Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003406.21ON33833813850.0
Kpol_1037.266.21ON3423469561e-128
SAKL0E01210g6.21ON3233368461e-112
Kwal_56.224336.21ON3223377721e-101
Skud_15.1686.21ON3483467652e-99
KAFR0L004106.21ON3313387614e-99
Smik_15.1766.21ON3453467563e-98
TDEL0G044806.21ON3433467538e-98
ZYRO0C07788g6.21ON3343297422e-96
TBLA0G010506.21ON3503407363e-95
KNAG0M011706.21ON3393497353e-95
CAGL0E02739g6.21ON3433297146e-92
KLTH0C11220g6.21ON3273347101e-91
Ecym_30256.21ON3183347013e-90
NCAS0H008306.21ON3383436963e-89
NDAI0D008106.21ON3493416747e-86
YOR007C (SGT2)6.21ON3462356693e-85
Suva_15.1826.21ON3462346617e-84
KLLA0D01155g6.21ON3353476441e-81
ACR005W6.21ON3273355892e-73
Kpol_1032.86.21ON3432264939e-59
NCAS0D026706.21ON3512243674e-40
NDAI0I022406.21ON3502133291e-34
TPHA0M002706.21ON3772803133e-32
TBLA0A072706.21ON3732563039e-31
CAGL0H08195g5.617ON5831022128e-18
NDAI0F009105.617ON5831031959e-16
TPHA0D028805.617ON5851021959e-16
YOR027W (STI1)5.617ON5891021932e-15
Kwal_55.199355.617ON5931021914e-15
Skud_15.1925.617ON5891241904e-15
KLTH0E02178g5.617ON5931011896e-15
Smik_15.2055.617ON5891011887e-15
NCAS0G008105.617ON5841041889e-15
Suva_8.805.617ON5861021861e-14
Kpol_1018.695.617ON5901021782e-13
TBLA0E033005.617ON5821021772e-13
AEL224W5.617ON5801241762e-13
SAKL0G07084g5.617ON5851241692e-12
ZYRO0A05676g5.617ON5721021683e-12
KLLA0A07062g5.617ON5811031683e-12
TDEL0A048405.617ON5761011673e-12
KNAG0B032005.617ON5791031665e-12
KAFR0C058905.617ON5751051656e-12
Ecym_55825.617ON5841021586e-11
NCAS0A00490singletonON620911231e-06
KAFR0B066103.481ON5111211176e-06
NCAS0F034903.481ON5121121141e-05
Kwal_27.118908.506ON3341501113e-05
Kwal_33.147672.152ON5941241052e-04
TBLA0C039503.481ON5121221052e-04
Ecym_44133.481ON510721033e-04
TDEL0D055003.481ON512831033e-04
KLTH0B05170g2.152ON593971015e-04
NDAI0B057903.481ON5231111016e-04
NCAS0B070102.152ON625107990.001
Skud_7.4323.481ON51380970.002
NDAI0F028102.152ON609100970.002
TPHA0D032203.481ON51384960.002
AGL268C8.506ON379104950.003
KNAG0A079003.481ON51275950.003
YGR123C (PPT1)3.481ON51377950.003
SAKL0H10934g8.506ON380104940.003
KAFR0E029808.506ON380164940.003
AAR083C3.481ON53886950.003
CAGL0D05060g3.481ON51072940.004
Smik_6.2153.481ON51368930.005
Suva_7.4083.481ON51380930.005
KNAG0A039508.506ON386104920.005
KLLA0F24046g2.152ON604132930.005
NCAS0B024008.506ON380101910.008
Kpol_1006.43.367ON732118900.015
CAGL0H07425g8.506ON380140890.015
Kpol_505.413.481ON51383890.017
SAKL0F03102g3.481ON513136880.019
AGL294W7.412ON656160880.024
Ecym_82042.152ON597100870.027
KLLA0B09966g8.506ON370142860.031
NDAI0C052908.506ON379102860.034
Kpol_1018.1067.412ON75391860.038
Ecym_71427.412ON675157850.051
SAKL0E10956g2.152ON600100840.059
NCAS0G024802.152ON596104840.072
KLLA0B09262g3.367ON94188840.076
CAGL0L12936g2.152ON600110830.078
ABR131W2.152ON59496830.089
TPHA0L014208.506ON374141810.13
Suva_15.3142.152ON644106810.16
Kpol_1043.605.689ON70687810.17
YNL121C (TOM70)2.152ON617109800.18
Ecym_25598.506ON370101800.19
Skud_8.1782.152ON638106800.19
YHR117W (TOM71)2.152ON639106800.20
NCAS0A112003.367ON907103790.25
Smik_2.2543.367ON102080790.26
Smik_4.4918.470ON61248790.26
Suva_2.4108.470ON61148790.27
Skud_4.5068.470ON61148790.27
Kpol_172.23.367ON41888780.32
KAFR0H008703.367ON88763790.32
TDEL0B051402.152ON59985780.33
Smik_2.2958.506ON385104780.34
ZYRO0G06512g2.152ON60488780.34
YBR112C (CYC8)3.367ON96680780.34
NCAS0E024907.412ON80997780.35
KLTH0F14542g3.481ON51395780.36
Skud_2.2403.367ON98480780.36
ADL344W3.367ON91093780.38
TPHA0M016303.367ON104355780.38
KLTH0E11748g8.506ON378150770.41
Kwal_55.211753.481ON51195770.42
TBLA0F012303.367ON118956780.42
CAGL0D01364g3.367ON114873780.43
Smik_8.1952.152ON635106770.45
Suva_4.3613.367ON96354770.45
NDAI0A051003.367ON100763770.45
YDR244W (PEX5)8.470ON61248770.46
YBR155W (CNS1)8.506ON385104760.47
CAGL0L04048g2.152ON58794770.48
KNAG0H006103.367ON97363770.50
Skud_14.2112.152ON617109770.51
TDEL0F032603.443ON248488770.54
Smik_14.2072.152ON617109760.61
KAFR0F007202.152ON60882760.68
SAKL0B07986g3.367ON88088760.73
Suva_14.2192.152ON617113750.73
Kwal_23.36703.367ON80248760.74
ZYRO0C16522g3.367ON97455760.76
Kpol_513.28.506ON374104750.76
TDEL0C050903.367ON75948750.83
KAFR0B002507.546ON142050750.89
KLTH0F10428g3.367ON79588750.89
Kwal_23.54087.546ON141051750.91
Suva_4.4058.506ON385101740.97
TBLA0H015203.367ON689131741.00
TDEL0B013108.506ON380101741.1
Smik_1.607.108ON21538721.1
TBLA0C055302.152ON610114741.1
KLLA0B10912g3.481ON51299731.4
Skud_2.2828.506ON385104721.5
CAGL0K11209g8.470ON59049731.5
Ecym_20906.328ON17288701.5
SAKL0D11110g1.456ON432154721.7
Suva_2.347.412ON76391721.9
Smik_2.367.412ON75191722.0
KLTH0H14872g5.352ON623155722.0
YBL084C (CDC27)7.412ON75891722.0
NCAS0B025608.470ON57848712.5
KLTH0F19140g3.32ON92483712.7
TDEL0E054906.240ON44059703.0
NDAI0J001307.546ON140342703.2
Ecym_40315.689ON68885703.3
Ecym_34593.367ON111588703.4
ADR230W5.689ON68583703.5
KLLA0E20857g7.412ON71087703.7
KNAG0F040107.546ON141847703.9
NDAI0B043402.152ON66489694.3
NDAI0C051308.470ON59049685.1
Kpol_1031.648.470ON60749676.7
Kwal_27.117378.470ON57548676.8
TPHA0I015102.152ON60385676.8
Kpol_1048.212.152ON59781677.0
KLTH0E10934g8.470ON56848669.1
KAFR0J025706.328ON12129639.6
NDAI0E040407.412ON783125669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00340
         (338 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   538   0.0  
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   372   e-128
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   330   e-112
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   301   e-101
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   299   2e-99
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   297   4e-99
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   295   3e-98
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   294   8e-98
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   290   2e-96
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   288   3e-95
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   287   3e-95
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   279   6e-92
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   278   1e-91
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   274   3e-90
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   272   3e-89
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   264   7e-86
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   262   3e-85
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   259   7e-84
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   252   1e-81
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   231   2e-73
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   194   9e-59
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   145   4e-40
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   131   1e-34
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   125   3e-32
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   121   9e-31
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    86   8e-18
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     80   9e-16
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    80   9e-16
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    79   2e-15
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    78   4e-15
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    78   4e-15
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    77   6e-15
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    77   7e-15
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    77   9e-15
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    76   1e-14
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    73   2e-13
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    73   2e-13
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    72   2e-13
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    70   2e-12
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    69   3e-12
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    69   3e-12
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    69   3e-12
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    69   5e-12
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    68   6e-12
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    65   6e-11
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       52   1e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    50   6e-06
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    49   1e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    47   3e-05
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    45   2e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    45   2e-04
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    44   3e-04
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    44   3e-04
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    44   5e-04
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    44   6e-04
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    43   0.001
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    42   0.002
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    42   0.002
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    42   0.002
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    41   0.003
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    41   0.003
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    41   0.003
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    41   0.003
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    41   0.003
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    41   0.003
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    41   0.004
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.005
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    40   0.005
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    40   0.005
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    40   0.005
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    40   0.008
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    39   0.015
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    39   0.015
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    39   0.017
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    39   0.019
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    39   0.024
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    38   0.027
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    38   0.031
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    38   0.034
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    38   0.038
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    37   0.051
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    37   0.059
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    37   0.072
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.076
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    37   0.078
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    37   0.089
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    36   0.13 
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    36   0.16 
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    36   0.17 
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    35   0.18 
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    35   0.19 
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    35   0.19 
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    35   0.20 
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    35   0.25 
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    35   0.26 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    35   0.26 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.27 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.27 
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    35   0.32 
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    35   0.32 
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    35   0.33 
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.34 
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    35   0.34 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    35   0.34 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    35   0.35 
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    35   0.36 
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    35   0.36 
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    35   0.38 
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    35   0.38 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    34   0.41 
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    34   0.42 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    35   0.42 
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    35   0.43 
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    34   0.45 
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    34   0.45 
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    34   0.45 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    34   0.46 
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    34   0.47 
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    34   0.48 
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    34   0.50 
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    34   0.51 
TDEL0F03260 Chr6 (599690..607144) [7455 bp, 2484 aa] {ON} Anc_3....    34   0.54 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    34   0.61 
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    34   0.68 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    34   0.73 
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    33   0.73 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    34   0.74 
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    34   0.76 
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    33   0.76 
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    33   0.83 
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    33   0.89 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    33   0.89 
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    33   0.91 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    33   0.97 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    33   1.00 
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    33   1.1  
Smik_1.60 Chr1 complement(120699..121346) [648 bp, 215 aa] {ON} ...    32   1.1  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    33   1.1  
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    33   1.4  
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    32   1.5  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    33   1.5  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    32   1.5  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    32   1.7  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    32   1.9  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    32   2.0  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    32   2.0  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    32   2.0  
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    32   2.5  
KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} simi...    32   2.7  
TDEL0E05490 Chr5 (1005955..1007277) [1323 bp, 440 aa] {ON} Anc_6...    32   3.0  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   3.2  
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    32   3.3  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    32   3.4  
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    32   3.5  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   3.7  
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    32   3.9  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    31   4.3  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    31   5.1  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    30   6.7  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    30   6.8  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    30   6.8  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    30   7.0  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    30   9.1  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    29   9.6  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    30   9.8  

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/338 (82%), Positives = 279/338 (82%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GNGLTSFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAI 120
           GNGLTSFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAI
Sbjct: 61  GNGLTSFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAI 120

