGLDYPPLTAYHSYI G +G  F+P WF+L  SRG E  
Sbjct: 75  HWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQESM 134

Query: 151 ELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGH 210
           +LK++MR T ++SE++ YIP +IYF  W+GK R Q+P+GQYIAAAAILFQP L+LIDHGH
Sbjct: 135 DLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDHGH 194

Query: 211 FQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQ 270
           FQYNSVMLGLTVYAINNLLD+ YAPAAI FV+S+CFKQM+LYYAPIFF+YLL +SLF   
Sbjct: 195 FQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKSLFSP- 253

Query: 271 FFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFWCV 330
            FN+ R L +A AT++SF  +F PLY++ GG RN++QS+HRIFPF+RGIFEDKVANFWC 
Sbjct: 254 LFNLPRLLAVAAATLISFAAMFFPLYMW-GGIRNVLQSIHRIFPFSRGIFEDKVANFWCF 312

Query: 331 TNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSF 390
           +N+ +KYKV YTQ +LQ+YSL  T +GFLPA + I ++PKKHL+PY+L AC+MSFFLFSF
Sbjct: 313 SNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLFSF 372

Query: 391 QVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFILS 450
           QVHEK            YTSTDWNVLS+VSWINN+A FTLWPLLKKDG+VLQY    +LS
Sbjct: 373 QVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLLLS 432

Query: 451 NWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAIQG 510
           NWLIGNFSF TPRFLPK LTPGP   +V+ +YRRRSLLP+NI WK+IIV SYI M  +  
Sbjct: 433 NWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGILHL 492

Query: 511 LELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNL 556
           L+ +V+PP +YPD++VLLNC+LGF  F  FW+WNYYK+FTL +K L
Sbjct: 493 LDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/529 (65%), Positives = 421/529 (79%), Gaps = 2/529 (0%)

Query: 29  DTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEA 88
             EPF+ASPLY FLSPF+   NQ+ + Y+IV+FAL+IRCA+GLG +SG N  P+ GDFEA
Sbjct: 8   KNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEA 67

Query: 89  QRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGME 148
           QRHWME+T HLP+SQWY+YDLQYWGLDYPPLTAYHSY+ G +G   N  WF L +SRG+E
Sbjct: 68  QRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIE 127

Query: 149 MKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208
             ++K +MR T I+SE   YIPA++YFT W G +R+QSP+GQYIAAAAILFQP L+LIDH
Sbjct: 128 NPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDH 187

Query: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268
           GHFQYNSVMLGLTVY+INNLLD  Y PAAI FV+S+CFKQM+LYY+P+FFAYLL   L  
Sbjct: 188 GHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLIS 247

Query: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328
               NV RFL++A +T++SF  +F+PLYVFGG K N++QS+HRIFPF+RGIFEDKVANFW
Sbjct: 248 PSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTK-NVLQSIHRIFPFSRGIFEDKVANFW 305

Query: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388
           CV+NV+ KY  NYTQ ELQ +S+I T  GFLP+ + +L +PKKH++P++LAAC+M+FFLF
Sbjct: 306 CVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLF 365

Query: 389 SFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448
           SFQVHEK            Y STDWNVLS+VSWINNVALFTLWPLLKKD + LQYG+  +
Sbjct: 366 SFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILML 425

Query: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508
           LSNWLIGNFSF TPRFLPK +TPGP I  V+  YRRRS LP+N  WK+IIV SY++M AI
Sbjct: 426 LSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAI 485

Query: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQ 557
             L+ FV  P   PD++VLLNC LGF CFT FWLW +YKLFT+ + NLQ
Sbjct: 486 HILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQ 534

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/545 (65%), Positives = 433/545 (79%), Gaps = 15/545 (2%)

Query: 29  DTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEA 88
           + E FYASPL+ FL PF+   +QWL+ Y+I++FA+IIRCAI LG YSG    PMFGDFEA
Sbjct: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEA 75

Query: 89  QRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGME 148
           QRHWMEITQHLPIS+WY++DLQYWGLDYPP TAYHSY  G +G FFNP WF L +SRG E
Sbjct: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135

Query: 149 MKE--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLI 206
             +  LKT+MR T I+SE +FYIPA++YFT W+GK R QSP+GQ+IAAAAILFQP LMLI
Sbjct: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195

