Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003306.20ON1107110758230.0
ZYRO0C07810g6.20ON1099110915940.0
Kpol_1037.256.20ON1105110815770.0
Skud_13.1526.20ON1090110615170.0
Suva_13.1606.20ON1090110315020.0
TDEL0G044906.20ON1093112314700.0
Smik_13.1576.20ON1090110414670.0
Sklu_YGOB_Anc_6.20b6.20ON1088111314410.0
ACR006C6.20ON1071112413031e-161
Ecym_30246.20ON1079112412911e-159
Sklu_YGOB_Anc_6.20singletonOFF84987012691e-158
NCAS0H008206.20ON1146113112301e-149
CAGL0L07634g6.20ON1130111411961e-144
KLTH0C11242g6.20ON1097112211691e-141
KLLA0D01133g6.20ON1067112211651e-141
Kwal_56.224246.20ON1089111211071e-132
YML002W6.20ON73772310221e-123
KNAG0M011606.20ON1131113410221e-120
NDAI0D008006.20ON119311839751e-112
TBLA0A072606.20ON120411929051e-103
KAFR0L004006.20ON9428445344e-55
YML003WsingletonOFF2902913984e-42
ZYRO0E00528g7.548ON36990870.10
KAFR0B005307.510ON898128810.71
Kwal_47.182025.323ON21264780.88
TBLA0E006103.440ON27071790.89
Skud_4.5485.296ON87776791.3
Suva_2.4515.296ON87795791.4
Suva_10.2957.352ON11474721.7
Ecym_33832.341ON74277772.0
NDAI0H008705.623ON31443735.0
CAGL0F04389g3.325ON1006108736.4
CAGL0A00473g4.114ON786108736.7
KAFR0H011003.325ON1011112737.0
TBLA0F004507.448ON48241728.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00330
         (1107 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...  2247   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   618   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   612   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   588   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   583   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   570   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   569   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   559   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   506   e-161
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   501   e-159
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   493   e-158
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   478   e-149
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   465   e-144
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   454   e-141
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   453   e-141
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   431   e-132
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   398   e-123
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   398   e-120
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   380   e-112
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   353   e-103
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   210   4e-55
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   157   4e-42
ZYRO0E00528g Chr5 complement(32878..33987) [1110 bp, 369 aa] {ON...    38   0.10 
KAFR0B00530 Chr2 complement(108516..111212) [2697 bp, 898 aa] {O...    36   0.71 
Kwal_47.18202 s47 complement(731252..731890) [639 bp, 212 aa] {O...    35   0.88 
TBLA0E00610 Chr5 complement(120051..120863) [813 bp, 270 aa] {ON...    35   0.89 
Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W ...    35   1.3  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    35   1.4  
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...    32   1.7  
Ecym_3383 Chr3 complement(726214..728388,728450..728491,728584.....    34   2.0  
NDAI0H00870 Chr8 complement(195210..196154) [945 bp, 314 aa] {ON...    33   5.0  
CAGL0F04389g Chr6 complement(437622..440642) [3021 bp, 1006 aa] ...    33   6.4  
CAGL0A00473g Chr1 complement(51137..53497) [2361 bp, 786 aa] {ON...    33   6.7  
KAFR0H01100 Chr8 (199377..202412) [3036 bp, 1011 aa] {ON} Anc_3....    33   7.0  
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    32   8.6  

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score = 2247 bits (5823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1107/1107 (100%), Positives = 1107/1107 (100%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGY 120
            FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGY
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGY 120

Query: 121  FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHS 180
            FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHS
Sbjct: 121  FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHS 180

Query: 181  QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDI 240
            QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDI
Sbjct: 181  QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDI 240

Query: 241  VNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLD 300
            VNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLD
Sbjct: 241  VNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLD 300

Query: 301  MLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKN 360
            MLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKN
Sbjct: 301  MLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKN 360

Query: 361  SDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALG 420
            SDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALG
Sbjct: 361  SDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALG 420

Query: 421  YTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRT 480
            YTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRT
Sbjct: 421  YTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRT 480

Query: 481  QYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAE 540
            QYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAE
Sbjct: 481  QYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAE 540

Query: 541  ILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGRTAL 600
            ILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGRTAL
Sbjct: 541  ILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGRTAL 600

Query: 601  FTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLK 660
            FTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLK
Sbjct: 601  FTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLK 660

Query: 661  FEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTV 720
            FEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTV
Sbjct: 661  FEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTV 720

Query: 721  FNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYYNLINAMQ 780
            FNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYYNLINAMQ
Sbjct: 721  FNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYYNLINAMQ 780

Query: 781  KIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLL 840
            KIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLL
Sbjct: 781  KIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLL 840

Query: 841  DENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK 900
            DENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK
Sbjct: 841  DENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK 900

Query: 901  LSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVYYELSQDILF 960
            LSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVYYELSQDILF
Sbjct: 901  LSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVYYELSQDILF 960

Query: 961  MKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENTSVFRY 1020
            MKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENTSVFRY
Sbjct: 961  MKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENTSVFRY 1020

Query: 1021 AWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVR 1080
            AWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVR
Sbjct: 1021 AWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVR 1080

Query: 1081 KFVSLNLAHLKEQSNLVQRIAMKLNTK 1107
            KFVSLNLAHLKEQSNLVQRIAMKLNTK
Sbjct: 1081 KFVSLNLAHLKEQSNLVQRIAMKLNTK 1107

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1109 (34%), Positives = 611/1109 (55%), Gaps = 49/1109 (4%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            MAY +PVL NPL+N+VFNC +P  S FKKL+ +L+ + F+LLVP    LLY+ D+ S  S
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSL--CIPIK 118
              +LC  YDFVA+HIL+L +++ +D     N        K+LN K V +R S    +  +
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSD--GGFNLSASQTEYKTLNDKRVAVRSSSGEILTTE 118

Query: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPF 178
            G+  +R++++++  L+TNFNDYL+GS  F ++HID+PL  +    ID  +G  +      
Sbjct: 119  GFPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQG----- 173

Query: 179  HSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFH 238
            +    D  G L R    K+    F  + +   DW+  L  Y  +Y++    +    ELF 
Sbjct: 174  NFNGVDAKGSLVRDLTQKS-WSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFR 232

Query: 239  DIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLS 298
             IV  ++  +  ++ F++  +LYD+ ++Y+E  L+ D+W ++   YR   +D   +  LS
Sbjct: 233  MIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLS 292

Query: 299  LDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITG 358
            ++ L+T  Y + ++ F+L D+  ME  +  A++ F G+   +++++K D +  TL  ++ 
Sbjct: 293  INELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSN 352

Query: 359  KNSDDTIRDNTLPKLPL-IDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFG 417
                D      +  LP+ +DADTL+S F L++CR  V+++  H+ YL+ F KDEN++KFG
Sbjct: 353  TREQDM----DIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFG 408

Query: 418  ALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLED---------FLIKIRSQHDDLIP 468
             LGY +ST+EA + YF  L  +       +KL  L+D          LI  +S    ++ 
Sbjct: 409  ILGYAISTLEAVVFYFDGLKGT-------KKLQKLQDDSNKAKELYILISDKSTGQAVLD 461

Query: 469  INQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLI 528
            I+QF+    +RT  GES+LS  I N KN  L E L N+EDIFPL+D+L D  V GSTLLI
Sbjct: 462  ISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLI 521

Query: 529  KCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYIN 588
            + LK  N EAA++++E+ QNSCT  EL  Y N+ DK +RT+AHY+T E+ ILE IGKYIN
Sbjct: 522  QALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYIN 581

Query: 589  WTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLL 648
            W  +D  G T LFTIFR YDQ  Y + I  A   A+ WY+ N   F+ SDH D  G++LL
Sbjct: 582  WKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLL 641

Query: 649  HILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKY 708
            HI+K+ VS+LL ++++DIN  N KG+TPLM Y +YNR DN+KTI+ D R+I+ KLQ   +
Sbjct: 642  HIIKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSF 701