Query: 121 EVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
           EVLPT            SSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA
Sbjct: 121 EVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180

Query: 181 LDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXXXXXXXX 240
           LDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNAD         
Sbjct: 181 LDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGTGAAGMG 240

Query: 241 XXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNPAVRQMAE 300
               FPDLSSM             K                     ESMMQNPAVRQMAE
Sbjct: 241 GMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPAVRQMAE 300

Query: 301 NFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK 338
           NFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK
Sbjct: 301 NFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK 338

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  372 bits (956), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 204/346 (58%), Positives = 235/346 (67%), Gaps = 15/346 (4%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNK+IAALI+D+L+ VVDK EVS DNADSLNVAMDCIAEAFEFERDSV   VKS+F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GNGLTSFLSGSATND---------IQVNIADDAADEEQKATAEGLKLEGNKAMATKDYES 111
           GN L+S+L+GS +           ++VN+ +D  D E    AE LKLEGNKAMA KDYE 
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTED--DTEASEAAEALKLEGNKAMAGKDYEL 118

Query: 112 AIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAK 171
           AIKKY+EAI  LPT            SSLKKYD+AV DA SAIK+NPTYSKGYSRLGFAK
Sbjct: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178

Query: 172 FAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNAD 231
           FAQGK EDAL+AYKKVLDIEGDKAT++MKRDYETAKKKVEQSLNLEK T     T + +D
Sbjct: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNAT-AESD 237

Query: 232 XXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQ 291
                         PD SSM             +                     ESMMQ
Sbjct: 238 SASAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQ---LMQAAQQMMQDPEAMKQVESMMQ 294

Query: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAP 337
           NP+V+QMA+ F+SG GTPD SA+MN+P ++DMAKNMFGNGGF GAP
Sbjct: 295 NPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAP 340

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  330 bits (846), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 226/336 (67%), Gaps = 22/336 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           MA SNKEIAALIVD+L++ V+K  VS D ADSLNVA+DCI+EAFEFERD+V + VK++F+
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GNGLTSFLSGSAT------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114
              L   L  +AT        ++VNI   A D   KA AE LKL+GNKAMA+KD+E+AIK
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIP--AEDANTKAKAEDLKLQGNKAMASKDFETAIK 118

Query: 115 KYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174
           KY+EAIEVLP+            SSLKKY+++V DAESAIKVNP+YSKGYSRLGFAK+A 
Sbjct: 119 KYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178

Query: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA-ETESNADXX 233
           GK E+AL+AYK VLDIEGDKATD+MKRDYETAK+KVEQSLNLEK  P +  E ES+ D  
Sbjct: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD-- 236

Query: 234 XXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNP 293
                      FPD++S                                    + MM+NP
Sbjct: 237 ----AGAGASGFPDMAS-------LLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNP 285

Query: 294 AVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329
           AVRQMAENF+SG GTP+L  +M+NP +KDMAKN+FG
Sbjct: 286 AVRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  301 bits (772), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 207/337 (61%), Gaps = 23/337 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNK++A LIVD+L++ V+ KEVS D  DSLNVA+DCI EAFEF+R+SV  T++  F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GNGLTSFL------SGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114
           G  L   +      S S    ++VNI  +  D E KA AE LKLEGNKAMA KD+E A+ 
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVE--DAETKAKAESLKLEGNKAMAAKDFEQAVL 118

Query: 115 KYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174
           KYSEAI+VLPT            SSLKKY++AV DAE AIKVNP+YSKGYSRLGFA++A 
Sbjct: 119 KYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178

Query: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXX 234
           GK E+ALDAYKKVLDIEG+ ATD MKRDY+TA KKV QSLN+EK  P        A    
Sbjct: 179 GKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAP--------AATRD 230

Query: 235 XXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNPA 294
                      PD+SSM                                   + +M NPA
Sbjct: 231 GAGSATGSGGLPDISSM-------LGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPA 283

Query: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNG 331
           V+QMAE F SG GTP ++ +MNNP L DMAKNMFG G
Sbjct: 284 VKQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  299 bits (765), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 168/346 (48%), Positives = 217/346 (62%), Gaps = 22/346 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVK-SAF 59
           M+AS  EIA+LIV+Y +++V+KKE+S D+ADSLNVAMDCI+EAF FER++V   ++ S F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  NGNGLTSFLSGSA----------TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109
            G  LT  L+ ++            +++VNI ++  D E KA AE LK++GNKAMA KDY
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEE--DAEIKAKAEDLKMQGNKAMANKDY 118

Query: 110 ESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169
           E AI KY+EAI+VLPT            SSLK YD+AV DAESAI ++PTY +GYSRLGF
Sbjct: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGF 178

Query: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA-ETES 228
           AK+AQGK E+AL+AYKKVLDIEGD AT+ MKRDYE+AKKKVEQSLNLEK  P+++ + ++
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADA 238

Query: 229 NADXXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXES 288
           NAD                                                       + 
Sbjct: 239 NADASQGAGTSG--------LPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQK 290

Query: 289 MMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334
           MMQ+P ++QMAE F SG G P+LS +MNNP L+ MA N+FG  G P
Sbjct: 291 MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAP 336

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  297 bits (761), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 210/338 (62%), Gaps = 22/338 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M  SNKEI+ LIVDYL  V +K +VS D  DSLNVA+DCI ++FEFERDS    +KS F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GNGLTSFLS----GSATNDIQVNIADDAA--DEEQKATAEGLKLEGNKAMATKDYESAIK 114
              L   L      SA  ++ VN+  D    DEE K  AE LKLEGNKAMA KD++ AI 
Sbjct: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120

Query: 115 KYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174
           KYSEAI + P             SSLK ++ A  DAESAI+V+P YSKGYSRLGFAK+A 
Sbjct: 121 KYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180

Query: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEK--VTPK-EAETESNAD 231
            K E+AL+AYKKVLD+EGDKAT+IMKRDYETAKK+VEQSLNLEK   TPK E+ TES A+
Sbjct: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240

Query: 232 XXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQ 291
                        FPD+SSM                                   +SMMQ
Sbjct: 241 --------AAAGGFPDMSSM----LGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQ 288

Query: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329
           NP++RQMAENF +G  TPD S +MN+P++KDMAKN FG
Sbjct: 289 NPSIRQMAENFQNG-NTPDFSQLMNDPNIKDMAKNFFG 325

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  295 bits (756), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 166/346 (47%), Positives = 216/346 (62%), Gaps = 24/346 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-KSAF 59
           M AS +EIAALIV+Y +++V+KKE+S D ADSLNVAMDCI+EAF FERD+    + KS F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  NGNGLTSFLSGSA----------TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109
            G  L   L+ ++            +++VNI ++  D E KA AE LK++GNKAMA KDY
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEE--DAETKAKAEDLKMQGNKAMANKDY 118

Query: 110 ESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169
           E AI KY+EAI+VLPT            SSL++YD+AV DAES+I ++P+Y +GYSRLGF
Sbjct: 119 ELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGF 178

Query: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA-ETES 228
           AK+AQGK E+AL+AYKKVLDIEGD AT+ MKRDYE+AKKKVEQSLNLEK  P+++ + ++
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADA 238

Query: 229 NADXXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXES 288
           NA                                  K                     + 
Sbjct: 239 NASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQK----------MMSNPGAMQNIQK 288

Query: 289 MMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334
           MMQ+P++RQMAE F SG G P+LS +MNNP L++MA N+FG    P
Sbjct: 289 MMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAP 334

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  294 bits (753), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 175/346 (50%), Positives = 212/346 (61%), Gaps = 27/346 (7%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNKE+A+LIVDYL+ +V+KK VS +  DSLNVA+DCI E+FE +    K   K+ F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQ----KGDSKAVFG 56

Query: 61  GNGLTSFL---SGSATN-------DIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYE 110
           G GL   L   SGS++         I+VNI   A D E KA AE LKLEGNKAMA KD++
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIP--AEDAETKAKAETLKLEGNKAMACKDFD 114

Query: 111 SAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170
            AIKKYS+AIEVLPT            SS+K Y++A+ DAESAIK +PTYSKGYSRLG+A
Sbjct: 115 LAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYA 174

Query: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNA 230
           KFA G+ EDAL+AYKKVLDIEGDKA+D+MKRDYETAKKKVEQSL+LE    K+ ET++  
Sbjct: 175 KFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLE----KKPETQARG 230

Query: 231 DXXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMM 290
                             S                                     ESMM
Sbjct: 231 ADAGAGGAGGSGGFGDFAS-----MLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMM 285

Query: 291 QNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG--NGGFP 334
           QNP VRQMAENFA G G P++  +MNNP L+DMA ++FG  NG  P
Sbjct: 286 QNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAP 331

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  290 bits (742), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 173/329 (52%), Positives = 205/329 (62%), Gaps = 21/329 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           MA SNK+I++LIVDYL +VVDKK VS D+ DSLNVA++CI EAF  E+ S      +AF 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSS----AAFG 56

Query: 61  GNGLTSFLSGSAT------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114
           G  L   LS  A        +++VNI   A D E K+ AE LKLEGNKAMA KDYE AIK
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIP--AEDAELKSKAESLKLEGNKAMAGKDYELAIK 114

Query: 115 KYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174
           KYSEAI V+PT            SSLK YD+A+ DAESA+KV+ +YSKGYSRLG+AKFAQ
Sbjct: 115 KYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQ 174

Query: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXX 234
           GK E+AL+AYKKVLDIEGD ATD+MKRDYETAK+KVEQ+L L K      ETE++     
Sbjct: 175 GKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTD----ETETSDRGTG 230

Query: 235 XXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNPA 294
                     F DLSSM                                   E+MMQNP 
Sbjct: 231 EPAGANPGGGF-DLSSM----LGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPN 285

Query: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDM 323
           VRQMAE FA G GTP+L+ +MNNP L+DM
Sbjct: 286 VRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  288 bits (736), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 169/340 (49%), Positives = 213/340 (62%), Gaps = 29/340 (8%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNK+IA L+VD+L+  ++KK VS DNADSLNVA+DCI EAFEFE+D VK T+ S F 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GNGLTSFL--------SGSATNDIQVNIAD--DAADEEQKATAEGLKLEGNKAMATKDYE 110
           G  LT  L          S+  DI+V+I+D  +  D+E  A AE LKLEGNKAMA KDY 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 111 SAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170
            A++KY+ AI+++PT            SS +KYD+A+ DAESAIKV P +SKGYSRLGFA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNA 230
           KFAQGK ++AL+AYKK L+++GDKATDIMKRDYETAKKKVEQSLN+EK     A   ++A
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 231 DXXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMM 290
                          PD++SM                                   ESMM
Sbjct: 241 ----------SAGGMPDMASM----LGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMM 286

Query: 291 QNPAVRQMAENFASG--EGTPDLSAMMNNPDLKDMAKNMF 328
           QNP++RQMAEN +SG  EG  D    MNNP +++MA N+F
Sbjct: 287 QNPSIRQMAENLSSGSSEGMGDF---MNNPAIREMASNLF 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  287 bits (735), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 160/349 (45%), Positives = 213/349 (61%), Gaps = 27/349 (7%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           MA SNKE+++LI+DYLN VV K EVS D+ DSLNVA+DC+ E F  E+D++  T++S FN
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GNGLTSFLSGSATN----------DIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYE 110
           G  LT  L  ++ N           +++NI  +  D E KA AE LKLEGNKA+A+KDY+
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQE--DAETKAKAEALKLEGNKAVASKDYD 118