Query: 207 DHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSL 266
           DHGHFQYNSVMLGLTVYAINNLLD+ Y PAAI FV+S+CFKQM+LYY+PIFF YLL +SL
Sbjct: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255

Query: 267 FKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG------------GKRNIIQSVHRIFP 314
                 N+SRF+ +AI+T+VSF  +F P+Y+FG             G  N+IQ + RIFP
Sbjct: 256 VHPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFP 314

Query: 315 FARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLL 374
           FARGIFEDKVANFWCVTNV++KY+  +TQ++LQ YSL+ T++GFLP+M+TI  +P+K L+
Sbjct: 315 FARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLI 374

Query: 375 PYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLL 434
           PY+LAAC+MSFFLFSFQVHEK            YTSTDWNVLSLV WINNVALFTLWPLL
Sbjct: 375 PYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434

Query: 435 KKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIW 494
           +KDG+VLQY VC+ LSNWLIGNFSF TP+FLP  LTPGP I N++  YRR SLLP+NI+W
Sbjct: 435 RKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILW 494

Query: 495 KIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSK 554
           KIII+ SYIVM A+Q L+LF +PP  YPD++++LNCT+GF CF  FWLWN YK+  + +K
Sbjct: 495 KIIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNK 554

Query: 555 NLQYL 559
            L  L
Sbjct: 555 TLNDL 559

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/558 (61%), Positives = 425/558 (76%), Gaps = 11/558 (1%)

Query: 2   GKSGKHNSKKFVKQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLF 61
           G SG   S+K  + T ++ +         E F+ASPLY FL P +   NQW + YII++F
Sbjct: 3   GSSGAVASEK-GQDTRRSCVE--------ESFFASPLYDFLYPLRPVANQWSAKYIILIF 53

Query: 62  ALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTA 121
           ALI+R A+GLG YSG  + P+FGDFEAQRHWMEIT  LPIS+WYFYDL+YWGLDYPPLTA
Sbjct: 54  ALIVRLAVGLGGYSGKGKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTA 113

Query: 122 YHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGK 181
           YHSYI G +G F N  WF+L TSRG E  +LK+FMR+T ++SE++ YIPA++YFT W+G+
Sbjct: 114 YHSYILGRLGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGR 173

Query: 182 QRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFV 241
            R QSP+GQY+A AAILFQP L+LIDHGHFQYN VMLGL VY INNLLD+ Y  AAI FV
Sbjct: 174 HRNQSPIGQYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFV 233

Query: 242 MSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGG 301
           +S+ FKQM+LYY+P+ FAYL  RS +  +F N  RF  IAIAT+++F  ++APL +FG  
Sbjct: 234 LSLGFKQMALYYSPVIFAYLFSRSAYYPRF-NFPRFAGIAIATLLTFGALYAPLCLFGD- 291

Query: 302 KRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPA 361
            RNIIQSV+R+FPF+RGIFEDKVANFWCVTNVI+KY+  YTQ +LQ Y L+ T +   PA
Sbjct: 292 FRNIIQSVYRVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPA 351

Query: 362 MVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSW 421
            + I  +PKK LLPY+LAAC+M+FFLFSFQVHEK            + ST+W+VLS+V+W
Sbjct: 352 FIIIFLYPKKFLLPYALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAW 411

Query: 422 INNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTH 481
           INNVALFTLWPLLKKDG++LQY + F+LSNWL+GNFSF TP FLPK LTPGP + +V   
Sbjct: 412 INNVALFTLWPLLKKDGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADD 471

Query: 482 YRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFW 541
           YRRRSLLP NI W+IIIV SY+ M  I  L+L+V+PP  YPDI+VL  C LGF CFT+FW
Sbjct: 472 YRRRSLLPKNIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFW 531

Query: 542 LWNYYKLFTLTSKNLQYL 559
           LWNYY+L+ + + +L  L
Sbjct: 532 LWNYYQLYRMRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/529 (62%), Positives = 414/529 (78%), Gaps = 2/529 (0%)

Query: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90
           E F+ASPLY FL P +  TNQW + YIIV+FALIIR A+GLG YSGM + PMFGDFEAQR
Sbjct: 37  EAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQR 96