Query: 709  LNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQ---KDDLEYTTN 765
            LN  DY +N  V   L ++  K   FE A++ + +YE   W+  I+V+     D EY T 
Sbjct: 702  LNSFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTV 761

Query: 766  IIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGL 825
             + +K   NL   + K++ + F+P    L+ L  + +   +  I +L+   +   L+   
Sbjct: 762  KLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSR-MPSIAKLETLYFFYMLTDCF 820

Query: 826  SALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSF---KPLSAEDINNIKAFCD 882
              LL  + ++ L +L E+ ++ WI S    Q+K  ++       K +  E+I  + +F  
Sbjct: 821  DVLLRHDNLNKL-VLRESRLVSWIRS----QDKKCNNSKKLQKQKNVEPEEIGIMASFLR 875

Query: 883  FSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSIS 942
            F+  E+      + +  KL IF ++KNTDL  SY  L   G+ ++  +      DL+ I+
Sbjct: 876  FNRGELSAVKLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLE-IN 934

Query: 943  PHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFL 1002
                         ++I F++ CT  L  ++   +   +  W K    +LE  K Y  KF 
Sbjct: 935  CCAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFP 994

Query: 1003 QSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEE 1062
              +          S F        R++ E +L   + + ++ ++++G  I   HE LAEE
Sbjct: 995  NISRNDSGTGIIASFFE-----GKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEE 1049

Query: 1063 FSDYVRMKSKFNSNLLVRKFVSLNLAHLK 1091
             S Y+  KS F  N ++R+ V  N+  LK
Sbjct: 1050 LSKYMEFKSNFFINGILRRAVRENINILK 1078

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/1108 (34%), Positives = 627/1108 (56%), Gaps = 36/1108 (3%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            ++Y MPVL NPLINAVFNCPDP  SP +KL+  ++ K+F+L+VP + ILL+Y+D    ++
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   FRELCYTYDFVAAHILILDKNSSTD---KISSSNQKNGDVYLKSLNGKEVLLRQSLCIPI 117
             +ELCY ++FVA+HI++   NSS +   K  +SN+   + Y KSLN  ++L++ +  IP+
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRY-KSLNNNQLLIKNNNIIPL 122

Query: 118  KGYFSKRKSQMRDATL--LTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF----E 171
                S +K + +   +  L NFN+YL GS  + I++ DYP   S W    E++ F    +
Sbjct: 123  DFNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNS-WLPKIEIESFYISKK 181

Query: 172  ESRELPFHSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQN 231
            ES  +        K  L Q   +    +  F  +    K+W    + Y+  ++  +    
Sbjct: 182  ESNNIKAAQITNHKSPLSQDLAQ--KTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLT 239

Query: 232  IGSELFHDIVNMIYNTLKEEQRFQRFTN-LYDIAYEYIESLLYQDIWNKLQEHYRD-KIL 289
                 F +IV+  Y  +K E+ F  F N LY++ +EY+ES  Y  IW+ +  +  D + L
Sbjct: 240  SLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFL 299

Query: 290  DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVI 349
               ++  LS+D L+   YN+ F+ F L++++ +E C+  A   FK I  + S+S+K  ++
Sbjct: 300  HTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQIL 359

Query: 350  FKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK 409
               L  +T   S D +    L    ++DADTL++LF L++CR+ V  +  H+ YLQ+F  
Sbjct: 360  IDALQKLT---SYDDVHYEPL----MVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFST 412

Query: 410  DENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD-DLIP 468
            DEN VKFG LGY +ST EATL Y  +    ++   Q+      ++ + KI S+ D     
Sbjct: 413  DENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQ 472

Query: 469  INQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLI 528
            +  +KD F++R + GESIL+L I +KKNE L E LLNFED+FPL+D+L D D+ G+TLL+
Sbjct: 473  VKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLM 532

Query: 529  KCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYIN 588
            K LK  N   A++++++ Q+SC+  EL+ Y+N+TD  +R  AHYIT++I++L++IG + N
Sbjct: 533  KALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFN 592

Query: 589  WTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLL 648
            W +KD KG T L TI R+YDQ  Y   I+ A  +A  WY+N +      DH D   ++LL
Sbjct: 593  WKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLL 652

Query: 649  HILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKY 708
            HILK  + +LLK+++++IN  NLK +TPLMTYVKYNR+ NI+ I+ D RLI+ K QK  +
Sbjct: 653  HILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTF 712

Query: 709  LNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYA-RYEKSHWYLCISVQKDDLE-YTTNI 766
            L+C D+ KN  +F  L  +  ++ +F N + +Y+ R E S+W L  + +  + + Y T  
Sbjct: 713  LDCYDFVKNTIIFEDLGVRSVRNSMF-NLFSAYSLRVENSNWVLYFTFKDTNQDSYITKS 771

Query: 767  IKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLS 826
            + LK  +N+I    K+Y   FIP+ ++L  L  I++ +    I++LK + +LN +S+   
Sbjct: 772  VSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFG 831

Query: 827  ALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQ 886
             L+  +  D     +   + KWI +  ++ +K     + +K ++ +DIN IK+F  F+  
Sbjct: 832  TLIETDDFDTELFKNPESLTKWIKAGKRKHKKE----NYYKRMTLDDINMIKSFVQFNIN 887

Query: 887  EIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQS-ISPHV 945
            E+GK N  +    KL  F  +K  D+N SY +    G+     +IS  +  +   I P  
Sbjct: 888  ELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKY 947

Query: 946  HSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSN 1005
              S+    L Q I F++ CT+ ++      IK+ +  W   +  L   +K+Y   F   +
Sbjct: 948  FQSIFLILLDQ-ISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFD 1006

Query: 1006 EETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSD 1065
               G L+EN  + RY  N   R+  E+R+   ++E      K+   I   HE LAEEF+ 
Sbjct: 1007 SRNG-LNENI-LSRYTKNK--REAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNK 1062

Query: 1066 YVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093
            ++  KS+F  ++++   +   +A LK+Q
Sbjct: 1063 FLTFKSRFFKDVILNMIIPSAIATLKDQ 1090

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/1106 (32%), Positives = 612/1106 (55%), Gaps = 35/1106 (3%)

Query: 2    AYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISF 61
             Y +P L NPLINA+FNCP+P  SP KKL+  L+ + F+LL P    LL Y D  + +  
Sbjct: 3    VYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPL 62

Query: 62   RELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKG 119
             ELCY  DF+ +HIL+  +NS        N    D + ++L+GK V++  + ++   + G
Sbjct: 63   HELCYNVDFINSHILLTTENSYL------NTTLRDSHYETLDGKAVVIQWKNNIIHALNG 116

Query: 120  YFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFH 179
            +  +++ ++ +  +L NFNDY  G+  F I+ ID PL   +    D LK F+   E+P +
Sbjct: 117  FPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNC-EVAPNDYLKCFDSYEEVPKN 175

Query: 180  SQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHD 239
            +Q      +    +E    R  F  +         +L +    Y+ + P  +   ++F D
Sbjct: 176  AQSVSNLPVNSYEQE----RSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFED 231

Query: 240  IVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSL 299
            IV   ++ +K +  F+ F+NLYD+ ++Y E  LY DIW++L  H++   +D       S+
Sbjct: 232  IVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSV 291

Query: 300  DMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGK 359
            + L   F+++ FK F+L DI  +E  +  A   F+ +   +SY++K  ++ +TL  ++G 
Sbjct: 292  NQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGP 351

Query: 360  ---NSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKF 416
               +S      N L  L + DADTL+SLF L++CR+  + +  H+ YLQ+F  + ++ KF
Sbjct: 352  TEISSHQQELPNGLNSLTM-DADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKF 410

Query: 417  GALGYTLSTIEATLSYFYELSNSDE----SRIQLQKLSLLEDFLIKIRSQH--DDLIPIN 470
            G LGY +ST+EA + YF +   ++E    + +  QK   L D   K+ S++  +++  + 
Sbjct: 411  GILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLD---KLSSENPTNEIENLA 467