Query: 111 SAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170
            A++KY+EAI++LPT            ++ + YD+AV DAE AIK++P YSKGYSRL +A
Sbjct: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA 178

Query: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKE-AETESN 229
           K+ Q   E++L+AYKKVL+IEGD AT++ KR YETAKK+VE+SLNLEK  P E A  ++N
Sbjct: 179 KYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTN 238

Query: 230 ADXXXXXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESM 289
                          FPD SS+                                   +SM
Sbjct: 239 P---------AAGGGFPDFSSL----MSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSM 285

Query: 290 MQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK 338
           MQNPA++QMAE F  G  TPD S MMNNP +++MA ++F   G P APK
Sbjct: 286 MQNPAIQQMAEQFKGG-NTPDFSEMMNNPAVRNMASSLFSGAGEPAAPK 333

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  279 bits (714), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 167/329 (50%), Positives = 203/329 (61%), Gaps = 16/329 (4%)

Query: 5   NKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFNGNGL 64
           +KE+AA+I+ YL  VV +K V  D  DS+NVA+DCIAE+FE ER  V   +K +    GL
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  TSFLS---GSA--TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEA 119
              L    G A  + D++VNI   A D E KA AE LKLEGNKAMA KD+E AI KYSEA
Sbjct: 62  EECLECMKGGAVKSEDVKVNIP--AEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEA 119

Query: 120 IEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVED 179
           IEVLPT            SSLK+YD+AV DAE AI+++P YSKGYSRLGFAK+AQ K E+
Sbjct: 120 IEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEE 179

Query: 180 ALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXXXXXXX 239
           AL+AYKKV+D+EGDKATDIMKRDYETAKKKVEQSLNLEK TP   +              
Sbjct: 180 ALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK-TP---DARGADSGAGAGAGA 235

Query: 240 XXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNPAVRQMA 299
                F D SSM                                   +SMMQ+P++RQMA
Sbjct: 236 GGAGGF-DFSSM----LSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMA 290

Query: 300 ENFASGEGTPDLSAMMNNPDLKDMAKNMF 328
           E F SG GTP++  +M+NP L++MA +MF
Sbjct: 291 EQFTSGNGTPNMDDLMSNPALRNMASSMF 319

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  278 bits (710), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 199/334 (59%), Gaps = 16/334 (4%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M  + KE+A+LI+DYL    + KE+  D  DSLNVA+DC+ EAFE E++S    ++ +F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GNGLTSFLSGS-----ATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKK 115
           G  L   +  S     AT    V +     D E KA AE LKLEGNKAMATKD+E AI K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 116 YSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175
           YSEAI  LP+            SSLKKY +AV DAE+AIKVNP+YSKGYSRLGFA++A G
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXXX 235
           + E+ALDAYKKVLDIEG  ATD MKRDY+TA KKVEQSLN+E+  P  +  ES       
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAES------- 233

Query: 236 XXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNPAV 295
                    FPD++SM             K                     + MM NPA+
Sbjct: 234 -PDAAGGSGFPDIASMLGGGLGGGLGGLLK---NPQVMQAAQQMMQNPNAMQEMMSNPAI 289

Query: 296 RQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329
           +QMA+ F SG GTP ++ +MNNP L DMAKNMFG
Sbjct: 290 KQMADKFQSGGGTPSMADLMNNPALMDMAKNMFG 323

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  274 bits (701), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 199/334 (59%), Gaps = 23/334 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M  SNKEIAALIV +L+     K+V  +  DSLNVA+DCIAEAFE ER+   + V  A+N
Sbjct: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GNGLTSFLSGSATNDI-----QVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKK 115
           G GL   +   A+              DA   E    AE LKLEGNKA A KD+E A+KK
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118

Query: 116 YSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175
           Y+EAIE++P             SS KK+++AV DAESA+++NP+YS+GYSRLG AK+A G
Sbjct: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178

Query: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXXX 235
           K E+A++AYKKVLDIEGD AT+ MKRDYE+AKKKVE+SLNLE + PK  E +++      
Sbjct: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL-PKGEEQQTS------ 231

Query: 236 XXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQNPAV 295
                    FPDLSSM                                   + MM NPA+
Sbjct: 232 --EGSSAGGFPDLSSM-------LGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAI 282

Query: 296 RQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329
           +QMA+NFASG GTP+L  MM +P++KDMA   FG
Sbjct: 283 KQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  272 bits (696), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 205/343 (59%), Gaps = 15/343 (4%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNKE+ +LIVD+L+ V+  KE+S D+ADSLNVA+DCI E+FEFERD+V  T++  F+
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GNGLTSFLSGSAT--------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESA 112
           G  L   LS ++           ++VNI     D E KATAE  KLEGNKAMA KDY  A
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIP--VEDAEIKATAESFKLEGNKAMAAKDYRLA 118

Query: 113 IKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKF 172
           I+KYSEAI+ LPT            SS+K+YD+A+ DAE AI+++P YSKGYSRL FAK+
Sbjct: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178

Query: 173 AQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADX 232
           A  K E+AL+ YKKVLD+EGDKAT  MKRD+E AK +VE S+NLEK +    E   +A  
Sbjct: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA-- 236

Query: 233 XXXXXXXXXXXXFPDLSSM-XXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQ 291
                        PD+SS+                                    + MMQ
Sbjct: 237 GQQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQ 296

Query: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334
           NP +R+MA+N ASG+   +L  +MNNP +KDMA N+FG  G P
Sbjct: 297 NPNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  264 bits (674), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 212/341 (62%), Gaps = 17/341 (4%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ +NK+I ALIVD+L+ +++K EVS DNADSLNVAMDCI+EA EF+R+ V +T+K+ FN
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GNGLTSFLSGSATN----------DIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYE 110
           G  L   L+ ++T            ++VNI     D E KA AE  KLEGNKAMA KD+ 
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIP--VEDAEIKANAEAFKLEGNKAMAMKDFH 118

Query: 111 SAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170
            A++KY+EAI++LPT            SSLK++++A+ DAESAIK++P+YSKGYSRL FA
Sbjct: 119 LAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFA 178

Query: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKV-TPKEAETESN 229
           K+  GK E+AL++YKKVLDIEGD AT  MKRDYETAKK+VE+S+N+EK  TP++ + +  
Sbjct: 179 KYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQ 238

Query: 230 ADXXXXXXXXXX-XXXFPDLSSMXXXXXXXXXXXXXKXXXX-XXXXXXXXXXXXXXXXXE 287
            +               PD+SS+                                    +
Sbjct: 239 TNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQ 298

Query: 288 SMMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMF 328
           SMM +P++R +A NF +  G  D++ +MNNP +++MA N+F
Sbjct: 299 SMMSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLF 337

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  262 bits (669), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/235 (58%), Positives = 175/235 (74%), Gaps = 13/235 (5%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-KSAF 59
           M+AS +EIAALIV+Y +++V+KKE+S D ADSLNVAMDCI+EAF FER++V   + KS F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  NGNGLTSFLSGSA----------TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109
            G  L   L+ ++            ++++NI +D  D E KA AE LK++GNKAMA KDY
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPED--DAETKAKAEDLKMQGNKAMANKDY 118

Query: 110 ESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169
           E AI KY+EAI+VLPT            SSLK+YD AV DAESAI ++P+Y +GYSRLGF
Sbjct: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGF 178

Query: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA 224
           AK+AQGK E+AL+AYKKVLDIEGD AT+ MKRDYE+AKKKVEQSLNLEK  P+++
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQS 233

 Score = 70.1 bits (170), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (82%)

Query: 287 ESMMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGG 332
           + MMQ+P++RQMAE FASG GTP+LS +MNNP L++MA N+FG  G
Sbjct: 287 QKMMQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAG 332

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  259 bits (661), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 176/234 (75%), Gaps = 13/234 (5%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-KSAF 59
           M+AS +EIA+LIV+Y +++V+KKEVS D+ADSLNVAMDCI+EAF FERD+V   + KS F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  NGNGLTSF------LSGSATND----IQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109
            G  L +       L  S   D    ++VNI ++  D E KA AE LK++GNKAMA K+Y
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEE--DAETKAKAEELKIQGNKAMANKEY 118

Query: 110 ESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169
           E AIKKY+EAI+VLPT            SSLK+YD+A+ DAESAI V+P+Y +GYSRLGF
Sbjct: 119 ELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGF 178

Query: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKE 223
           AK+AQGK E+AL+AYKKVLDIEGD ATD MKRDYE+AKK+VEQSLNLEK  P++
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQ 232

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%)

Query: 287 ESMMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334
           ++MMQ+P++RQMAE F SG GTP+LS +M NP L++MA ++FG    P
Sbjct: 287 QNMMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAP 334

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  252 bits (644), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/347 (47%), Positives = 204/347 (58%), Gaps = 33/347 (9%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNKEIAALIVD+L++      V+ D  DSLNVA+DCI EAF+FERD     +   FN
Sbjct: 1   MSLSNKEIAALIVDFLSSS--SSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GNGLTSFLS------GSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114
           G  L   L+      G +   ++V+I     D   KA AE LKL+GNKAMA K ++ AI+
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIP--VEDAAAKAKAEELKLQGNKAMAAKKFDEAIE 116

Query: 115 KYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174
           KY+ AIEV P+            SSLK+Y+ AV DAE AI+V+PTYSKG+SRLGFAK+A 
Sbjct: 117 KYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176

Query: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXX 234
            K E+ALDAYKKVLDIEG+KATD+MKRDYETAKKKVE S+NLEK +   A +E  +D   
Sbjct: 177 NKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEK-SSTSASSEDVSDKSA 235

Query: 235 XXXXXXXXXXFPDLSSMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXESMMQ--- 291
                      PDLSS                                    E MMQ   
Sbjct: 236 TEGPGAGAGGLPDLSS------------LLGGGGLGGGLGALLNNPQVMQAAEKMMQNPG 283

Query: 292 -------NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNG 331
                  NPA++QMA  F+SG G PDLS MMN+P ++DMAKNMFG G
Sbjct: 284 LMQDMMSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334
           NP V Q AE      G   +  MM+NP +K MA      GG P
Sbjct: 268 NPQVMQAAEKMMQNPGL--MQDMMSNPAMKQMANQFSSGGGMP 308

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  231 bits (589), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 185/335 (55%), Gaps = 16/335 (4%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNK+IAALIVD+L      K V  D  DSL VA+DCI EAFE         V     
Sbjct: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  GNGLTSFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAI 120
           G  L+  L+    +         AA EE K  AE LKLEGN+AMA KDYE+AI+KY+ AI
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEPKVAA-EELKKEAEALKLEGNRAMAAKDYETAIQKYTAAI 117

Query: 121 EVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
           EVLPT            SSL++Y+ AV DAE A KV+ +YSKG+SRLG+AK+A G+ E+A
Sbjct: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEA 177

Query: 181 LDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADXXXXXXXXX 240
           L+AYK+VLDIEGD AT+ M+RDYE+AK+KVE+S+N++    + AE     +         
Sbjct: 178 LEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMD----RNAEV---TESGDSAAGSA 230

Query: 241 XXXXFPDLSSMXXXXXXXXXXXXXKXXXXX------XXXXXXXXXXXXXXXXESMMQNPA 294
                PDL+SM                                         + MM NPA
Sbjct: 231 GGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPA 290

Query: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329
           +++MAENFASG G+  L  +M +P +++MA   FG
Sbjct: 291 IKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  194 bits (493), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 103/226 (45%), Positives = 153/226 (67%), Gaps = 5/226 (2%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ +NK+  ALIV+YL+ ++D KEVS DNA+SLNVA+DCI++ FE +  S +  +   FN
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GNGLTSF-LSG----SATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKK 115
            + L +  L G    + ++ +++ + ++   E++K  AE LKLEGNK M+ K+Y+SAI K
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDK 120