Query: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150
           HWME+TQH+P+S+WYF+ LQYWGLDYPPLTAYHSY+ G +G + +P WF L  SRG E +
Sbjct: 97  HWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESE 156

Query: 151 ELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGH 210
           +LK++MRLT I+SE+ FYIPA++YFT W+G++R+QSP+GQYIA AAILFQP L+LIDHGH
Sbjct: 157 DLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGH 216

Query: 211 FQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQ 270
           FQYN VMLGLTV AINNLLD  YA AA++FV S+ FKQM+LYYAP+ F YLL RS++  +
Sbjct: 217 FQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPR 276

Query: 271 FFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFWCV 330
             N+ RF+ +A+AT+++F  ++APLY+  G    I QS+HR+FPF RG+FEDKVANFWCV
Sbjct: 277 -LNIPRFVAVAVATLIAFGVLYAPLYLL-GNISAIFQSIHRVFPFERGLFEDKVANFWCV 334

Query: 331 TNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSF 390
           TNV++KYK  YT  +L+ +SL+LT    LP+++    +PKK +LPY+LAAC+MSFFLF F
Sbjct: 335 TNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLFGF 394

Query: 391 QVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFILS 450
           QVHEK            YTSTDWNVLS+V+WINN+ALFTLWPLLKKDG+ LQY + F+LS
Sbjct: 395 QVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLS 454

Query: 451 NWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAIQG 510
           NWLIGNFSF TP FLPK+LTPGP + +V   YRRRSLLP+NIIW+IIIV+SYI + AI  
Sbjct: 455 NWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVGAIHI 514

Query: 511 LELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559
            EL+  P  + PDI+VL NC +G   F  FW+WN YK+F + +  +  L
Sbjct: 515 AELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  122 bits (306), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 98/396 (24%), Positives = 172/396 (43%), Gaps = 49/396 (12%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHS-YICGLIGKFFNPAWFELET 143
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  AY   ++   + KF          
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 144 SRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCL 203
             G        F RLT I+SE++ ++   ++       ++ QS    ++ A++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 204 MLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLG 263
           ++IDH HFQYN  + G+ + +I    +  Y    + + +++CFK + LY AP +F +LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 264 RSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYV------FGGGKRNIIQSVHRIFPFAR 317
             +   Q F    + ++ +            + V      FG   R++ Q + R+FPF+R
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRLFPFSR 278

Query: 318 GIFEDKVA-NFWCVTNVIMKY------KVNYTQ----DELQL------------------ 348
           G+     A NFW + + + K       +V + +    D+++                   
Sbjct: 279 GLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVEDVFFV 338

Query: 349 --------YSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKXXXXX 400
                    + +LT+   + A+V +L+ P       SL  C  + FLF + VHEK     
Sbjct: 339 ILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEKAILLV 398

Query: 401 XXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKK 436
                      D  +LS    + +    +L+PLL K
Sbjct: 399 IIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFK 433

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  122 bits (306), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 103/381 (27%), Positives = 171/381 (44%), Gaps = 87/381 (22%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT +LPIS+WY+ +   W LDYPP  AY  ++       F P   E+  +
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSR----FAP---EIVKN 116

Query: 145 RG-MEMKELK-------TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAA 196
            G +++ E+         F RLT I+SE++ +     Y  T   K+R Q     ++ A++
Sbjct: 117 DGCLDIVEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASS 172

Query: 197 ILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPI 256
           I+  P  ++IDH HFQYN  +  + + +I       Y   A+ + +S+CFK + LY AP 
Sbjct: 173 IVLSPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPC 232

Query: 257 FFAYLLGRSLFKKQFFNVSRFLNI----------AIATMVS--FFTVFAPLYVFGGGKRN 304
           +F +LL   +   + F    ++++           +A +VS  F   FAP ++F      
Sbjct: 233 YFVFLLRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAP-FIF-----Q 286

Query: 305 IIQSVHRIFPFARGIFEDKVA-NFWCVTNVI----------------------------- 334
           + Q + R+FPF+RG+     A NFW + + I                             
Sbjct: 287 LPQVLSRLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPILPK 346