Query: 471  QFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKC 530
             ++D  +YR + G+SILS+ I N KN  L + L  +ED+FP++D+L D  + GSTLLI+ 
Sbjct: 468  TYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIES 527

Query: 531  LKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWT 590
            +K  N+EAA+ILI I   +C+  EL++Y NK DK  RT+AHY+T E++IL+ IG Y++W 
Sbjct: 528  IKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWK 587

Query: 591  LKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHI 650
             K+  G+T LF+IFR+YDQ  Y   +KIA + A  WY+ ++  F   DHTD  G+SLLHI
Sbjct: 588  RKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHI 647

Query: 651  LKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLN 710
            LKS VS+LL+   LDIN  N KG+TPLM YVKY RI NI  I +D RLI++K+Q   +  
Sbjct: 648  LKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFT 707

Query: 711  CLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKD-DLEYTTNIIKL 769
            C DY K+ +V + +  + ++D +F   Y+   RY   +    I+   + D  + T +I +
Sbjct: 708  CFDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINM 767

Query: 770  KKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALL 829
            K    L+ ++ K  +  F+P +  +D +  +    ++  I +  +++ L+ L++  + LL
Sbjct: 768  KTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRS-DLTIIGKADVRSLLHKLTNCFNVLL 826

Query: 830  YFEKIDPLTLLDENLIIKWI---SSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQ 886
            + +K+      DE  ++ W+   +SK  Q+  S D+  + +P   E+IN I++F  F+F 
Sbjct: 827  FLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEP---EEINMIQSFLRFNFD 883

Query: 887  EIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVH 946
            EI      +    K+ IF  +K+ D   +YD L  +G    N E +     + + + ++ 
Sbjct: 884  EISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFT-NHNMF 942

Query: 947  SSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNE 1006
            S +   EL + + F+++CT+ L++ + + + DK++ W K   + L  +K Y   F    +
Sbjct: 943  SDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVK 1002

Query: 1007 ETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDY 1066
                    + +   ++  T R++ E+RL   +    + LK+LG+EI   HE+LAEE S+Y
Sbjct: 1003 PKSATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNY 1062

Query: 1067 VRMKSKFNSNLLVRKFVSLNLAHLKE 1092
            +  +        +  F + N+   +E
Sbjct: 1063 MEFRKACLDQRTIVAFATTNIGIFQE 1088

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/1103 (32%), Positives = 613/1103 (55%), Gaps = 31/1103 (2%)

Query: 3    YFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFR 62
            Y +P L NPLINA+FNCP+P  SP KKL+  L+ + F+LL P   +LL Y D  + +   
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   ELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKGY 120
            ELCY  DF+ +HIL+  +NS        N    D + ++L+GK V++  + ++   + G+
Sbjct: 64   ELCYNADFINSHILLTTENSYI------NTTLRDDHYETLDGKTVVVQWKNNVIHTLNGF 117

Query: 121  FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHS 180
              +R+ ++ D  +L NFNDY  G+ +F I++ID PLG  ++   D L  F    E     
Sbjct: 118  PLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGC-EFVPNDYLHCFNSYEETS--K 174

Query: 181  QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDI 240
              ++ P LL  T +   +R  F  +      W  +L +    Y+      +   ++F ++
Sbjct: 175  TARNAPNLLMDTSQ--LERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEEL 232

Query: 241  VNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLD 300
            V   ++ +K +  F+ F+NLYD+ ++Y E  LY+DIW++L  H++   ++       S++
Sbjct: 233  VEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVN 292

Query: 301  MLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGK- 359
             L T +Y++ F++F+L DI  +E  +  A   F+ +  ++SY++K  ++ +TL  ++G  
Sbjct: 293  QLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTT 352

Query: 360  --NSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFG 417
               S      N    L + DADTL+SLF L++CR+  + +  H+ YLQ+F  + ++ KFG
Sbjct: 353  DMGSHKPDLSNGFNNLTM-DADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFG 411

Query: 418  ALGYTLSTIEATLSYFYELSNSDESRIQLQKLSL-LEDFLIKIRSQH--DDLIPINQFKD 474
             LGY +ST+EA + YF   + ++ +  +   L +   D L K+  ++  +++  +  +KD
Sbjct: 412  ILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKD 471

Query: 475  YFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKER 534
               YR + G+SILSL I N KN+ L + L  +E +FP++D+L D  + GSTLLI+ +K  
Sbjct: 472  ILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVG 531

Query: 535  NLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDL 594
            NLEA +ILI I   +CT+ EL+ Y NKTDK  R++AHY+T E++IL+ IG YINW  K+ 
Sbjct: 532  NLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS 591

Query: 595  KGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQ 654
             G+T LF+IFRSYDQ  Y   +K+A + A  WY+ ++  F  SDHTD  G+SLLH+LK+ 
Sbjct: 592  SGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTD 651

Query: 655  VSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDY 714
            VS+LL+   L+IN  N KG+TPLM YVKY R+ NI  I +D RLI++K+Q   +  C DY
Sbjct: 652  VSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDY 711

Query: 715  GKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCI-SVQKDDLEYTTNIIKLKKYY 773
             K+  V + +  + + D IF   Y+   RY   +  + + SV K +  + T +I +K   
Sbjct: 712  AKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQ 771

Query: 774  NLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEK 833
             L+ ++ K     F+P  + +D +  +    ++  I +  +++ L+ L++  + LL+ +K
Sbjct: 772  GLLRSIVKDNPFTFLPIDNYIDGISHLNRS-DLTIIGKADVRSLLHKLTNCFNVLLFLKK 830

Query: 834  IDPLTLLDENLIIKWI---SSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGK 890
            +      DE  ++ W+   +S+  Q+  S D+  + +P   E+IN I++F  F+F EI  
Sbjct: 831  VPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEP---EEINMIQSFLRFNFDEILS 887

Query: 891  TNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPH-VHSSM 949
                +    K+ IF  +K++D   +Y  L ++G+  +N + +     +  I  H + S +
Sbjct: 888  FKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTI--IKNHKMFSDL 945

Query: 950  VYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETG 1009
               EL + + F+++CT+ L + + + + D++  W K   + L   K Y   F  + +   
Sbjct: 946  SLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKS 1005

Query: 1010 NLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRM 1069
                ++ +    +  T R++ E+RL   +    + LK+LG+EI   HE LAEE S+Y+  
Sbjct: 1006 TAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEF 1065

Query: 1070 KSKFNSNLLVRKFVSLNLAHLKE 1092
            +        +  F   N++ L+E
Sbjct: 1066 RKACLDQRTIVAFAIKNISVLQE 1088

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1123 (33%), Positives = 608/1123 (54%), Gaps = 66/1123 (5%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            M Y +PVL NPL+NAVFNCP+P  S  KKL++ L+D+ F+LLVP    LL   D  S   
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQS--LCIPIK 118
             +ELCY+Y+FVA+H+L++D+ ++    ++   +   V   +LNGK+V++R    + +   
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQ---VKFDTLNGKKVIVRSQNRIILTSD 117

Query: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGV----SDWTLIDELKGFEESR 174
            G+  K++  +    L  NFN+YL     F I+ ID P+      +    I +  G    R
Sbjct: 118  GFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLG-SGKR 176

Query: 175  ELPFHSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGS 234
            E    ++D   P L    + ++  +  F  + +   DW ++  +   +Y++     +   
Sbjct: 177  E----TKDGSSPTL----DSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHI 228

Query: 235  ELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLV 294
            ELFHDI+   Y+ ++ +  F    +L D+ Y+Y+E  LY DIW ++  H++D  ++   +
Sbjct: 229  ELFHDIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGL 288

Query: 295  SQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLN 354
              LSL  L+T  Y   F+ F L  +V+ME  +  A++ F  +  A++++ K   +  TL 
Sbjct: 289  RYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLR 348