Query: 116 YSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175
           YS+AIE+ P+              ++ + +AV DA +AIK++PTYSK YSRLG AK A+G
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

Query: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTP 221
             EDA+ A+KKVL++EGDK+T++MK DYE AKK V+  + L K  P
Sbjct: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVP 226

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 287 ESMMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMF 328
           E +MQNP VRQ AEN A+G G   LS ++NNP +K++A  + 
Sbjct: 280 EGLMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  145 bits (367), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 137/224 (61%), Gaps = 21/224 (9%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ SNKEIA+ IV YL++++   +V+ D A+S++VA++CI ++F+ + +   D       
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53

Query: 61  GNGLTSFLSGSATNDIQVNIADDAADEEQKATAEG---LKLEGNKAMATKDYESAIKKYS 117
                S L+     ++ +      +++E++   E    LKLEGNKA+  ++Y+ AI KY+
Sbjct: 54  -----SDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYT 108

Query: 118 EAIEVL-----PTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKF 172
            AI++L     P             +   +Y++A +DA + IK++PT+SKGYSRL  AK 
Sbjct: 109 RAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKI 168

Query: 173 AQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNL 216
            Q K EDA++AYK+VLD+EG+KATD MKRD+E  K+K E +LN 
Sbjct: 169 GQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNF 211

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  131 bits (329), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 119/213 (55%), Gaps = 14/213 (6%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M+ + ++ A+LI+ YL+ + +   +  D  +SL VA+ CI E+F  + D +  ++K    
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKE--- 57

Query: 61  GNGLTSFLSGSATNDIQVNIAD-DAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEA 119
              L + L        Q N+   +A  +     AE LK EGN+AM    YE AIKKY+EA
Sbjct: 58  -RTLKTIL--------QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEA 108

Query: 120 IEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVED 179
           I+                S L +Y+DAVNDA  AI ++P++SK YSRLG+AK  Q K+ED
Sbjct: 109 IQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLED 167

Query: 180 ALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQ 212
            + AYK+ +D+EG  A+  +  DYE A+ K EQ
Sbjct: 168 GMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  125 bits (313), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 140/280 (50%), Gaps = 52/280 (18%)

Query: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
           M  +++EIA++IVDY N  +   +++ DN DSLNVA+DCIA+ F+ ++D + + +K+A+ 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GNGLTSFLSG---SATN----DIQVNIADDAAD-------------------------EE 88
            N L ++L     SA N    +  +N++    D                         EE
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 89  QKAT---------AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS 139
            K T         AE LK +GN+ M  K Y  AI  YS+AI++ PT              
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 140 LKKYDDAVNDAESAI----KVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI----- 190
              +D A+ DA  +I    K++PT  K Y RLG AK+  G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 191 EGDKATDIMKRDYETAKKKVEQS--LNLEKVTPKEAETES 228
           +GD+ T  M  DYE AK+KV++   + + K T KE    S
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNS 280

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  121 bits (303), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 124/256 (48%), Gaps = 41/256 (16%)

Query: 6   KEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFNGNGLT 65
           K++A LIV++L NV+ KKE+S DN DSLNVA+DCI + +      +  ++   F+ + LT
Sbjct: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSDLT 68

Query: 66  SFLSGSATND--------------------------------------IQVNIADDAAD- 86
           S L+  A N+                                      I +N+ D + + 
Sbjct: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128

Query: 87  --EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYD 144
             ++ K  A+  K EGN+ M ++DY+ AI+ Y+ AI   P               +  Y+
Sbjct: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYE 204
            A+NDA   I ++  +SK Y RL   K  Q +  DALD YKK +++  D   + + R++E
Sbjct: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248

Query: 205 TAKKKVEQSLNLEKVT 220
             K KV+  ++L +++
Sbjct: 249 DLKLKVQTDISLREIS 264

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXX-XXXXXXXXSSLKKYDDAVNDA 150
           TA+  K +GN A   KDYE AI  +S+AIEV  T             +SLKK+ +A+NDA
Sbjct: 3   TADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDA 62

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
           E  +K+NPT+SKGY+RLG A    G +++A  +YKK L+++G
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG       D+ +A+K Y+E I+  P             S L  + +A+ D   
Sbjct: 390 AEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNK 449

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R   A+ A
Sbjct: 450 AIEKDPNFIRAYIRKATAQIA 470

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPT-XXXXXXXXXXXXSSLKKYDDAVNDA 150
           TA+  K +GN A  +KD+  AI+ +++AIEV PT             +S K++ +A+NDA
Sbjct: 4   TADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
              +K+NPT+SKGY+RLG A+F  G +E+A   YK+ L ++ +
Sbjct: 64  TECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ +A+K YSE I+  P             S L  + +A+ D ++
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDN 448

Query: 153 AIKVNPTYSKGYSRLGFAKFAQGKVEDALD 182
           AIK +P + + Y R   A+ A  +  +ALD
Sbjct: 449 AIKKDPNFVRAYIRKATAQIAIKEYANALD 478

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 62/137 (45%), Gaps = 8/137 (5%)

Query: 90  KATAEGLKLEGNKAMATKDYESAIKKYSEA------IEVLPTXXXXXXXXXXXXSSLKKY 143
           K  A+  K+EGNK      ++ AI++Y++A      I  L              +++   
Sbjct: 252 KLEADEAKVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATL 311

Query: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVL--DIEGDKATDIMKR 201
           ++AV+            +K ++R+G A   +G ++ ++D Y+K L      D  T +   
Sbjct: 312 NEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNC 371

Query: 202 DYETAKKKVEQSLNLEK 218
           + E  K++ EQ ++ EK
Sbjct: 372 EKELKKQEAEQYIDPEK 388

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (62%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLP-TXXXXXXXXXXXXSSLKKYDDAVNDA 150
           +A+  K +GN A + K+YE A+  +S+AIEV P              +SLKK+ DA+NDA
Sbjct: 4   SADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
               K+NPT+SKGY+R+G A +  G +++A  +YKK L+++ 
Sbjct: 64  NECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDA 105

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 81/210 (38%), Gaps = 31/210 (14%)

Query: 13  VDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERD----------------SVKDTVK 56
           + YLNN    +   GD   ++    D I +  E   D                 + D  K
Sbjct: 291 ITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKK 350

Query: 57  SA-FNGNGLTSFLS-------GSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKD 108
           +A F    LT F +        S    I+V  A+   + E+   AE  +++G        
Sbjct: 351 AAEFFNKSLTEFRTPATLTKLRSLEKKIKVQEAEAYINPEK---AEEARIQGKDFFNKGQ 407

Query: 109 YESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLG 168
           +  A+K Y+E I   P             S L  + +A++D E A++ +P + K Y R  
Sbjct: 408 WPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKA 467

Query: 169 FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
            A+ A  +   AL+     LDI   K T++
Sbjct: 468 TAQIAIKEYSSALE----TLDIARSKDTEL 493

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXX-XXXXXXXXSSLKKYDDAVNDA 150
           TA+  K +GN A   KDY+ AI+ +++AIEV  T             +SLKK+ DA+NDA
Sbjct: 4   TADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
              +K+NP++SKGY+RLG A    G +++A   YKK L+++ 
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ +A+K Y+E I+  P             + L  + +A+ D   
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 153 AIKVNPTYSKGYSRLGFAKFAQGKVEDALD 182
           AI+ +P + + Y R   A+ A  +   AL+
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVKEYASALE 485

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           +AE  K +GN A   KD+E A + +S+AIE   T             +SLKK+ +A+ DA
Sbjct: 2   SAEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDA 61

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
           E  +K+NPT+SKGY+R+G A++  G ++DA   YKK L+I+ 
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +L+G +     D+ SA+  Y+E I+  P             + L  + DA+ D + 
Sbjct: 401 AEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDV 460

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI  +P + + Y R   A+ A
Sbjct: 461 AISKDPNFVRAYIRKASAQIA 481

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 74/124 (59%), Gaps = 3/124 (2%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXX-XXXXXXXSSLKKYDDAVNDA 150
           TA+  K +GN A   K+Y+ AI+ +++AIEV  T             +SLKK+ DA+NDA
Sbjct: 4   TADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDK--ATDIMKRDYETAKK 208
              +K+NP++SKGY+RLG A    G +++A   YKK L+++ +   A D +++ + T + 
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQA 123

Query: 209 KVEQ 212
           +  Q
Sbjct: 124 RQAQ 127

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ +A+K Y+E I+  P             + L  + +A+ D   
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 153 AIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMK 200
           AI+ +P + + Y R+  A+ A  +   AL+     LD+   K  ++ K
Sbjct: 456 AIEKDPNFVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNK 499

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 62/101 (61%), Gaps = 1/101 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           +AE  K +GN A   KDYE A + +++AIE                 +SLKK+++A+NDA
Sbjct: 2   SAEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDA 61

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIE 191
              +K+NP +SKGY+R+G A F  GK+++A   YKK L+I+
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 68/184 (36%), Gaps = 25/184 (13%)

Query: 13  VDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFNGNGLTSF----- 67
           V YLNN    +   GD   ++    + + +  E   D    +   A  GN          
Sbjct: 300 VTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKK 359

Query: 68  --------LSGSATNDIQVNIADDAADEEQKAT----------AEGLKLEGNKAMATKDY 109
                   L+   T DI   + +   ++EQK            AE  +L+G +     D+
Sbjct: 360 AIEFYQKSLTEHRTPDILTKLRN--CEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDW 417

Query: 110 ESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169
            +A+K Y+E  +  P             + L  + +A+ D + AI  +P + + Y R   
Sbjct: 418 PNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKAT 477

Query: 170 AKFA 173
           A+ A
Sbjct: 478 AQIA 481

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 63/101 (62%), Gaps = 1/101 (0%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXX-XXXXXXXXSSLKKYDDAVNDAE 151
           A+  K +GN A   KDY+ AI+ +++AIEV  T             +SLKK+ DA+NDA+
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 152 SAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
             I +NP++SKGY+RLG A    G +++A + YKK L+++ 
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG       D+ +A+K Y+E I+  P             + L  + +A+ D   
Sbjct: 396 AEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 153 AIKVNPTYSKGYSRLGFAKFAQGKVEDALD 182
           AI+ +P + + Y R   A+ A  +   AL+
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVQEYAAALE 485

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 91  ATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVND 149
           +TA+ LK +GN A A+KD+  AI+ ++EAI    T             +SLK++ +A+ND
Sbjct: 2   STADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALND 61

Query: 150 AESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
           A+  +K+NP +SKGY+R+G A    G ++DA   YKK L+++ +
Sbjct: 62  AQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSN 105

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ +A+K Y+E I+  P             + L  + +A+ D E 
Sbjct: 390 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEK 449

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R   A+ A
Sbjct: 450 AIEKDPNFVRAYLRKATAQIA 470

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPT-XXXXXXXXXXXXSSLKKYDDAVNDA 150
           TA+  K +GN A   KDY  AI  +++AIEV                +SLKK+ DA+NDA
Sbjct: 4   TADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
              +K+NP++SKGY+RLG A    G ++DA   YKK L+++ 
Sbjct: 64  TECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 73/192 (38%), Gaps = 23/192 (11%)

Query: 13  VDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFNGNGLTSF----- 67
           + YLNN    +   GD   ++    D + +  E   D    +   A  GN          
Sbjct: 292 ITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKK 351