Query: 335 --------MKYKVNYTQDELQLY------------SLILTVVGFLPAMVTILWFPKKHLL 374
                   M    N T+  +Q Y            + +LT+   + A++ +L+ P     
Sbjct: 347 TAAEIRERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYKRF 406

Query: 375 PYSLAACAMSFFLFSFQVHEK 395
             SL  C M+ +LF + VHEK
Sbjct: 407 IGSLTLCGMASYLFGWHVHEK 427

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  119 bits (299), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 136/272 (50%), Gaps = 36/272 (13%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  +        F P    +   
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPK--SVRDD 119

Query: 145 RGMEMKELK-------TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAI 197
             +++ E+         F RLT I SE++ ++   IY  T    +R QS    ++ A++I
Sbjct: 120 GCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSI 175

Query: 198 LFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIF 257
           +  P  ++IDH HFQYN  +  + + +I    +  Y   A+ +  +ICFK + LY AP +
Sbjct: 176 VLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCY 235

Query: 258 F-----AYLLGRSLFK----KQFFNVSRFLN-IAIAT-MVSFFTV-FAPLYVFGGGKRNI 305
           F     AY+L  + FK    K F  + R+ N + +AT +V  FT+ F P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF------AHQM 289

Query: 306 IQSVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  117 bits (292), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 127/266 (47%), Gaps = 24/266 (9%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHS-YICGLIGKFFNPAWFELET 143
           DF+  R+WM IT  LPIS+WYF +   W LDYPP  AY   ++   + K           
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 144 SRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCL 203
             G        F RLT I+SE+  +     Y  T    +R QS    ++ A++I+  P  
Sbjct: 169 EVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPGF 224

Query: 204 MLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLG 263
           +++DH HFQYN+ +  + + +I       Y   A+ + +++CFK + LY AP +F +LL 
Sbjct: 225 LIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLLR 284

Query: 264 RSL----------FKKQFFNVS--RFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHR 311
             +          +K   F V   R L +    +  F   FAP ++F      + Q + R
Sbjct: 285 AYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAP-FIF-----QMPQVLSR 338

Query: 312 IFPFARGIFEDKVA-NFWCVTNVIMK 336
           +FPF+RG+     A NFW + + + K
Sbjct: 339 LFPFSRGLTHAYWAPNFWAIYSFLDK 364

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 128/266 (48%), Gaps = 24/266 (9%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHS-YICGLIGKFFNPAWFELET 143
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY   ++   + K           
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 144 SRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCL 203
             G        F RLT I SE++ Y    IY  T    +R QS    ++ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 204 MLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFF----- 258
           ++IDH HFQYN  +  + + +I    +  Y   A  +  +ICFK + LY AP +F     
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 259 AYLLGRSLFK----KQFFNVSRFLNI--AIATMVSFFTV-FAPLYVFGGGKRNIIQSVHR 311
           AY+L  + FK    K F  + R+ N+    + ++  FT+ F P          + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPF------AHQMPQVLSR 295

Query: 312 IFPFARGIFEDKVA-NFWCVTNVIMK 336
           +FPF+RG+     A NFW + + + K
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDK 321

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 106/409 (25%), Positives = 171/409 (41%), Gaps = 62/409 (15%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSY-ICGLIGKFFNPAWFELET 143
           DF+  R+W+ IT  LP+ QWYF +   W LDYPP  AY  + +  L+             
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 144 SRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCL 203
             G        F RLT I SE++ ++   +Y    + K         ++ A++I+  P  
Sbjct: 104 KVGQFGMPTIVFQRLTVIASEILLFVVLQVY----INKSHISERSANFVVASSIVLSPGF 159

Query: 204 MLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLG 263
           ++IDH HFQYN  +  + + +I    +  Y    + F ++ICFK + LY AP FF +LL 
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLLR 219

Query: 264 RSLFKKQFFNVSRFLN-IAIATMVSFFTVFA-PLYVFGGGKRNII----QSVHRIFPFAR 317
             +     F+   + + I+I    + F + +  L VFG      I    Q + R+FPF+R
Sbjct: 220 VYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPFISQWPQLLSRLFPFSR 279

Query: 318 GIFEDKVA-NFWCVTNVIMK------YKVNYTQDELQLY--------------------- 349
           G+     A NFW + +++ K       KV Y    L  +                     
Sbjct: 280 GLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEIKQKLLQYN 339