Query: 355  IITGKNSDDTIRDNTLPKLPL-IDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENT 413
             ++    D +I++ +    P+ I ADTL+SLF L++CR  + ++   + YLQ+F K+E +
Sbjct: 349  NLS--RVDKSIQEVS----PVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETS 402

Query: 414  VKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL------I 467
            + FG LGY +ST+EA + YF EL  S       +K+S LE      RS  D L      +
Sbjct: 403  ITFGVLGYAISTLEAAVCYFDELKGS-------KKMSRLESECENARSLVDKLSSESSSV 455

Query: 468  PINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLL 527
             +  ++    YRT+ GES+LS+ IAN KN+ L E LL+ E  FPL+D+L D    G TLL
Sbjct: 456  NLIHYQKTLSYRTEQGESLLSICIANGKNDILQE-LLSDERSFPLEDILEDQTTEGCTLL 514

Query: 528  IKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYI 587
            ++ LK  N +AA +++++ ++SCT  E+  Y+N++DK KRT AHY+T EI ILE+IG + 
Sbjct: 515  MQSLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFF 574

Query: 588  NWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSL 647
            +W +KD  G TALFTIFRSYDQ  Y   I+ +   A  WY      F  + H D   ++L
Sbjct: 575  DWDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTL 634

Query: 648  LHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDK 707
            LHILK  +S+LL++E +D+N  N KG+TPLM Y KYNR+DN K+IL D R+I+ K+Q   
Sbjct: 635  LHILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPL 694

Query: 708  YLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKD-DLEYTTNI 766
             L  +DY KN  + + +A + + D  F   ++   +YE S W + I+VQ D    + T  
Sbjct: 695  LLCSIDYAKNPLILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVE 754

Query: 767  IKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLS 826
              LK   N    + +     F+P    L+ L  + +   +  I +L+   YL  L++  +
Sbjct: 755  FHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKAR-LSSIGKLETVCYLRSLTNCFN 813

Query: 827  ALLYFEKIDPLTLLDENLIIKWISSKLQQQE-KSIDDHSSFKPLSAEDINNIKAFCDFSF 885
             L+  +++    L +E+ ++ WI  K+Q +  ++   H   K +  E+++ I+ F  F+ 
Sbjct: 814  VLINSQELPKDILANESKLLSWI--KVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQ 871

Query: 886  QEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHV 945
             E+    + +    KL+IF  +K++D+  S ++L  LG        S  +GDL  ++ H 
Sbjct: 872  AELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLG--------SEGMGDLYPLTDHK 923

Query: 946  HSSMVYYE------LSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSI 999
             S    Y       L +DI  M KCT+ L   + + ++ K+  W K   +LL  RK+Y+ 
Sbjct: 924  FSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQ 983

Query: 1000 KF--LQSNEETGNLSENTSVFRYAWNVTYRKEE-ERRLKFAMLELERDLKKLGTEIRVKH 1056
             F  L  N ET     +T        +  +KE+ E+RL F++ E  R + + G  I   H
Sbjct: 984  NFPHLVKNGET-----STDAGIIGKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDH 1038

Query: 1057 EELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQSNLVQR 1099
            E LAE+ S ++  K  +    +++++V  N+  LKE+   +QR
Sbjct: 1039 ESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERLIHIQR 1081

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/1104 (32%), Positives = 607/1104 (54%), Gaps = 37/1104 (3%)

Query: 5    MPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFREL 64
            +P L NPLINA+FNCP+P  SP KKL+  L+   F+LL P    LL Y D  + +   EL
Sbjct: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHEL 65

Query: 65   CYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKGYFS 122
            CY  +F+ +HIL++ +NS        N  + D + ++L+GK V++  + ++   + G+  
Sbjct: 66   CYNAEFINSHILLMTENSFI------NTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQV 119

Query: 123  KRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHSQD 182
            +R+ ++    +L NFNDY  G+  F I++I+ PL   +    D L+ F   +++P     
Sbjct: 120  RRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSC-ESVPNDYLQCFHSYKKIPKSVYS 178

Query: 183  KDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDIVN 242
                 L    + ++ +R  F  +         +L +    Y+ + P  +   ++F  IV 
Sbjct: 179  VHNLSL----DSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQ 234

Query: 243  MIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLDML 302
              +  +K +  F++F NLYD+ +EY E  LY DIW++L  H++   +        S++ L
Sbjct: 235  QAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHL 294

Query: 303  DTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSD 362
               FY++ F+ F+L D+  +E  +  A   F+ +   +SY++K  ++ +TL  ++G    
Sbjct: 295  LADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDM 354

Query: 363  DTIRDNTLPKLP--LIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALG 420
             + + +   +L    +DADTL+SLF L++CR+  + +  H+ YLQ+F  + ++ KFG LG
Sbjct: 355  GSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILG 414

Query: 421  YTLSTIEATLSYFYELS-NSD---ESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYF 476
            Y +ST+EA + YF +   NSD   ++ + LQK   L + L    +  + +  +  +KD  
Sbjct: 415  YAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNML-SCENVTNKVENLATYKDIL 473

Query: 477  RYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNL 536
             YR   G+SILS+ I+N KN  L + L  ++ IFPL+DLL D  + GSTLLI+ +K  NL
Sbjct: 474  PYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNL 533

Query: 537  EAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKG 596
            EAA+ILI I   +CT  EL++Y N+TDK  RT+AHY+T EI+IL+ IG Y++W  K+  G
Sbjct: 534  EAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGG 593

Query: 597  RTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVS 656
            +T LF+IFRSYDQ  Y + +KIA + A  WY+  +  F   DHTD  G+ LLH+LK+  S
Sbjct: 594  QTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDAS 653

Query: 657  LLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGK 716
            +LL+   LDIN  N KG+TPLM YVKY R++NI+ I++D RL+++K+QK  +  C DY K
Sbjct: 654  ILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAK 713

Query: 717  NFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKD-DLEYTTNIIKLKKYYNL 775
            + TV + +  + +KD +F   Y    RY   +  + I+   D +  ++  +I +K    L
Sbjct: 714  DHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGL 773

Query: 776  INAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKID 835
            + ++ K     F+P +  +D + ++    ++  I +  + + L+ LS+  + LL+ +K+ 
Sbjct: 774  LRSILKDNPFTFLPLNIYIDEISQLSRS-DVTIIGKADVMSLLHKLSNCFNVLLFLKKVP 832

Query: 836  PLTLLDENLIIKWI---SSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTN 892
                 DE  I+ W+   +SK  Q++ S +++ + +P   E+IN I++F  F+F EI    
Sbjct: 833  KSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEP---EEINMIQSFLRFNFDEISSFK 889

Query: 893  NVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTL-GDLQSISPHVHSSMVY 951
              +    K+ IF  +K+ D     D L  +G    N + +    G+L +     H+    
Sbjct: 890  ASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTN-----HNMFND 944

Query: 952  YELS---QDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEET 1008
            Y L+   + + F+++CT+ L++ +   + +K+  W K   +L+   K Y   F    +  
Sbjct: 945  YSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPK 1004

Query: 1009 GNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVR 1068
                 +  +    +  T R++ E+RL   +    + LK+LG+EI V HE+LAEE S+Y+ 
Sbjct: 1005 STTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYME 1064

Query: 1069 MKSKFNSNLLVRKFVSLNLAHLKE 1092
             +    +   +  F + N++ L+E
Sbjct: 1065 FRKACLNQRNIVAFAATNISVLQE 1088

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1113 (33%), Positives = 593/1113 (53%), Gaps = 64/1113 (5%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            M Y +P+L NPL+N+VFNCP P  SP KK++  LRD+ F+L+VPN  ILL+Y+D  +  S
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQ--SLCIPIK 118
             ++LCYTY+FVA HI+IL K+S          K  D   K+LNGK VL+R    + +   
Sbjct: 61   LQDLCYTYEFVANHIIILKKDS----------KYSDQEFKTLNGKTVLIRSQNGIVLTGD 110