Query: 68  --------LSGSATNDIQVNIADDAADEEQKATAEGL---------KLEGNKAMATKDYE 110
                   L+   T DI   + + A  E +KA AE           +LEG +     D+ 
Sbjct: 352 TIDNYQKSLTEHRTADILTKLRN-AEKELKKAEAEAYINPEKAEEARLEGKEYFTKSDWP 410

Query: 111 SAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170
           +A+K Y+E I+  P             + L  + +A+ D   AI+ +P + + Y R   A
Sbjct: 411 NAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATA 470

Query: 171 KFAQGKVEDALD 182
           + A  +   AL+
Sbjct: 471 QIAVQEFAGALE 482

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           +A+  K +GN A   KDY+ AI  +S+AI+V                +SLKK+ +A+ DA
Sbjct: 4   SADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
           E  +K+NP++SKGY+R+G A F  G +++A   YKK L+++ 
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 1/130 (0%)

Query: 53  DTVKSAFNGNGLTSFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESA 112
           D  K +   +     LS     + QV I  +A D      AE  +LEG       D+ +A
Sbjct: 358 DFYKKSLTEHRTPEILSKLRAAEKQVKI-QEAEDYINPEKAEEARLEGKDYFTKGDWPNA 416

Query: 113 IKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKF 172
           +K Y+E I+  P             S L  + +A++D   AI+ +P + + Y R   A+ 
Sbjct: 417 VKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQI 476

Query: 173 AQGKVEDALD 182
           A  +   AL+
Sbjct: 477 AVREFSSALE 486

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           TA+  K +GN A   K+Y+ AI+K+++AIEV  T             +S K++   + DA
Sbjct: 4   TAQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
              +K+NPT+SKGY+R+G A F  G +++A  AYKK L+++ 
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ +A+K Y+E I   P+            S L  + +A+ D  +
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNT 448

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R   A+ A
Sbjct: 449 AIEKDPNFIRAYIRKATAQIA 469

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 74/124 (59%), Gaps = 3/124 (2%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPT-XXXXXXXXXXXXSSLKKYDDAVNDA 150
           TAE  K EGN A A KD+E AI+ + +AIEV                +S++K+ +A+ DA
Sbjct: 3   TAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADA 62

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDK--ATDIMKRDYETAKK 208
           +  +++ P +SKG++RLG A +  G +++A ++YKK L+++     A D + +   T ++
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQ 122

Query: 209 KVEQ 212
           ++EQ
Sbjct: 123 RMEQ 126

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +L+G +     D+ +A+K Y+E I+  P             + L  + DA+ D + 
Sbjct: 388 AEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDM 447

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R   A+ A
Sbjct: 448 AIQKDPNFVRAYIRKATAQIA 468

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 73/124 (58%), Gaps = 3/124 (2%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVL-PTXXXXXXXXXXXXSSLKKYDDAVNDA 150
           +A+  K +GN A A KD+E AI+ +++AIEV                +S K+++ A+ DA
Sbjct: 2   SADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDA 61

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG--DKATDIMKRDYETAKK 208
           +  + +NP +SKGY+R+G A F  G +++A   YKK L+++     A D +++ ++T + 
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQS 121

Query: 209 KVEQ 212
           + +Q
Sbjct: 122 RQQQ 125

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +L+G +     D+ +A+K Y+E I+  P             S L  + +A+ D   
Sbjct: 393 AEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNV 452

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI  +P + + Y R   A+ A
Sbjct: 453 AISKDPNFIRAYIRKATAQIA 473

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 6/105 (5%)

Query: 90  KATAEGLKLEGNKAMATKDYESAIKKYSEAIEV------LPTXXXXXXXXXXXXSSLKKY 143
           KA A+  K EGNK    + ++ AI+ YS+A E+      L              +++K  
Sbjct: 256 KAKADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTL 315

Query: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVL 188
            +AV             SK ++R+G +     +++ A++ Y+K L
Sbjct: 316 TEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 64/102 (62%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           +A+  K +GN A   KDY  AI  +++AIEV  T             +S KK+++A+ DA
Sbjct: 2   SADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDA 61

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
           E  +K++P++SKGY+R+G A+F   ++++A  +YK+ L+++ 
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDS 103

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +L+G +     D+ +A+K Y+E ++  P             + L  + +A+ D   
Sbjct: 380 AEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNK 439

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           A+ ++P + + Y R   A+ A
Sbjct: 440 AVSIDPNFVRAYIRKATAQIA 460

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 64/103 (62%), Gaps = 3/103 (2%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEV--LPTXXXXXXXXXXXXSSLKKYDDAVND 149
           +A+  K EGN+A A+KDY  AI+ +++AIEV   P             S+ K +  A++D
Sbjct: 2   SADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASN-KDFVKALDD 60

Query: 150 AESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
           A   +K+NP+++KGY+RLG A +  G +++A  +YKK L+++ 
Sbjct: 61  ANECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDS 103

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +L+G +     D+  A++ Y+E I+  P             S L  + DA+ D + 
Sbjct: 389 AEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDK 448

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R    + A
Sbjct: 449 AIEKDPNFVRAYIRKATGQIA 469

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 90  KATAEGLKLEGNKAMATKDYESAIKKYSEAIEV------LPTXXXXXXXXXXXXSSLKKY 143
           K+ AE  K EGNK    + ++ AI+KY+EA E       L              ++++  
Sbjct: 252 KSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETL 311

Query: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVL--DIEGDKATDIMKR 201
             AV             SK ++R+G +    G ++ A+D Y+K L      D  T +   
Sbjct: 312 TKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNT 371

Query: 202 DYETAKKKVEQSLNLEK 218
           + E  +K+ E  ++ EK
Sbjct: 372 EKELKQKEAESYMDPEK 388

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 1/101 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           +A+  K +GN A   KDYE A + + +AI+V                +SLKK+ + + DA
Sbjct: 3   SADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDA 62

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIE 191
           E  +K+NP +SKGY+R+G A+F    +EDA  +Y+K L+++
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +  +  D+ +A+K Y+E I+  P             + L  + +A+ D + 
Sbjct: 382 AEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDR 441

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R   A+ A
Sbjct: 442 AIEKDPNFIRAYIRKASAQIA 462

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 62/103 (60%), Gaps = 1/103 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX-SSLKKYDDAVNDA 150
           TA+  K +GN A A K Y+ A+  +++AIEV  T             +S +K+++A+ DA
Sbjct: 4   TADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
               K+NP+++KGY+R G A F  G ++DA  +YKK L+++ +
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ SA+K Y+E I+  P             S L  + DA++D   
Sbjct: 385 AEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNK 444

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P + + Y R   A+ A
Sbjct: 445 AIEKDPNFVRAYIRKATAQIA 465

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 8/113 (7%)

Query: 83  DAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKK 142
           D   +E K  AE  K+EGNKA   ++++ AI  Y++A E L                  +
Sbjct: 241 DVDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGE 299

Query: 143 YDDAVNDAESAI----KVNPTY---SKGYSRLGFAKFAQGKVEDALDAYKKVL 188
           YD A+N    AI    ++   Y   +K ++R+G A    G +++A++ Y+K L
Sbjct: 300 YDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPT-XXXXXXXXXXXXSSLKKYDDAVNDA 150
           TA+  K EGN A   KDY+ AI  +++AIEV  T             +S K+Y+ A++DA
Sbjct: 4   TADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDA 63

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKA 195
           +  IK+NP+++KGY+R G A     K E+A   Y + L I+ + A
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +LEG +     D+ +A+K Y+E I+  P             + L  + DA++D   
Sbjct: 385 AEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNK 444

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+ +P++ + Y R    + A
Sbjct: 445 AIEKDPSFIRAYLRKATCQIA 465

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 61/102 (59%), Gaps = 1/102 (0%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAI-EVLPTXXXXXXXXXXXXSSLKKYDDAVNDA 150
           +AE  K EGN A   KD++ A++ ++ AI E                +SLKK+D+A++DA
Sbjct: 3   SAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDA 62

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
              +K+   +SKG++RLG A F  G +++A ++YKK L+++ 
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           AE  +L+G +     D+ SA+K YSE I   P             S L  + DA+ D + 
Sbjct: 392 AEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDK 451

Query: 153 AIKVNPTYSKGYSRLGFAKFA 173
           AI+++P++ + Y R   A+ A
Sbjct: 452 AIEIDPSFVRAYIRKATAQIA 472

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 61/139 (43%), Gaps = 12/139 (8%)

Query: 90  KATAEGLKLEGNKAMATKDYESAIKKYSEA------IEVLPTXXXXXXXXXXXXSSLKKY 143
           +  AE  K EGN+    + ++ AI KY EA      I  L              S++K  
Sbjct: 255 RENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTL 314

Query: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMKR-- 201
           ++AV             +K ++RLG A +   +V+ A++ Y+K L     +  D++ +  
Sbjct: 315 NEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSLT--EHRTPDVLNKLR 372

Query: 202 --DYETAKKKVEQSLNLEK 218
             + E  K++ E  ++ EK
Sbjct: 373 NLEREIKKREAEAYIDPEK 391

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 94  EGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESA 153
           E  ++EG +    ++Y  A+K Y+E I+  PT              L      ++D + A
Sbjct: 430 EEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKA 489

Query: 154 IKVNPTYSKGYSRLGFAKFAQGKVEDALDAY 184
           I V+P+Y K Y R GFA+  +  +++AL+ +
Sbjct: 490 ISVDPSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 92  TAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXS-SLKKYDDAVNDA 150
           +++ LK  GNK    K YE A+  ++ A+    T               LK Y +A+ D 
Sbjct: 7   SSQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDG 66

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           ++ +++ P + KGYSR+G A     K+++A + +KK L +
Sbjct: 67  KNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           A   K EGNK +  +D++ A + Y++AIE  PT              L  + +A+ND  +
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 153 AIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIM-KRDYETAKKKVE 211
           AI++N +  K Y R G A       + A + +  VL     K  DI+ K  ++T +K + 
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKY---KPNDIIAKNGFDTCEKVIR 125

Query: 212 Q 212
           +
Sbjct: 126 E 126

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 2/112 (1%)

Query: 85  ADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYD 144
           AD +++A A   K EGN  +  ++Y  AI+ YS+AIE+ PT              L  + 
Sbjct: 6   ADAKEQAVA--FKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQ 63

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKAT 196
             +ND + A++++P   K Y R G +     + + A +  + VL  +   AT
Sbjct: 64  SCMNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 68/150 (45%), Gaps = 13/150 (8%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A D E    AE  K +GN+    K Y+ A + Y++ IE+               ++    
Sbjct: 69  AYDGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELE 128

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKA---- 195
           LK Y   VND   A++ NPT  K + R+  A F   K EDA +A +  L ++ + A    
Sbjct: 129 LKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESAALKA 188

Query: 196 --TDIMKRDYETAKKKVEQSLNLEKVTPKE 223
               ++KR+ +   KK  ++  L + T KE
Sbjct: 189 LLQKVIKREED---KKAHEAKRLREETEKE 215

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 4/124 (3%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D+ + EE+   A GLK +GN+    K +E A+K YS AIEV                SL 
Sbjct: 85  DELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLG 143

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA---LDAYKKVLDIEGDKATDI 198
           + +  V D  +A+K+ P YSK   R   A  + GK  DA   L A     D  G     +
Sbjct: 144 QQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDFNGSSIEPL 203

Query: 199 MKRD 202
           ++R+
Sbjct: 204 LERN 207

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 91  ATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDA 150
           A A   K  GN A+ T+DY  AI+ Y+EAI++  T              +  +   +ND 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKV 210
           + A++++P   K Y R G +     + ++A    K VL  + + AT   KR  +  +K +
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFI 127