Query: 350 ----------------------SLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFL 387
                                 + ILT+   + A++ +L+ P       SL  C  + FL
Sbjct: 340 VGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLTLCGFASFL 399

Query: 388 FSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKK 436
           F + VHEK             TS D  +L+  + + +    +L+PLL +
Sbjct: 400 FGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHE 447

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  114 bits (286), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 130/266 (48%), Gaps = 24/266 (9%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT  LP+ QWY+     W LDYPP  AY  +        F P++  +++ 
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPSY--VKSD 89

Query: 145 RGMEMKELK-------TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAI 197
             +++ E+         F RLT I SE++ ++   +Y  T    +R QS    ++ A++I
Sbjct: 90  GCLDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSI 145

Query: 198 LFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIF 257
              P  ++IDH HFQYN  +  + + +I    +  Y      + +++CFK + LY AP +
Sbjct: 146 AISPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCY 205

Query: 258 FAYLLGRSLFKKQFFNVSRFLNIAIAT----MVSFFTVFAPLY--VFGGGKRNIIQSVHR 311
           F +LL   +   + F    + ++        +V   +V    +   FG    ++ Q + R
Sbjct: 206 FVFLLRAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPFIFDLPQLLTR 265

Query: 312 IFPFARGIFEDKVA-NFWCVTNVIMK 336
           +FPF+RG+     A NFW + + I K
Sbjct: 266 LFPFSRGLTHAYWAPNFWAIYSTIDK 291

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 133/272 (48%), Gaps = 36/272 (13%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  AY  +        F P    +   
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPK--VVRDD 119

Query: 145 RGMEMKELK-------TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAI 197
             +++ E+         F RLT I SE++ +    IY  T    +R QS    ++ A++I
Sbjct: 120 GCLDIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSI 175

Query: 198 LFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIF 257
           +  P  ++IDH HFQYN  +  + + +I    +  Y   A+ +  SICFK + LY AP +
Sbjct: 176 VLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCY 235

Query: 258 F-----AYLLGRSLFK----KQFFNVSRFLNI--AIATMVSFFTV-FAPLYVFGGGKRNI 305
           F     AY+L  + FK    K F  + R+ N+    + ++  FT+ F P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPF------AHQM 289

Query: 306 IQSVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 112/417 (26%), Positives = 179/417 (42%), Gaps = 78/417 (18%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELE-- 142
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++       F P   + +  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQ----FVPQRVQDDGC 99

Query: 143 ---TSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILF 199
               + G        F R+T IVSE++ ++   +Y    + K         ++ A++I+ 
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVY----INKSHISDRSANFVVASSIVL 155

Query: 200 QPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFA 259
            P  ++IDH HFQYN  +  + + +I       Y      F  ++CFK + LY AP FFA
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 260 -----YLLGRSLFKKQFFN----VSRFLNI-AIATMVSFFTVFAPLYVFGGGKRNIIQSV 309
                Y+L  S F+ + +N    + R+ N+  + T+V   +VFA    F      + Q +
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVV--LSVFA--VCFAPFIYQLPQLM 271

Query: 310 HRIFPFARGIFEDKVA-NFWCVTNVIMK------YKVNY----------------TQDE- 345
            R+FPF+RG+     A NFW + + + K       KV Y                T DE 
Sbjct: 272 SRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDEI 331

Query: 346 ---LQLYSL-----------------------ILTVVGFLPAMVTILWFPKKHLLPYSLA 379
              LQ Y++                       ILT+   + A++ +L+ P       SL 
Sbjct: 332 KTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSLT 391

Query: 380 ACAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKK 436
            C  + FLF + VHEK             T TD  +L+    + +    +L+PLL +
Sbjct: 392 LCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  113 bits (283), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 132/272 (48%), Gaps = 36/272 (13%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  +        F P    +   
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPK--VVRDD 119

Query: 145 RGMEMKELK-------TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAI 197
             +++ E+         F RLT I S+++ ++   +Y  T    +R QS    ++ A++I
Sbjct: 120 GCLDIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSI 175

Query: 198 LFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIF 257
           +  P   +IDH HFQYN  +  + + +I       Y   AI +  +ICFK + LY AP +
Sbjct: 176 VLSPGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCY 235