Query: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF----EESR 174
            G+ SKR+ ++ +  L  NFNDYL GS +F ++HID PL +SD    DEL+ F      + 
Sbjct: 111  GFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPL-MSDAVKNDELQVFGVRSTNTS 169

Query: 175  ELPFHSQ--DKDKPGLLQ--RTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ 230
             LP  +    ++     Q  R      DR  F  LF+E++      ++    ++ ++ L 
Sbjct: 170  SLPLSTDLTQREVSSFEQLFRLHPQLGDR--FSGLFKEQR------QEINANFKGLDSLV 221

Query: 231  NIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRD---- 286
            +   +  ++   +I    + E+RF+  + L+   + Y+E  LY DIW ++ + YRD    
Sbjct: 222  DFFDKFNYEAFELI----RHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIE 277

Query: 287  KILDFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKV 346
               D+ L+  +++  + T FY      F L  + + E  + QA   FK +  ++S+S+K 
Sbjct: 278  ATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKT 337

Query: 347  DVIFKTLNIIT--GKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYL 404
             +I  TL  +T   +  D  I D T      IDADTL+ L  L++CR+ V+++  H+ YL
Sbjct: 338  KIIMDTLQTLTDYSEFPDADIEDVT------IDADTLIGLMVLVVCRSQVKNLKSHLFYL 391

Query: 405  QSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD 464
            Q+F  DENT+KFG + Y LST+EA L YF +  NS + R         + F   +  +  
Sbjct: 392  QNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAV 451

Query: 465  DLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALL-NFEDIFPLDDLLYDTDVSG 523
                +  ++D  R RT  GES LS+ I  K N +  E LL NFE   PL+D+L D  ++G
Sbjct: 452  SFDSLKSYRDILRIRTAGGESCLSVCI-QKGNFSGIECLLQNFEHELPLEDILDDQTING 510

Query: 524  STLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKI 583
            STLL++ L+  N   A++L+EI   SCT +EL  Y N+ ++ KRT AHY+T ++++ +KI
Sbjct: 511  STLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKI 570

Query: 584  GKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLF 643
            G + +W  KD+ G T LF IFRSYD   Y+  +  A   A  WY+     F  S H D  
Sbjct: 571  GIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTK 630

Query: 644  GDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKL 703
            G++LLH++K+ + +LL+ E++D+N  N KG+TPLM YVKYNR+DN+K IL D RLI++K 
Sbjct: 631  GNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKH 690

Query: 704  QKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYT 763
            QK  +LNC DY KN  +   L    ++   F        R+E + W+L I+++  D E  
Sbjct: 691  QKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRE-- 748

Query: 764  TNIIKLKKYYNLINAMQKIY----KSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLN 819
            T+   +K     I  + ++Y       F+P   +L+ L +I +   ++ + +L++  +L 
Sbjct: 749  TDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKT-GLVSVGKLEVHRFLC 807

Query: 820  FLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKA 879
             L+  L  +   E+      L  + ++ WI      +E      +  + +  E+IN+I++
Sbjct: 808  ELTLVLKLICQKEEFKKALYLPASDLVNWI------RESGRKRTNVSRRIEPEEINSIQS 861

Query: 880  FCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQ 939
            F  F+  E+    + I    KLSIF E+K  D+N +  +L        +  IS+  G + 
Sbjct: 862  FLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFG-IS 920

Query: 940  SISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSI 999
             +S      +    L+ +I F+K+CT  L  K+   ++ KL+ W K   +LL+ R +Y+ 
Sbjct: 921  GLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNK 980

Query: 1000 KFLQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEEL 1059
             F   N    +L +N  +F         K EE+        LER L+ L  E++ +HE L
Sbjct: 981  NF--PNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSAQIKSCLER-LQTLTYEVKQEHEAL 1037

Query: 1060 AEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKE 1092
            AEE S Y+  K+ +    +++ F    +  LK+
Sbjct: 1038 AEELSIYLEFKTNYLRTGIIQDFTVGKINTLKD 1070

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  506 bits (1303), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 344/1124 (30%), Positives = 576/1124 (51%), Gaps = 83/1124 (7%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            M Y +PVL NPL+NAVFNCP P ASP KKL+N  +DK F+L+VP   +LL Y+D+T+ + 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGY 120
              ELCY Y+FVA+H L+  + +   ++            +++NGK V++R    I I   
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELE----------FQTINGKSVVIRPQSGI-ITAQ 109

Query: 121  FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFH- 179
             S +K +++   LL +FNDYL G   F +++ID PL V +  LI  L+ F   +E P   
Sbjct: 110  PSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPL-VGEIELITPLRVFG-PQEQPLQY 167

Query: 180  ---SQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLK---KYQAMEPLQNIG 233
               +Q  D P  L+          +F++L  +  +   E+ K  K   +Y A+   + + 
Sbjct: 168  QRITQTADAPLPLE----------QFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELV- 216

Query: 234  SELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQE----HYRDKIL 289
              LFH++V  +Y  +K ++ F+ + NL ++   Y+E  +Y+D+W KL +    +  D++ 
Sbjct: 217  -RLFHELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVP 275

Query: 290  DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVI 349
             + +   +SL+ L T+ Y      F L  +  +E  +VQA   F  +   NS+ +K  ++
Sbjct: 276  GYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARIL 335

Query: 350  FKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK 409
              T   +T K S  T+        P+IDADTL+ L  +++CRA V+++  H+ YL+ F +
Sbjct: 336  ISTFQKLTTKTSQATLD-------PMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQ 388

Query: 410  DENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL--- 466
            + + VKFG LGY+LST+EA + YF    +   S I+L++L          + Q + +   
Sbjct: 389  NSDDVKFGLLGYSLSTLEAVVGYF----DIGGSSIKLERLI--------TQCQRNKIFWN 436

Query: 467  -----IPIN--QFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDT 519
                 IPIN  + ++    RT   ES+LSL I   + +   + + N++  F L+D+L D 
Sbjct: 437  LIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDV 496

Query: 520  DVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEI 579
            + S  +LLI+ L+  N +  E +I++   +CTN+E+  Y NK D   RT+ HY+    EI
Sbjct: 497  NQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEI 556

Query: 580  LEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDH 639
            ++++GK+++W  KDL   T LFT+ R+YD  +Y   +         +Y      F  +DH
Sbjct: 557  VDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADH 616

Query: 640  TDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLI 699
             D  G++LLHI+K  + L L     ++N  N +GMTPLM Y KYNRI+NI+ IL D RLI
Sbjct: 617  EDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLI 676

Query: 700  IKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDD 759
            + KLQ  + L  +DY KN  + NL+   ++K+ ++    +   +YE++ WYL I+     
Sbjct: 677  LSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSP 736

Query: 760  LEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLN 819
              Y T+   LK   +L+    K +   F+P    L+ LK + +   I+ +  L+    L 
Sbjct: 737  ESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKS-GIISVINLENSMLLE 795

Query: 820  FLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKA 879
             L+  LS +   E    +    E+ +  W+ + + +Q+ +  D      +  E+I++I+ 
Sbjct: 796  ALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRDK-----IEPEEIHSIQN 850

Query: 880  FCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQ 939
            F  FS  E            KL IF   K+ D+  S  IL   G   ++   S+ L    
Sbjct: 851  FLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRL---- 906

Query: 940  SISP---HVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKE 996
              SP     +  +  +E  Q + FM  C   LTSK+   +  K+S W     ++   +KE
Sbjct: 907  RTSPFDNEFNDGIDPFE--QAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKE 964

Query: 997  YSIKFLQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKH 1056
            Y   F +  +     SE++  F  ++    R++ E +L+  +     +L+ L  E++  H
Sbjct: 965  YQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCH 1024

Query: 1057 EELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQSNLVQRI 1100
            E LAEE S ++  K+    N +V+ +V+     +K+  N++  I
Sbjct: 1025 ELLAEEISFFISSKNFAYMNFMVKAYVN---RRIKQHKNMLLAI 1065