Query: 211 EQ 212
            +
Sbjct: 128 RE 129

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 99  EGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNP 158
           +GNK +A+KDY  AI+ Y++AIE+                 L ++  A+ D+  AI+++ 
Sbjct: 15  QGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDS 74

Query: 159 TYSKGYSRLGFA 170
           +  KGY R G A
Sbjct: 75  SNVKGYHRRGMA 86

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           EQ A A  LK EGN  +  +D+  AI  Y++AI +  T              L  +  ++
Sbjct: 7   EQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSL 66

Query: 148 NDAESAIKVNPTYSKGYSRLGFA 170
           ND + A+K++P  +K Y R G +
Sbjct: 67  NDCDEALKLDPKNAKAYHRRGLS 89

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 85  ADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYD 144
           +DE++   A GLK +GN+    K Y+ AI+ YS AIEV                SL + +
Sbjct: 87  SDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQE 145

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
             V D  +A+K+ P YSK   R   A  + G   DA+
Sbjct: 146 KVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAM 182

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 5/111 (4%)

Query: 96  LKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIK 155
           LK EGNK +  K Y  A++ Y++AIE+  T              L  +   ++D  SA++
Sbjct: 16  LKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALE 75

Query: 156 VNP-----TYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMKR 201
           ++P      + +G S+LG   F + K + ++    K  D    +A D+ ++
Sbjct: 76  LDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDATAKRALDMCEK 126

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDA 146
           EEQK  +  LK +GNK    KDY +AIK Y+ A++ L               SL + D  
Sbjct: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKV 174

Query: 147 VNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
           +  +  A+++NP YSK   R   A  +     DAL     VL + GD
Sbjct: 175 IESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDA 146
           E  +  A   K EGN  +  K +  AI+KY+EAI++  T              +  +  A
Sbjct: 6   EADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSA 65

Query: 147 VNDAESAIKVNPTYSKGYSR 166
           +ND + AIK++P   K Y R
Sbjct: 66  LNDCDEAIKLDPKNIKAYHR 85

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 1/100 (1%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D   +E +   A  LK +GN+   T  +E AIK Y  A++ L              +SL 
Sbjct: 99  DSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLL 157

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
           +Y+  +  A  A+K+ PT+SK   R   A  A G   DA+
Sbjct: 158 QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDA 146
           +E  ATA   K +GN+ +   DY+SAI+ YS+AI +  T                 +  A
Sbjct: 6   QEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSA 65

Query: 147 VNDAESAIKVNPTYSKGYSRLGFA 170
           V D ++A+K++P   K Y R G +
Sbjct: 66  VVDCDNALKLDPKNIKAYHRRGLS 89

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 43/104 (41%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLP----TXXXXXXXXXXXXSS 139
           A D E    AE  K +GN     K +  A   Y++ IEV                     
Sbjct: 68  AYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELE 127

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK Y   +ND   A+K+NP   K + R+G A     K+E+A +A
Sbjct: 128 LKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEA 171

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 96  LKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIK 155
            K EGN  + ++DY+ AI+ Y++AIE+  T              L  +  A++D   AIK
Sbjct: 15  FKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIK 74

Query: 156 VNPTYSKGYSRLGFA 170
           ++    K Y R G A
Sbjct: 75  LDNNNIKAYHRRGLA 89

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%)

Query: 90  KATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVND 149
           +A A   K EGN  +  K +  AI+KY+EAI++  T              +  +  A+ND
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 150 AESAIKVNPTYSKGYSR 166
            + AIK++P   K Y R
Sbjct: 69  CDEAIKLDPKNIKAYHR 85

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVL----PTXXXXXXXXXXXXSS 139
           A + E    AE  K +GN     + Y+ A + Y++ +EV                     
Sbjct: 71  AYEGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELE 130

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK +   +ND + A++ NP   K + R+G A F+  K+E+A +A
Sbjct: 131 LKNHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEA 174

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 68/164 (41%), Gaps = 19/164 (11%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIE----VLPTXXXXXXXXXXXXSS 139
           A + E    AE  K +GN     K +  A + Y++ IE    V                 
Sbjct: 69  AYEGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLE 128

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALD-------------AYKK 186
           LK +   ++D ++A+  NP   K Y R+G A  A  K E A +             +++ 
Sbjct: 129 LKNFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFEN 188

Query: 187 VLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNA 230
           +L+I  +K  +I  R YE  K K +Q    +K+  ++A T  N 
Sbjct: 189 LLNIIKNKEEEI--RKYEEKKLKAQQDRENKKIMLQDALTLRNV 230

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%)

Query: 86  DEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDD 145
           D    ATA   K EGN+ +  KDY  A++ Y+ AIE   T              L ++  
Sbjct: 31  DSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQS 90

Query: 146 AVNDAESAIKVNPTYSKGYSRLGFAK 171
           A+ D+  AI+++    K Y R G A 
Sbjct: 91  ALEDSARAIELDAGNVKAYHRRGLAH 116

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%)

Query: 99  EGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNP 158
           EGN  +  +DY  AI+KY +AIE+  T              L  +  A  D + A+ ++P
Sbjct: 15  EGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDP 74

Query: 159 TYSKGYSRLGFA 170
              K Y R G A
Sbjct: 75  KNVKAYHRRGLA 86

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%)

Query: 99  EGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNP 158
           EGN  +  K +  AI+KY+EAI++  T              +  +  A+ND + AIK++P
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 159 TYSKGYSR 166
              K Y R
Sbjct: 78  KNIKAYHR 85

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDA 146
           E  +A A   K EGN  +  K +  AI+KY++AI++  T              +  +  A
Sbjct: 6   EADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSA 65

Query: 147 VNDAESAIKVNPTYSKGYSR 166
           +ND + A+K++P   K Y R
Sbjct: 66  LNDCDEALKLDPKNIKAYHR 85

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K + N     K +  A + Y++ I+V               ++    
Sbjct: 76  AYEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELE 135

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK Y   V D + A+++NP   K + R+G A  A GK ++A DA
Sbjct: 136 LKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDA 179

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 57/132 (43%), Gaps = 4/132 (3%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D+   E+    A  LK +GN+    KD+E AI+ Y+ AI  L               S+ 
Sbjct: 93  DEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSIN 151

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA---LDAYKKVLDIEGDKATDI 198
            ++  V D  +A+K+ P YSK + R   A    G+  DA   L A   + +  G     +
Sbjct: 152 NFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQL 211

Query: 199 MKRDYETAKKKV 210
           ++R+      KV
Sbjct: 212 LERNMNKQATKV 223

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 4/101 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K +GN     K +  A   Y++ IE+               ++    
Sbjct: 71  AYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLE 130

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
           LK Y   +ND + A+ +NP   K Y R+G A +    +E+A
Sbjct: 131 LKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 5/118 (4%)

Query: 85  ADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYD 144
            D E   T   L   G   M   DY +A + + +A+                   + +Y 
Sbjct: 281 VDSEDSTTWYHL---GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYR 337

Query: 145 DAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDIMKR 201
           DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   +E D  T I +R
Sbjct: 338 DALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDN-THIRER 394

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 6/140 (4%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K +GN     K +  A + YS+ I+V               ++    
Sbjct: 72  AYEGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELE 131

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG-DKATDI 198
           +K Y   +ND + A+++NP   K Y R+  A  A  ++++AL++ +    I+  +K+   
Sbjct: 132 IKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKT 191

Query: 199 MKRDYETAKKKVE-QSLNLE 217
           +K   ET + ++E + L LE
Sbjct: 192 LKLHIETKQLEIEARRLKLE 211

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           E  A A   K EGN  +  ++Y  AI+ Y++AIE+ P               L  +  A 
Sbjct: 7   EDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAY 66

Query: 148 NDAESAIKVNPTYSKGYSRLGFA 170
           ND   A+ ++    K Y R G A
Sbjct: 67  NDCNEALTLDSKNVKAYHRRGLA 89

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 8/136 (5%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKY 143
           A+DE+     E  K +GN  +  K++  A + YS+AIE+  T              L  +
Sbjct: 4   ASDEDVNKALE-FKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNF 62

Query: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD-----KATDI 198
             A+ND   AI+++P   K Y R G +     +   A    K VL  + +     +A D+
Sbjct: 63  QTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVATRALDV 122

Query: 199 MKRDYETAKKKVEQSL 214
            +R     K+K E+++
Sbjct: 123 CER--VIRKEKFEKAI 136

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 66/160 (41%), Gaps = 17/160 (10%)

Query: 82  DDAADEEQKAT------AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXX 135
           D+A    +KAT      A    L+G++      +++A   Y +A+ + P           
Sbjct: 455 DEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGM 514

Query: 136 XXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKA 195
               L +YD+A+   E A  +NP         G A    G+ E ALD Y+   +++ + +
Sbjct: 515 SCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSS 574

Query: 196 TDIMKR--------DYETAKKKVEQSLNLEKVTPKEAETE 227
             + K+         Y  A +  E+   LE++TP EA   
Sbjct: 575 LALFKKSQLLFNLGQYSNALQNFEK---LEQLTPNEAPVH 611

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D   +E+++  +  +K +GN+    K YE AIK YS A+  L                L 
Sbjct: 87  DSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLN 145

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
           K +  V D  +A+++ P YSK   R   A  + G   DA+
Sbjct: 146 KLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 13/142 (9%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEV----LPTXXXXXXXXXXXXSS 139
           A + E    A   K +GN     K ++ A   Y +A++V    L                
Sbjct: 61  AYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELE 120

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD------ 193
           +K Y   +N    A+K+N    K + R+G A    G+ ED+L+A +  L ++ +      
Sbjct: 121 IKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKS 180

Query: 194 ---KATDIMKRDYETAKKKVEQ 212
              KAT+ +KR  E   + + Q
Sbjct: 181 IQSKATEKLKRKKELENRTLAQ 202

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 5/102 (4%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEV-----LPTXXXXXXXXXXXXS 138
           A + E    AE  K +GN     K ++ A   Y + I++     +               
Sbjct: 67  AYEGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACEL 126

Query: 139 SLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
            LK +   +ND ++A+++NP   K Y R+  A FA  K+E+A
Sbjct: 127 ELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           GN     KD+E AIK + +A +V P             SS   +D A N    A+  +P 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 160 YSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +   Y  LG +    G+ ++AL  ++K   I
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 17/157 (10%)

Query: 82  DDAADEEQKAT------AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXX 135
           D+A    +KAT      A    L+G++      +++A   Y +A+ + P           
Sbjct: 474 DEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGM 533

Query: 136 XXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKA 195
               L +YD+A+   E A  +NP         G A    G+ E ALD Y+   +++ + +
Sbjct: 534 SCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSS 593

Query: 196 TDIMKR--------DYETAKKKVEQSLNLEKVTPKEA 224
             + K+         Y  A +  E+   LE++TP EA
Sbjct: 594 LALFKKSQLLFNLGQYSNALQNFEK---LEQLTPNEA 627

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D   DE+++  A GLK +GN+    K ++ AIK Y+ A+E L               S+ 
Sbjct: 91  DQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMG 149

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
           + +  V D  +A+K+   YSK   R   A  + G   DA+
Sbjct: 150 QLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAM 189

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 4/104 (3%)

Query: 78  VNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXX 137
           V++ +D   EE    A  LK +GN     KD+E+AIK Y+ A+  L              
Sbjct: 83  VDLLNDKTKEEW---AGALKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACY 138

Query: 138 SSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
           SSL  Y+  +  A  A+ + P YSK   R   A    G   DA+
Sbjct: 139 SSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAM 182