Query: 258 F-----AYLLGRSLFK----KQFFNVSRFLNI--AIATMVSFFTV-FAPLYVFGGGKRNI 305
           F     AY+L  + FK    K F  + R+ N+    + ++  FT+ F P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPF------AHQM 289

Query: 306 IQSVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 125/270 (46%), Gaps = 32/270 (11%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLI--GKFFNPAWFELE 142
           DFE  R+W+ +T  LP+ +WY      W +DYPPL A+  +    +  G        +L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKL- 117

Query: 143 TSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPC 202
            + G        F RLT I SEV+ Y+   +Y ++   ++R  +    ++   ++   P 
Sbjct: 118 VAEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPA 173

Query: 203 LMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLL 262
            +L+DH HFQYN  +  + V +I    +  Y      F +++C K + LY AP +F +LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 263 G-----------RS----LFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQ 307
                       RS    +F  ++ N+ R   + +A M   F  FA +         + Q
Sbjct: 234 RAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGV---------MPQ 284

Query: 308 SVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            + R+FPF+RG+     A NFW + + + K
Sbjct: 285 LMARLFPFSRGLTHAYWAPNFWAIYSFVDK 314

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 126/263 (47%), Gaps = 18/263 (6%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICG--LIGKFFNPAWFELE 142
           DF+  R+W+ IT +LP+ QWY+     W LDYPP  AY  +     + G        E+ 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEI- 103

Query: 143 TSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPC 202
             +G        F R T I+SE++ ++   ++  T    +R QS    ++ A++I+  P 
Sbjct: 104 VDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 203 LMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLL 262
            +++DH HFQYN  +  + + +I       Y   A  + +++CFK + LY AP +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 263 GRSLFKKQFFNVSRFLN-IAIATMVSFFT-------VFAPLYVFGGGKRNIIQSVHRIFP 314
                  Q F    + + I I      F        VFA    FG   +++ Q + R+FP
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFA--LCFGPFVKDLPQVLTRLFP 277

Query: 315 FARGIFEDKVA-NFWCVTNVIMK 336
           F+RG+     A NFW + + + K
Sbjct: 278 FSRGLTHAYWAPNFWALYSFLDK 300

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 125/270 (46%), Gaps = 32/270 (11%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELE-- 142
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++       F PA    +  
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQ----FVPAAVRADGC 108

Query: 143 ---TSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILF 199
                +G+       F R T I SEV+ ++   +Y  T    ++ QS    ++ A++I+ 
Sbjct: 109 LDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVL 164

Query: 200 QPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFA 259
            P L+++DH HFQYN  +  + + +I       +   A  +  ++CFK + LY AP +F 
Sbjct: 165 SPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFM 224

Query: 260 YLLGRSLFK---------KQFFNV---SRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQ 307
           +LL   + +         K  F +    R   +    +      FAP        R++ Q
Sbjct: 225 FLLRTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF------ARDMPQ 278

Query: 308 SVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            + R+FPF+RG+     A NFW + ++  K
Sbjct: 279 LLSRLFPFSRGLTHAYWAPNFWALYSLCDK 308

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  111 bits (277), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 96/373 (25%), Positives = 161/373 (43%), Gaps = 71/373 (19%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ +T  LP+ QWY+     W LDYPP  AY  +I   I +F      +    
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWI---ISQFVPQVVRDDGCL 112

Query: 145 RGMEMKELKT----FMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQ 200
             +E+ +       F RL+ I SE++ ++    +  T   K+R QS    +I A +I+  
Sbjct: 113 DIVEIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILS 168

Query: 201 PCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAY 260
           P  +++DH HFQYN  +  + + +I       Y   A+ +  ++CFK + LY AP +F +
Sbjct: 169 PGFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVF 228

Query: 261 LLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYV--------FGGGKRNIIQSVHRI 312
           LL   +   + F    + +  +  +V +  +F    V        FG    ++ Q + R+
Sbjct: 229 LLRAYVLNVKGFQFKSYKD--LVRLVQWTNLFRLAGVVLSIVGVCFGPFIFDMPQLLTRL 286

Query: 313 FPFARGIFEDKVA-NFWCV--------TNVIMKYKVNYTQ--------------DELQ-- 347
           FPF+RG+     A NFW +        T +++K    +T                E+Q  
Sbjct: 287 FPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATIKEIQKR 346