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  501 bits (1291), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 347/1124 (30%), Positives = 581/1124 (51%), Gaps = 82/1124 (7%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            M Y +PVL NPL+NAVFNCP P  SP KKL+N ++ + F+LLVP+  +LL Y+D  S + 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGY 120
              ELCY YDFVA+HILI  + S          K  +   ++LNG  V++R    I +   
Sbjct: 61   LSELCYNYDFVASHILIQLQES----------KVTEQEYRTLNGNSVIIRSQAGI-VMSK 109

Query: 121  FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHS 180
               RK +++   +L NFNDYL    +F ++HID PL V      DEL+ F       +  
Sbjct: 110  PELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPL-VGALVRNDELQVFGS-----YEM 163

Query: 181  QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSE----- 235
             +  K   +    EN     KFI+L+ +      +L+ Y ++ +     Q I +E     
Sbjct: 164  HNPSKSKTINTISENHIPFEKFIRLYPQ---LGAQLDGYFQRDR-----QRIRNEVDQLD 215

Query: 236  ----LFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQE----HYRDK 287
                +F D+V  +Y  +KE++ F+ +  L ++  EY+E  +Y+DIW KL +       D+
Sbjct: 216  KLIKIFKDLVIDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDR 275

Query: 288  ILDFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVD 347
            +  +     +SL+ + T  Y     +F L  +  +E  +V+A   F  +   NS+++K  
Sbjct: 276  VSGYSSTKYISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAK 335

Query: 348  VIFKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSF 407
            ++  T  I+T K    +I        P IDADTL+ L  ++LCR+ V+++  H++YL+ F
Sbjct: 336  IVVSTFQILTTKMEYTSID-------PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREF 388

Query: 408  YKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLED----FLIKIRSQH 463
                + VKFG  GY+LSTIEA L+YF E  +  E   +L+KL  L +    F   IRS  
Sbjct: 389  APRPDDVKFGLTGYSLSTIEAVLAYF-EAGDGTE---KLKKLISLSEANRVFWDLIRS-- 442

Query: 464  DDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSG 523
               + ++ +K+    R+   ES LS+ I   + + + E LLN+++   L+DLL+D + + 
Sbjct: 443  GVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQAN 502

Query: 524  STLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKI 583
            STLLI+ L+  + E AE+LI++  ++CTN+E   Y N+++   RT+AHY+     I+EKI
Sbjct: 503  STLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKI 562

Query: 584  GKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLF 643
            G Y++W  KD+   T LF I R+YDQ  YS  +  + +    + +     F  +DH D  
Sbjct: 563  GLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPM 622

Query: 644  GDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKL 703
            G+SLLHI+K  +  +L   ++++N  N+KGMTPLM Y KYNRI+NI+ ILED RLI+ K+
Sbjct: 623  GNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKI 682

Query: 704  QKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYT 763
            Q  + L  +DY KN  + NL+   ++K+ ++        ++E + WYL I+V+  D  Y+
Sbjct: 683  QNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFSDNSYS 742

Query: 764  TNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSH 823
            T    +K    L+    K +  +F+P   +L  LK I +   ILP+  L+   +L  L+ 
Sbjct: 743  TLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIGKP-GILPVINLENSIFLGLLTQ 801

Query: 824  GLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDF 883
             LS +    +   +   +E+ +  W+ +   +   + D+      +  E++++I++F  F
Sbjct: 802  LLSVIGQRNEYMAVLRYNESDLSTWLRTNNFKPRANKDER-----IEPEEVSSIQSFLKF 856

Query: 884  SFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISP 943
            +  E  +         KL +F  +K  D+  +  I+ +     SN           S+ P
Sbjct: 857  NLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSN-----------SVGP 905

Query: 944  HVHSSMVY----YEL---SQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKE 996
             V  + +     Y L    Q I F+  C   L+SK+   +  K+++W +   +L   R+E
Sbjct: 906  SVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRRE 965

Query: 997  YSIKFLQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKH 1056
            Y   F    + +    E +  F  ++    R++ E +L+  +      L+ L  E++  H
Sbjct: 966  YQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDH 1025

Query: 1057 EELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQSNLVQRI 1100
            E LAEE S +V  K+    + +++ + ++ + H     N++Q I
Sbjct: 1026 ENLAEEISFFVTFKNFAYESFVMKTYANICIKH---HRNILQVI 1066

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  493 bits (1269), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 307/870 (35%), Positives = 480/870 (55%), Gaps = 54/870 (6%)

Query: 1   MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
           M Y +P+L NPL+N+VFNCP P  SP KK++  LRD+ F+L+VPN  ILL+Y+D  +  S
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQ--SLCIPIK 118
            ++LCYTY+FVA HI+IL K+S          K  D   K+LNGK VL+R    + +   
Sbjct: 61  LQDLCYTYEFVANHIIILKKDS----------KYSDQEFKTLNGKTVLIRSQNGIVLTGD 110

Query: 119 GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF----EESR 174
           G+ SKR+ ++ +  L  NFNDYL GS +F ++HID PL +SD    DEL+ F      + 
Sbjct: 111 GFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPL-MSDAVKNDELQVFGVRSTNTS 169

Query: 175 ELPFHS----QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ 230
            LP  +    ++      L R      DR  F  LF+E++      ++    ++ ++ L 
Sbjct: 170 SLPLSTDLTQREVSSFEQLFRLHPQLGDR--FSGLFKEQR------QEINANFKGLDSLV 221

Query: 231 NIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRD---- 286
           +   +  ++   +I    + E+RF+  + L+   + Y+E  LY DIW ++ + YRD    
Sbjct: 222 DFFDKFNYEAFELI----RHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIE 277

Query: 287 KILDFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKV 346
              D+ L+  +++  + T FY      F L  + + E  + QA   FK +  ++S+S+K 
Sbjct: 278 ATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKT 337

Query: 347 DVIFKTLNIIT--GKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYL 404
            +I  TL  +T   +  D  I D T      IDADTL+ L  L++CR+ V+++  H+ YL
Sbjct: 338 KIIMDTLQTLTDYSEFPDADIEDVT------IDADTLIGLMVLVVCRSQVKNLKSHLFYL 391

Query: 405 QSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD 464
           Q+F  DENT+KFG + Y LST+EA L YF +  NS + R         + F   +  +  
Sbjct: 392 QNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAV 451

Query: 465 DLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALL-NFEDIFPLDDLLYDTDVSG 523
               +  ++D  R RT  GES LS+ I  K N +  E LL NFE   PL+D+L D  ++G
Sbjct: 452 SFDSLKSYRDILRIRTAGGESCLSVCI-QKGNFSGIECLLQNFEHELPLEDILDDQTING 510

Query: 524 STLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKI 583
           STLL++ L+  N   A++L+EI   SCT +EL  Y N+ ++ KRT AHY+T ++++ +KI
Sbjct: 511 STLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKI 570

Query: 584 GKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLF 643
           G + +W  KD+ G T LF IFRSYD   Y+  +  A   A  WY+     F  S H D  
Sbjct: 571 GIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTK 630

Query: 644 GDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKL 703
           G++LLH++K+ + +LL+ E++D+N  N KG+TPLM YVKYNR+DN+K IL D RLI++K 
Sbjct: 631 GNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKH 690

Query: 704 QKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYT 763
           QK  +LNC DY KN  +   L    ++   F        R+E + W+L I+++  D E  
Sbjct: 691 QKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRE-- 748

Query: 764 TNIIKLKKYYNLINAMQKIY----KSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLN 819
           T+   +K     I  + ++Y       F+P   +L+ L +I +   ++ + +L++  +L 
Sbjct: 749 TDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKT-GLVSVGKLEVHRFLC 807

Query: 820 FLSHGLSALLYFEKIDPLTLLDENLIIKWI 849
            L+  L  +   E+      L  + ++ WI
Sbjct: 808 ELTLVLKLICQKEEFKKALYLPASDLVNWI 837