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY SA   + +A+                   + +Y DA++    AI++NP 
Sbjct: 365 GRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPY 424

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKK 186
            S+ +  LG   +    +V DALDAYK+
Sbjct: 425 ISEVWYDLGTLYETCNNQVNDALDAYKQ 452

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKY 143
           ++++++K  A  LK +GN     K +E AI+ Y+ AI+ L               SL   
Sbjct: 84  SSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDL 142

Query: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
           D  V  +  A+++ P YSK   R   A    G+ +DA+     VL + GD
Sbjct: 143 DKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 86  DEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDD 145
           +E+++  A  LK +GN+    + YE AIK Y  A++ L                L K + 
Sbjct: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEK 146

Query: 146 AVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
            V D  +A+K+ P YSK   R   A  + G   DA+
Sbjct: 147 VVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 6/141 (4%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K +GN+A   K Y +A   Y   IEV               ++    
Sbjct: 65  AYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELE 124

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKAT--D 197
           +K Y   +ND + A+  NP   K Y R+  A  A  K +++ ++ +  L ++   ++  +
Sbjct: 125 MKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLN 184

Query: 198 IMKRDYETAKKKVEQSLNLEK 218
           ++K   +  ++K    L LE+
Sbjct: 185 LLKTIIKKQEEKTAYRLKLER 205

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 44/106 (41%), Gaps = 1/106 (0%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           +++A A  LK +GN     K +  AIK Y  AIE+ P              S    D  V
Sbjct: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185

Query: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 12/87 (13%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVL----------- 188
           L++ D A   +   I + P   KGY R+G     QGK  +A   YKK L           
Sbjct: 84  LQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLLMSREMLQKFD 143

Query: 189 DIEGDKATDIMKRDYETAKKKV-EQSL 214
            +  +K  DI+K+  +  KK++  QSL
Sbjct: 144 IVVPEKFRDIIKQQRDIVKKRINNQSL 170

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 48/109 (44%), Gaps = 6/109 (5%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVL--PTXXXXXXXXXXXXSSLKKYD 144
           EE+   A  LK +GN+    K Y+ AIK Y+ A+E+   P               LKK  
Sbjct: 93  EEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKK-- 150

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
             V  +  A+++ P YSK   R   A    GK  DA+     VL + GD
Sbjct: 151 -VVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 42/101 (41%), Gaps = 4/101 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    A   K +GN     K Y+ A   YS+ IEV               ++    
Sbjct: 70  AYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELE 129

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
           L+ +   +ND + A+  N    K + R+G A F   K+E+A
Sbjct: 130 LRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           +++  A  LK +GN    +K+++ AIK Y  AIE+ P              S    +  V
Sbjct: 120 QRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVV 179

Query: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 180 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 44/106 (41%), Gaps = 1/106 (0%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           +++A A  LK  GN     K++  AIK Y  AIE+ P              S    +  +
Sbjct: 122 QRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVI 181

Query: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 182 EFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 45/103 (43%), Gaps = 2/103 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY +A   + +A+                   + +Y DA++    AI++NP 
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDIMKR 201
            S+ +  LG   +    ++ DALDAYK+   ++ +    I KR
Sbjct: 373 ISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENV-HIRKR 414

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ +     
Sbjct: 345 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVH-- 402

Query: 199 MKRDYETAKKKVEQSLNLEK 218
           ++   E   K++E   N+ K
Sbjct: 403 IRERLEALTKQLENPGNMNK 422

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +D  ++  ESA+KVNP     ++RLG +     + E+A+ AY + L +
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 521

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +D  ++  ESA+KVNP     ++RLG +     + E+A+ AY + L +
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +D  ++  ESA+KVNP     ++RLG +     + E+A+ AY + L +
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY +A   + +A+                   + +Y DA++    AI++NP 
Sbjct: 320 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 379

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKK 186
            S+ +  LG   +    ++ DALDAYK+
Sbjct: 380 ISEVWYDLGTLYETCNNQLSDALDAYKQ 407

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAY++   ++ D    I
Sbjct: 351 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYRQASRLDPDN-VHI 409

Query: 199 MKR 201
            KR
Sbjct: 410 KKR 412

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           ++ + E ++  A  LK  GN+    KDY++A+K Y+ A+ V+               SL 
Sbjct: 90  EELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLG 148

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSR 166
           + D  V ++  A+++ P YSK   R
Sbjct: 149 QLDKVVENSTKALELKPDYSKALLR 173

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K +GN+    K ++ A + Y++ I V               ++    
Sbjct: 74  AYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELE 133

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK Y   + D   A+ +NP   K Y R   A F+  K+E+A  A
Sbjct: 134 LKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 79  NIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXS 138
           N+A+  ++E++++ +  LK +GN+    KDY++A+K Y  A+  L               
Sbjct: 93  NVAE-MSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYV 150

Query: 139 SLKKYDDAVNDAESAIKVNPTYSKGYSR 166
           S+ + D  V ++  A+++ P YSK   R
Sbjct: 151 SMNQLDKVVENSTKALELKPDYSKALLR 178

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ +     
Sbjct: 343 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVH-- 400

Query: 199 MKRDYETAKKKVEQSLNLEK 218
           ++   E   K++E   N+ K
Sbjct: 401 IRERLEALTKQLENPGNINK 420

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G  +M   +YE A+  + +A  + P+              L   + A+N  E A ++ PT
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 160 YSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKAT 196
            S    +     ++  K   ALDA+++++ I  ++AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 110 ESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169
           E A+  Y  A ++ PT             S+ KY  A++  E  IK+ P  +     LG 
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQ 768

Query: 170 AKFAQGKVEDALDAYKKVLDIE---GDKATDIMKRDYE 204
                G+ +DA+  Y   ++++    +  +D +K+ +E
Sbjct: 769 LYQIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDA 146
           EE    A   K +GN  +  K Y  A++ YS+AIE+  T              L  +  A
Sbjct: 6   EEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTA 65

Query: 147 VNDAESAIKVNP-----TYSKGYSRLGFAKFAQGK 176
           + D   +I+++P      + +G S +G  +F++ +
Sbjct: 66  LEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKAR 100

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ +     
Sbjct: 337 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVH-- 394

Query: 199 MKRDYETAKKKVEQSLNLEK 218
           ++   E   K++E   N+ K
Sbjct: 395 IRERLEALTKQLENPGNINK 414

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY +A   + +A+                   + +Y DA++    AI++NP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIE 191
            S+ +  LG   +    ++ DALDAYK+ + ++
Sbjct: 379 ISEVWYDLGTLYETCNNQLSDALDAYKQAVRLD 411

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGD 193
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ D
Sbjct: 352 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPD 406

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 14/150 (9%)

Query: 45  EFERDSVKDTVKSAFNGNGLTSFLS------GSATNDIQVNIADDAADE-EQKATAEGLK 97
           EF+  S  D ++     N +  F+S      G    ++++      A E E    AE  K
Sbjct: 26  EFQNKSTDDVMEEL---NRMPFFMSKLDGTDGEGGQNVELEALKALAYEGEPHEVAENFK 82

Query: 98  LEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS----LKKYDDAVNDAESA 153
            +GN     K Y+ A + Y+  I++               ++    LK Y   VND + A
Sbjct: 83  NQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRA 142

Query: 154 IKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           ++ N    K Y R+  A     K+EDA  A
Sbjct: 143 LQYNVKNIKCYYRIAKAFLLLNKLEDAKQA 172

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 89  QKATAEGLKL--EGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDA 146
           Q+A  + L+   +GN  +  K Y+ A++ YS+AIE+  T              L  +  A
Sbjct: 4   QEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTA 63

Query: 147 VNDAESAIKVNP-----TYSKGYSRLGFAKFAQGK 176
             D + AI ++P      + +G S +G  +F + +
Sbjct: 64  QEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKAR 98

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKV--LDIEG 192
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   LD E 
Sbjct: 332 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN 387

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ +    I
Sbjct: 345 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDPEN-IHI 403

Query: 199 MKRDYETAKKKVE 211
            KR  ET   ++E
Sbjct: 404 RKR-LETLTAQLE 415

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           +++  A  LK +GN    TK++  AIK Y  AIE+ P              S    +  +
Sbjct: 119 QKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVL 178

Query: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 179 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKV--LDI 190
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   LD+
Sbjct: 347 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDV 400

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ +    I
Sbjct: 358 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPEN-IHI 416

Query: 199 MKR 201
            KR
Sbjct: 417 RKR 419

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +D  ++  ESA++VNP     ++RLG +     + E+A+ AY + L +
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K +GN+    K ++ A + YS+ + V               ++    
Sbjct: 74  AYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELE 133

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK Y   + D   A+ +NP   K Y R   A F   K+E+A  A
Sbjct: 134 LKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAV 147
           E+   A  LK  GN     KDYE+AI  Y  A++ L               SL+   +A+
Sbjct: 81  EKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAI 139

Query: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
                A+++NP YSK   +        GK  DAL
Sbjct: 140 EACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDI 198
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   ++ +    I
Sbjct: 362 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN-IHI 420

Query: 199 MKR 201
            KR
Sbjct: 421 RKR 423

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 6/109 (5%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVL--PTXXXXXXXXXXXXSSLKKYD 144
           EE+   A  LK +GN+    K Y+ AIK Y+ A+E+   P               LKK  
Sbjct: 93  EEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKK-- 150

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
             V  +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 151 -VVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>TDEL0F03260 Chr6 (599690..607144) [7455 bp, 2484 aa] {ON} Anc_3.443
            YPR117W
          Length = 2484

 Score = 34.3 bits (77), Expect = 0.54,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 1    MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60
            +AA  K+I  ++V +L  ++  K V     + L  +MD I+   + + + ++ T  S   
Sbjct: 2391 LAALKKDITKVVVQHLGQIIGNKLVPHKKENRLKASMD-ISHLLKSDSNGLQSTTSSIHR 2449

Query: 61   GNGLTSFLSGSATNDIQVNIADDAADEE 88
                 SF+S    ++  VN   D ADE+
Sbjct: 2450 KKSQYSFMS----SNFSVNSPSDDADED 2473

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 6/109 (5%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVL--PTXXXXXXXXXXXXSSLKKYD 144
           EE+   A  LK +GN+    K Y+ AIK Y+ A+E+   P               LKK  
Sbjct: 93  EEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKK-- 150

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
             V  +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 151 -VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 85  ADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYD 144
           AD++ K   E LK +GN+    KDYE+A+K Y  A+ +L               SL + D
Sbjct: 101 ADQKDKWAIE-LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELD 158

Query: 145 DAVNDAESAIKVNPTYSKGYSR 166
             +  +  A+++ P YSK   R
Sbjct: 159 KVIEMSTKALELKPDYSKALLR 180

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY +A   + +A+                   + +Y DA++    AI++NP 
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 374

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKK 186
            S+ +  LG   +    ++ DALDAYK+
Sbjct: 375 ISEVWYDLGTLYETCNNQLTDALDAYKQ 402

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 48/113 (42%), Gaps = 6/113 (5%)

Query: 83  DAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVL--PTXXXXXXXXXXXXSSL 140
           D   EE+   A  LK +GN+    K Y+ AIK Y+ A+E+   P               L
Sbjct: 89  DFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDL 148

Query: 141 KKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193
           KK    V  +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 149 KK---VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKK 186
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+
Sbjct: 363 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQ 410

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKKV--LDIE 191
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+   LD E
Sbjct: 351 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPE 405

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    A   K +GN     K +  A + Y++AI+V               ++    
Sbjct: 65  AYEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELE 124

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK Y   +ND + A+ +NP   K Y R+  A  A  K +D  +A
Sbjct: 125 LKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEA 168