Query: 348 -------------------------LYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACA 382
                                      + ILT+   L A++ +L+ P       SL  C 
Sbjct: 347 LSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRFIGSLTLCG 406

Query: 383 MSFFLFSFQVHEK 395
           M+ +LF + VHEK
Sbjct: 407 MASYLFGWHVHEK 419

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 128/270 (47%), Gaps = 32/270 (11%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  +   L+ +F      E    
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEW---LLSQFVPKIVKEDGAL 111

Query: 145 RGMEMKELK----TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQ 200
             +E+ +       F RLT I SEV+ ++   ++  T    ++ +S    ++ A++I+  
Sbjct: 112 DIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLS 167

Query: 201 PCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAY 260
           P  ++IDH HFQYN  +    + +I       Y   A  + +++CFK + LY AP +F +
Sbjct: 168 PGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVF 227

Query: 261 LLGRSLFKKQFFNVSRFLNI------------AIATMVSFFTVFAP-LYVFGGGKRNIIQ 307
           LL   +   + F    + ++            A   +  FF  F P LY       ++ Q
Sbjct: 228 LLRAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLY-------DLPQ 280

Query: 308 SVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            + R+FPF+RG+     A NFW + + + K
Sbjct: 281 VMTRLFPFSRGLTHAYWAPNFWAIYSFLDK 310

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 101/418 (24%), Positives = 171/418 (40%), Gaps = 75/418 (17%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHS-YICGLIGKFFNPAWFELET 143
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY   ++   + K           
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 144 SRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCL 203
             G        F R + I+SE++ ++    +       +R QS    +I A +I+  P  
Sbjct: 114 PVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILSPGF 169

Query: 204 MLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLG 263
           ++IDH HFQYN  +  + + +I     + Y    + + +++CFK + LY AP +F +LL 
Sbjct: 170 LIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 229

Query: 264 RSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNII------------QSVHR 311
             +   + F    + ++ +         +  L+  GG   +I             Q   R
Sbjct: 230 AYVLNVKNFKFKSYKDLILLIQ------WNNLFKLGGIVLSIFGICFLPFIYHLPQVFTR 283

Query: 312 IFPFARGI--------------FEDKVA-----------NFWC--------------VTN 332
           +FPF RG+              F DK+A              C              + +
Sbjct: 284 LFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEIQS 343

Query: 333 VIMKYKVNYTQDELQ-LYSLIL---------TVVGF--LPAMVTILWFPKKHLLPYSLAA 380
            IM+Y  N ++  ++ +Y +IL          + GF  L A+V +L+ P       SL  
Sbjct: 344 RIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFIGSLTL 403

Query: 381 CAMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSLVSWINNVALFTLWPLLKKDG 438
           C M+ FLF + VHEK                D  +L+    +++    +L+PLL K+ 
Sbjct: 404 CGMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLYKND 460

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 97/375 (25%), Positives = 157/375 (41%), Gaps = 77/375 (20%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           DF+  R+W+ IT  LP+++WY      W LDYPP  AY  +    + +F   +  E    
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEW---FLSQFVPKSVAEDGCL 108

Query: 145 RGMEMKELK----TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQ 200
             +++         F R+T I+SE++ Y    ++  T    ++       ++ A++I+  
Sbjct: 109 DIVKVGSFGLPTIIFQRITVILSELVLYAALQVFINTSDISEKS----ANFVVASSIVLS 164

Query: 201 PCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFF-- 258
           P L+++DH HFQYN  + G+ + +I    +  Y   A  F +++CFK + LY AP +F  
Sbjct: 165 PGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVF 224

Query: 259 ---AYLLGRSLFK----KQFFNV---SRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQS 308
              AY+L  S FK    K   ++   S  L +A   M  F   F P            Q 
Sbjct: 225 LLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPFIT------TWQQL 278

Query: 309 VHRIFPFARGIFEDKVA-NFWCVTN------VIMKYKVNYTQDELQL------------- 348
           + R+FPF+RG+     A N W V +       ++  K+ Y Q  L +             
Sbjct: 279 LARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMPKTAADIH 338