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  478 bits (1230), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 361/1131 (31%), Positives = 590/1131 (52%), Gaps = 93/1131 (8%)

Query: 15   AVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFRELCY-TYDFVAA 73
            ++FNCP+P  SP KKLY  L+DK F+LLVP    LL Y D+ + I   +LCY   DF+ A
Sbjct: 16   SIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFIGA 75

Query: 74   HILILDKNSST----------DKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKGYF 121
            HIL+  K+S +           +++S  Q        +LNG  +L+  R +  + + G  
Sbjct: 76   HILLPPKDSISSSSSTIDDGYTRLASIEQ------FDTLNGDNILVKWRNNFLVLLSGSP 129

Query: 122  SKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHSQ 181
            +++K ++    +L NFNDYL GS +F ++HID PL      L DEL+ F+    L  H  
Sbjct: 130  NRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT---LTLHDN 186

Query: 182  DKD-----KPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSEL 236
            D D     +P L+Q  + ++ +R +F  +      W    + ++ +Y+     +     L
Sbjct: 187  DGDSSPDARP-LIQ--DMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNETL 243

Query: 237  FHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQE--HYRDKILDFRLV 294
            F  IV + YN LK  + F+ F +L  + +EY+E  LY  +W ++       D+    R +
Sbjct: 244  FKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTR-I 302

Query: 295  SQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLN 354
              +S++ +D  FY      F L  I  +E  MV++ +    +   NS+++K + +  TL 
Sbjct: 303  KNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQ 358

Query: 355  IITGKNSDDTI----RDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFL--HVQYLQSFY 408
            I+T  N D+ I    ++N      LIDADTL++L  L++CR+ +  V L  ++ YL+ F 
Sbjct: 359  ILT--NMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFN 416

Query: 409  KDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL-- 466
             DEN + FG L YT+ST E  +  F  +   D    +L+  S + + LIK+    DDL  
Sbjct: 417  YDENLINFGILSYTISTFEIVIYSFENIVEYD----KLKSYSEIIEKLIKV----DDLKK 468

Query: 467  IPIN-QFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGST 525
            +P   +++ +  +R+  GESIL   I N + E   + L+++E+IF +D++L D +V G+T
Sbjct: 469  VPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTT 528

Query: 526  LLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGK 585
            LL++ L  RN + + +LI +   +C+N +++ Y NK DK  R + HY+ +E+EIL+ IGK
Sbjct: 529  LLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGK 588

Query: 586  YINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGD 645
            Y+NW  +DL GRT LFTIFR YDQ  Y   I    D  L WY  N + F++SDH DL  +
Sbjct: 589  YVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDN 648

Query: 646  SLLHILKSQVSLLLKFE-----DLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLII 700
            S+LHIL+S + +L  +      ++DIN  N KG TPLM YVKY+R+ N+K IL D RL+ 
Sbjct: 649  SILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLF 708

Query: 701  KKLQKDKYLNCLDYGKNFTVFNLLAA-KLSKDVIFENAYISYARYEKS---HWYLCISVQ 756
             + Q++ Y  C DY  + T+ N L    L  + +F   YI   +   S    + L   + 
Sbjct: 709  NRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLP 768

Query: 757  KDDLEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHN----ILPIRRL 812
              + E  T  IK+K   +L+  ++K  +   +P   ++  L K+    N    +  I  L
Sbjct: 769  DKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEML 828

Query: 813  KIKNYLNFLSHGLSALLYFE-KIDPLTLL-DENLIIKWISSKLQQQEKSIDD-HSSFKPL 869
            + ++ L  L+  L  LL+F+  ID L+L+ DE  ++ W++++  + + +++  H   K L
Sbjct: 829  RNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSL 888

Query: 870  SAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNN 929
              EDIN I++F  F+ +E+      +++  KL  F  +K+ D+  S      L     N+
Sbjct: 889  KPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKND 948

Query: 930  EISRTLGDLQSISPHVHSSMV---YYE---LSQDILFMKKCTLILTSKLASFIKDKLSIW 983
            +I++     +S+ P +    +   YY    +  ++ F+K CTLILT  +   ++ ++  W
Sbjct: 949  QIAQATN--RSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNW 1006

Query: 984  LKKNTKLLEHRKEYSIKFL------------QSNEETGNLSENTSVFRYAWNVTYRKEEE 1031
             K   +LLE  K Y+  F             Q + E  N   N  VF        R +  
Sbjct: 1007 WKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFG-GLIENQRNKAV 1065

Query: 1032 RRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKF 1082
            ++LK  + +L+  L+ LG EI  KHE LAEE + Y+  K  F    ++R +
Sbjct: 1066 KKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNW 1116

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  465 bits (1196), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 339/1114 (30%), Positives = 584/1114 (52%), Gaps = 69/1114 (6%)

Query: 15   AVFNCPDPHASPFKKLYNELRDKD-FLLLVPNDFILLYYKDSTSNISFRELCYTYDFVAA 73
            A+ NC +P++SP KKLY +L  KD +L+LVP   +LLYY D  SN    +LCYT +F +A
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HILILDK-----NSSTDKISSSN-QKNGDVYL--------KSLNGKEVLLRQSLCIPIKG 119
            HIL+LD      N+  + +   N +K  DV+         K +N K  ++ +   +   G
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL---G 135

Query: 120  YFSKRKSQMRDATLLTNFNDYLHGSGH-FGIMHID--YPLGVSDWTL---IDELKGFEES 173
               K ++++ D   +  FN+Y+  + +   IM+ID  +  G  +  L   ID L+     
Sbjct: 136  DQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRS-PSM 194

Query: 174  RELPFHSQDKDKPGLLQRTE---ENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ 230
            R +P       +P L+ +     EN   +  F  + +  K W+ + E++ +K++ +    
Sbjct: 195  RSIP----TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQD 250

Query: 231  NIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILD 290
            ++  ++FH+I+  ++  +  +  F+   +L +I YEY+E  L+ DIW  +    ++  +D
Sbjct: 251  DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID 310

Query: 291  FRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIF 350
                  +S+  +D+ F +  +  F L +++  E  + +A    + I+SA++Y  K +++ 
Sbjct: 311  LNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILI 370

Query: 351  KTLNIITGKNSDDTIR----DNTLPKLPL-IDADTLVSLFALLLCRAGVEDVFLHVQYLQ 405
             TL  +TG   +D       D  L   PL IDAD L++LF L+ CRA ++++  H+ YLQ
Sbjct: 371  LTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQ 430

Query: 406  SFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQ--- 462
            +FY +++  KFG LGY LST+EA + YF +L   +  R +L       + L+K+ S    
Sbjct: 431  NFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYR-KLIDFCNSNERLVKVLSSTKK 489

Query: 463  ---HDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDT 519
               +  L  + +++   RYR   G+S+L+L I + +N+ L   L  +E +FP++DLL D 
Sbjct: 490  YETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADE 549

Query: 520  DVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEI 579
             + GSTLLI+ +K  N  +A +L+ I +++CT  EL+ Y N+ D  KRT  H++T+E+E+
Sbjct: 550  SIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEV 609

Query: 580  LEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDH 639
            L+ +GKYINW  KD  G+T LFTIFRSYDQ  Y   +  +++ A  WY  N   F   DH
Sbjct: 610  LKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDH 669

Query: 640  TDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLI 699
             D  G++LLHILK  + +LL  + +++N  N  G TPLMT ++Y R +NI+ +L D RL 
Sbjct: 670  VDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLR 729

Query: 700  IKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDD 759
            +   QK+  L   D+ K+  + +LL      +  +   Y    +Y  S W L ++V+  D
Sbjct: 730  VDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLKD 789

Query: 760  LEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNIL--PIRRLKIKNY 817
               TTN   LK    ++  + K   + F+P  ++++ L   I  + I    + R+K+   
Sbjct: 790  APKTTNFT-LKTLRGILRVVIKNNMTVFLPVQELVEDL---ISFNRIRFSELMRIKVLEM 845