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLG-FAKFAQGKVEDALDAYKK 186
           + +Y DA++    AI++NP  S+ +  LG   +    ++ DALDAYK+
Sbjct: 323 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQ 370

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDK 194
           D++   +SA++V+P   + +  LG A FA G+VE ++  ++K +++  D 
Sbjct: 702 DSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDH 751

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 1/88 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY +A   +  A+                   + +Y DA++    AI++NP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKK 186
            S+ +  LG   +    ++ DALDAYK+
Sbjct: 379 ISEVWYDLGTLYETCNNQLTDALDAYKQ 406

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 33/51 (64%)

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKA 195
           +++   +SA++V+P+  + +  LG A +A G+VE ++  ++K L++E   A
Sbjct: 698 ESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSA 748

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 4/101 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    AE  K +GN+    K ++ A + Y++ + V               ++    
Sbjct: 74  AYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELE 133

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
           LK Y   V D   A+ +NP   K Y R+  + F   K+E+A
Sbjct: 134 LKNYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 56/131 (42%), Gaps = 14/131 (10%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   MA KD+ +A +   +A+                   + +  DA++    AI++NP 
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPY 480

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEK 218
            S+ +  LG   +    ++ DALD+Y++ L ++ +                ++  LN  K
Sbjct: 481 ISEVWYNLGTLYETCNDQITDALDSYERALSLDPENPV-------------IQGRLNALK 527

Query: 219 VTPKEAETESN 229
           +  K++E + N
Sbjct: 528 IQDKKSEYDPN 538

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 4/101 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEV----LPTXXXXXXXXXXXXSS 139
           A + E    A   K +GN     K ++ A + Y++ IE+                     
Sbjct: 69  AYEGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELE 128

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDA 180
           +K Y   +ND ++A++ NP   K Y R+G A  A   +E+A
Sbjct: 129 IKNYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEA 169

>Smik_1.60 Chr1 complement(120699..121346) [648 bp, 215 aa] {ON}
           YAL007C (REAL)
          Length = 215

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 22/38 (57%)

Query: 194 KATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNAD 231
           K T     +Y TA KKVE +L  EK   +EAETE N D
Sbjct: 101 KYTFCFSNNYGTALKKVEVTLEKEKTLTEEAETEVNND 138

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D   +EE++  +  LK +GN       +E AIK Y+ AIE L               SL 
Sbjct: 100 DQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLN 158

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAY--KKVLDIEGD 193
           K ++ +     A+++ P YSK   R      A  K+E+  DA     VL + GD
Sbjct: 159 KLEEIIKYCNKALELKPDYSKVLLRRA---NANEKLENYADAMFDLSVLSLNGD 209

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 9/99 (9%)

Query: 87  EEQKAT----AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKK 142
           EE KA     A  LK EGNK +  K Y  A + Y++AIE  P               L  
Sbjct: 3   EEVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDN 62

Query: 143 YDDAVNDAESAIKVNPTYSKGYSR-----LGFAKFAQGK 176
           +  +++DA+ AI+++    K Y R     +G  +F + +
Sbjct: 63  FQSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKAR 101

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 43/104 (41%), Gaps = 4/104 (3%)

Query: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSS---- 139
           A + E    A G K +GN+    K ++ A + Y + + V               ++    
Sbjct: 74  AYEGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELE 133

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDA 183
           LK Y   + D   A+ +NP  +K Y R   A F   K+E+A  A
Sbjct: 134 LKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSA 177

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           ++D  ++  ++A+KVNP     ++RLG +     + E+A+ AY + L +
Sbjct: 439 EFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 487

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 36/88 (40%)

Query: 67  FLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTX 126
           F+  S   +    +      E    TAE LK++GN      DYE+AI  Y +A  +  + 
Sbjct: 15  FIKYSYIYEYDAKVGRRIVLESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSN 74

Query: 127 XXXXXXXXXXXSSLKKYDDAVNDAESAI 154
                        L+++ +AVN  +  +
Sbjct: 75  PIYFSNMATALIKLERWQEAVNACDKGL 102

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 62/154 (40%), Gaps = 31/154 (20%)

Query: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAI----EVLP--------------TXXXX 129
           E    A  +K  G +    KD++ A  KY +A+    E +P                   
Sbjct: 274 ESYKAANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKL 333

Query: 130 XXXXXXXXSSLKKYDDAVNDAESAIKVN--PTY--SKGYSRLGFAKFAQGKVEDALDAYK 185
                    +LKKYD A+  A   +++   PT   +K Y R G    A+ ++E+AL  YK
Sbjct: 334 YLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

Query: 186 ---------KVLDIEGDKATDIMKRDYETAKKKV 210
                    KV+D + +   ++++   E  +K +
Sbjct: 394 NCKENNPDDKVIDQKIESVENLLEERKEKTRKNI 427

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           GN     KD+++AIK + +A ++ P             SS    D A      A+  +P 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 160 YSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +   Y  LG +    G+ E+AL  ++K   I
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           GN     KD+++AIK + +A ++ P             SS    D A      A+  +P 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 160 YSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +   Y  LG +    G+ E+AL  ++K   I
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 76/155 (49%), Gaps = 29/155 (18%)

Query: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXX--XXSSLK--K 142
           E ++ + E  K +G  +  T DY +A + Y +++  LP                 LK  +
Sbjct: 319 ELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGE 378

Query: 143 YDDAVNDAESAIKVNP---------------TYSKGYSRLGFAK-FAQGKVED---ALDA 183
           Y +A++DA SA+K+ P               TY + +S++   K  A  +VE+   AL+ 
Sbjct: 379 YREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALET 438

Query: 184 YKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEK 218
           Y+++++  G  ++ +++     A+++ ++++ LEK
Sbjct: 439 YQQLIEA-GVTSSKVLE-----ARRQCQKAIALEK 467

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           GN     KD+++AIK + +A ++ P             SS    D A      A+  +P 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 160 YSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +   Y  LG +    G+ E+AL  ++K   I
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           +D  +   + ++K+NP     ++RLG +     K EDA+ AY + L++
Sbjct: 447 FDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

>KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 924

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%)

Query: 106 TKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYS 165
           TKDY + +K  +E++ + P                 K D A       + ++ T+S  +S
Sbjct: 635 TKDYNACLKHLNESLSLYPLAFDTWYFYGCIGLECGKTDLAAEAFTRCVSLDDTHSLSWS 694

Query: 166 RLGFAKFAQGKVEDALDAYKKVL 188
            L  A   QGK+++A     K +
Sbjct: 695 NLSAAYIEQGKLKEAHSCLSKAI 717

>TDEL0E05490 Chr5 (1005955..1007277) [1323 bp, 440 aa] {ON}
           Anc_6.240 YGL138C
          Length = 440

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 156 VNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSL 214
             PT  +  +RLG A   QGKV+       +  DIE DK   I   DY + KK ++ SL
Sbjct: 79  FRPTSLRSETRLGVAFCGQGKVQWQTSTQLQD-DIEWDKPFCIYNPDYGSQKKAIKASL 136

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 28/42 (66%)

Query: 151 ESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEG 192
           +SAI+V+P   + +  LG A  A G++E ++  ++K ++++G
Sbjct: 693 QSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDG 734

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 11/85 (12%)

Query: 146 AVNDAESAIKVNPTYSKGYSRLG--FAKFAQGKVEDALDAYKKVL-------DIEGDKAT 196
           A+ DA+  IKV+    KGY R G    K AQ K  +AL  Y++ L        +  +K  
Sbjct: 89  ALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EALYVYREGLSKAKEAYQLHFEKPP 146

Query: 197 DIMKRDYETAKKKVEQSLNLEKVTP 221
                  E  K +V + LNL+K+TP
Sbjct: 147 SKFVEIVEHQKNEVIKRLNLQKLTP 171

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 31.6 bits (70), Expect = 3.4,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           G   M   DY +A   + +A+                   + +Y DA++    AI++NP 
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 444

Query: 160 YSKGYSRLG-FAKFAQGKVEDALDAYKK 186
            S+ +  LG   +    ++ DALDAYK+
Sbjct: 445 ISEVWYDLGTLYETCNNQLNDALDAYKQ 472

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 11/83 (13%)

Query: 140 LKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD------ 193
           L K D A+ DA   I V+    KGY R G      G+ E+AL  Y+  L   G+      
Sbjct: 83  LNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQVYENGLKQAGEAEKTHA 142

Query: 194 -----KATDIMKRDYETAKKKVE 211
                K  DI+ R   T K+ ++
Sbjct: 143 IHAPQKFLDIVYRQRSTIKELLQ 165

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%)

Query: 100 GNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPT 159
           GN     KD++ AI  + +AI++ P             S+   +D+A +    A+ +  T
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 160 YSKGYSRLGFAKFAQGKVEDALDAYKK 186
           +      LG      GK E+AL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 29/47 (61%)

Query: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIE 191
           ++V    SA++V+P   + +  LG A FA G+VE +   ++K ++I+
Sbjct: 703 ESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEID 749

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 93  AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDDAVNDAES 152
           A+ LK +GN+   +KD E+AIK Y  A+  L               ++ + D  +  +  
Sbjct: 158 AKELKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNK 216

Query: 153 AIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181
           A+++ P YSK   R   A  A G  ++AL
Sbjct: 217 ALELKPDYSKALLRRANAYEALGNNKEAL 245

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 29/49 (59%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIE 191
           +D  +   ++A+K+NP     ++RLG +     + E+A+ AY K ++++
Sbjct: 457 FDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           ++D  ++  ++A+KV+P     ++RLG +     + E+A+ AY K L++
Sbjct: 465 EFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNL 513

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           YD  V+   +A+ V P     ++RLG +     + E+A+ AY+K L +
Sbjct: 442 YDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 489

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLK 141
           D  +DE ++  A  LK +GN     +D+E+A+K Y+ A+  L               SL 
Sbjct: 94  DSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLG 152

Query: 142 KYDDAVNDAESAIKVNPTYSKGYSR 166
           + +  V  +  A+K+   YSK   R
Sbjct: 153 QLEKVVESSTEALKLKHDYSKALLR 177

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 87  EEQKAT-AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTXXXXXXXXXXXXSSLKKYDD 145
           EEQK T +  LK +GN+    + YE A+K Y+ A++ L               SL   + 
Sbjct: 92  EEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEK 150

Query: 146 AVNDAESAIKVNPTYSKGYSR 166
            V  +  A+++ P YSK   R
Sbjct: 151 VVESSTKALELKPDYSKALLR 171

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 143 YDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI 190
           YD  V+   +A+ V P     ++RLG +     + E+A+ AY+K L +
Sbjct: 435 YDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 96  LKLEGNKAMATKDYESAIKKYSEAIEVLP 124
            K EGN+     +Y SAIK Y + IE+ P
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINP 34

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 48/125 (38%)

Query: 66  SFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPT 125
           S L     + I++ +  +   +E K   +     GN     KD++ AIK + +  ++ PT
Sbjct: 538 STLLWHLHDKIKLTVLSNELLKEFKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPT 597

Query: 126 XXXXXXXXXXXXSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYK 185
                        S   +D A N    A+  +  +   Y  +G      G+ E AL  ++
Sbjct: 598 FTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFE 657

Query: 186 KVLDI 190
           K   I
Sbjct: 658 KARSI 662

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,723,930
Number of extensions: 1080152
Number of successful extensions: 4434
Number of sequences better than 10.0: 211
Number of HSP's gapped: 4392
Number of HSP's successfully gapped: 282
Length of query: 338
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 228
Effective length of database: 40,868,139
Effective search space: 9317935692
Effective search space used: 9317935692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)