Query: 349 ----------------------------YSLILTVVGFLPAMVTILWFPKKHLLPYSLAA 380
                                        + +LT+   + A+V +L+ P       SL  
Sbjct: 339 VRIESNNSGTRGLVQDVFFVVLPQITPKLTFLLTLFYQILAVVPVLFDPSFKRFVGSLTL 398

Query: 381 CAMSFFLFSFQVHEK 395
           C    FLF + VHEK
Sbjct: 399 CGFVSFLFGWHVHEK 413

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 125/267 (46%), Gaps = 26/267 (9%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHS-YICGLIGKFF-NPAWFELE 142
           DF+  R+W+ IT  LP+ +WY      W LDYPP  AY   ++   + K   +    ++ 
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 143 TSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPC 202
                 M  +  F R+T IVSEV+ ++   I+    + K         +I A++I+  P 
Sbjct: 108 EVGNFGMPTI-IFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLSPG 162

Query: 203 LMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFF---- 258
            +++DH HFQYN  +  + + AI       Y      F  ++CFK + LY AP FF    
Sbjct: 163 FLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLL 222

Query: 259 -AYLLGRSLFK----KQFFNV---SRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVH 310
            AY+L  + FK    K   ++    R L + +  +  F   FAP          + Q + 
Sbjct: 223 RAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPFI------SEMPQLLE 276

Query: 311 RIFPFARGIFEDKVA-NFWCVTNVIMK 336
           R+FPF+RG+     A NFW + +++ K
Sbjct: 277 RLFPFSRGLTHAYWAPNFWALYSLLDK 303

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 130/270 (48%), Gaps = 32/270 (11%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHS-YICGLIGKFFNPAWFELET 143
           DF+  R+W+ IT  + +  WY+     W LDYPP  AY   +I  L+  F       +  
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSF-------VRR 116

Query: 144 SRGMEMKELKTF-------MRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAA 196
              +++ E+  F        RLT I SE + ++   IY  T   ++R QS    +I A++
Sbjct: 117 DGCLDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASS 172

Query: 197 ILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPI 256
           I+  P  +++DH HFQYN  +  + V +I    +  Y   A+ + +++CFK + LY AP 
Sbjct: 173 IVLSPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPC 232

Query: 257 FFAYLLGRSLFK---------KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQ 307
           +F +LL   +           K    + R+ N+    M+    VF+    FG    ++ Q
Sbjct: 233 YFVFLLRVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIV-VGVFS--LCFGPFIFDMPQ 289

Query: 308 SVHRIFPFARGIFEDKVA-NFWCVTNVIMK 336
            + R+FPF+RG+     A NFW + + + K
Sbjct: 290 LLSRLFPFSRGLTHAYWAPNFWALYSFLDK 319

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 123/268 (45%), Gaps = 40/268 (14%)

Query: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144
           D E  R+W+ +T  LP+  WY      W LDYPP  AY  ++       F PA    +  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQ----FVPAVVRDDGC 148

Query: 145 RGMEMKELK------TFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAIL 198
             + +KE K       F+RLT I +E++ ++   ++  T    +R  +    +I A++I 
Sbjct: 149 LDI-VKEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIA 203

Query: 199 FQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFF 258
             P  +++DH HFQYN  +  + + +I     + Y      F   +CFK + LY AP +F
Sbjct: 204 LSPGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYF 263

Query: 259 AYLLG--------------RSL-FKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKR 303
            +LL               R L F  ++FN+ +   I ++ +   F  F P+        
Sbjct: 264 TFLLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV-------- 315

Query: 304 NIIQSVHRIFPFARGIFEDKVA-NFWCV 330
            + Q + R+FPF+RG+     A NFW V
Sbjct: 316 -LPQLISRLFPFSRGLTHAYWAPNFWAV 342

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 16/21 (76%)

Query: 15  QTHKNDISSLDETLDTEPFYA 35
           +THKND   + + L+T+P+YA
Sbjct: 397 ETHKNDAKKVKDILETDPYYA 417

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,831,063
Number of extensions: 2516195
Number of successful extensions: 7230
Number of sequences better than 10.0: 53
Number of HSP's gapped: 7271
Number of HSP's successfully gapped: 62
Length of query: 559
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 444
Effective length of database: 40,294,809
Effective search space: 17890895196
Effective search space used: 17890895196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)