Query: 818  LNFLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSS-FKPLSAEDINN 876
            L F+S  LSAL++ + +D      E   IKW+     +   S+D  ++    ++ EDI+ 
Sbjct: 846  LPFISFCLSALVHIKVLDLNVFQTEENAIKWV-----KMNGSVDKKTNQTSDITPEDISM 900

Query: 877  IKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDL---NTSY-DILERLGSYFSNNEIS 932
            I+ F  F+  EI +T N ++   KLS+F  +K+ DL   N +Y  I+ +L S    + + 
Sbjct: 901  IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK 960

Query: 933  RTLGDLQSISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLE 992
             +  D + +S     +++       I ++K C   L + + S     +S W     +LL 
Sbjct: 961  YSAEDTKLLSVRAEKALL-----SKITYLKICAQKLHNHILSITTTMISNWWHIYGELLN 1015

Query: 993  HRKEYSIKFLQ-SNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTE 1051
              K Y+  F + +N  T N   + ++ R   N    K EE RL   + ++   L  +G +
Sbjct: 1016 AHKHYTRAFPELANVTTEN--RDLALHRMISNPKRIKLEE-RLSEKIKDITEQLNSVGHD 1072

Query: 1052 IRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSL 1085
            I+  HE  AEE S ++ +K+KF     ++ ++++
Sbjct: 1073 IKQMHELAAEEVSRFIDLKTKFTLEYALQSYLTI 1106

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  454 bits (1169), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 338/1122 (30%), Positives = 559/1122 (49%), Gaps = 81/1122 (7%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            M Y++PVL NPLINAVFNCP P  SP +K++  +  + F L+ P   ILL Y+D  S  S
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR--QSLCIPIK 118
             ++LCY+  FV+ HIL+L     + +         + Y K+L+GK + LR  Q      +
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHE---------EEY-KTLSGKTITLRNQQKALFTGE 110

Query: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPF 178
            G+ ++R+ Q+ +  LL+NFN+Y  GS  + I+H+D+PL        DE  GF+  R   F
Sbjct: 111  GFDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPL-TGRLARRDEWPGFKAYR---F 166

Query: 179  HSQDKDKP-GLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEP-----LQNI 232
             S D       L  + E KA      Q+ +    +  +L   ++  +A          N+
Sbjct: 167  ASTDTTSANSSLAASTEPKAS---LEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNL 223

Query: 233  GSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKIL--- 289
             +  F          ++E+Q F+ F NL    +EY+E  LY D W +L    +D  +   
Sbjct: 224  AAH-FMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQ 282

Query: 290  -DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDV 348
             DF ++  +S+  + +  Y    + F +  +  +E  + +AV   + +   NS+S K  V
Sbjct: 283  SDFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKV 342

Query: 349  IFKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFY 408
            I +TL  ++       I D  +     +DADTLVSL  +++C+A V+D+  H+ YLQ F 
Sbjct: 343  IVETLQTVS---RSLEINDKVIS----VDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFA 395

Query: 409  KDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL-- 466
            KD N++ FG L Y +ST+EA LSYF       ESR   +KL LLE       S  + L  
Sbjct: 396  KDSNSITFGILAYGMSTLEAVLSYF-------ESR---EKLKLLEKHCSSNASYWEALAD 445

Query: 467  --IPI-----NQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDT 519
              +P+     ++ KD  R RT  G S LS+ + N++          FE  FPL+DLL D 
Sbjct: 446  GKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDE 505

Query: 520  DVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEI 579
             V GS LLI+ L       +   IE+   SCT +EL ++ N  ++ +R+  HY+   +++
Sbjct: 506  TVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDL 565

Query: 580  LEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDH 639
            + K+GK+INW  +D  G T LF I R+YD T Y + +  A   A LW       F++S H
Sbjct: 566  IVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKH 625

Query: 640  TDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLI 699
             D  G++LLH++KS VS++L    +++N  N KG+TP+M Y +YNR+DNIK+IL D RLI
Sbjct: 626  QDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLI 685

Query: 700  IKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKDVIF-ENAYISYA---RYEKSHWYLCISV 755
            I+K Q   YL C DY KN  V      +L K   F   +Y   A   ++E   W L +++
Sbjct: 686  IQKCQNGSYLTCFDYIKNPVVL----GELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTL 741

Query: 756  QKDDLEYTTNIIK--LKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLK 813
                      +I+  LK   + + +  K     FIP   + + L  ++    I+ I RL+
Sbjct: 742  VGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPAESLAEEL-SLLAKMKIISINRLE 800

Query: 814  IKNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAED 873
             K++L   S  LS +   E+ + +       ++   +  +Q+QE     +S++  +  E+
Sbjct: 801  TKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVN-AAEHVQEQEA----NSTYGMIEPEE 855

Query: 874  INNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSN--NEI 931
            + +I+    F+  EI    +      KL+IFG +K  DL  S+ + +  G+ F+      
Sbjct: 856  VASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRS 915

Query: 932  SRTLGDLQSISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLL 991
            +   G L+   P       +  L+ +   ++  + +L  K+   +   +  W K   +L+
Sbjct: 916  TNVFGSLKHSLPQCE----FGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELV 971

Query: 992  EHRKEYSIKFLQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTE 1051
              R EY+  F   ++    ++ENT  F  ++  T R   E+ L   +    ++L +    
Sbjct: 972  SLRHEYNKNF--PDDVRPRVAENTG-FISSYIETKRVRLEQGLVGRINRSSKNLLRFSLM 1028

Query: 1052 IRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093
            +R  +E LA E ++++  K++F  +  +++  ++N+  L+EQ
Sbjct: 1029 LRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQ 1070

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  453 bits (1165), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 334/1122 (29%), Positives = 561/1122 (50%), Gaps = 113/1122 (10%)

Query: 15   AVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFRELCYTYDFVAAH 74
            A+FNCP P  S  K++++ L D+ F +LVP+   LL ++D  S +   ELCY YDFVA+H
Sbjct: 15   AIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELAELCYHYDFVASH 74

Query: 75   ILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR--QSLCIPIKGYFSKRKSQMRDAT 132
            I+++ K+ + D     +  N D    +LNG+++ +R   S  +   G+  +RK  +++  
Sbjct: 75   IVVI-KDPTKDVPDQRSIYNTD--FTTLNGRKLSIRYRNSTIVTGDGFTERRKITIKEIN 131

Query: 133  LLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF----------EESRELPFHSQD 182
            LL  FNDYL GS +  I+HI  PL   D   +DEL+ F          +E   LPF  + 
Sbjct: 132  LLPTFNDYLKGSNYTPILHISMPL-CGDLVPLDELQVFSKVAGNKYSKQEQAPLPFDEEQ 190

Query: 183  KDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSEL-FHDIV 241
            K      QR        ++ I    ER    + L  +L K +  + +  IG    + +  
Sbjct: 191  KKVLYFEQR--------IQSISDVAER----VALTFHLTKARIKKAISVIGIRTEWLNTR 238

Query: 242  NMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKIL----DFRLVSQL 297
            + I   +  ++R     +L  + Y+Y+E  L+ DI  +L E   D+ L    DF+ +  +
Sbjct: 239  DSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSI 298

Query: 298  SLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIIT 357
            SL+ + T FY +  K+F L  +V +E  +  A+   K I    ++S K++V+  T+ +++
Sbjct: 299  SLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLS 358

Query: 358  GK-NSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKF 416
             + N   T            DADTL+SLF LL+CR+ V  +   + YL +F   E ++KF
Sbjct: 359  REINGIST------------DADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKF 406

Query: 417  GALGYTLSTIEATLSYFYE---------LSNSDESRIQLQKLSLLEDFLIKIRSQHDDLI 467
            G  GY LST EA LS+F++          +++ +    +QK S +E  L+          
Sbjct: 407  GLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLS--------- 457

Query: 468  PINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLL 527
                     R RT  GES+LS+ I +  NE L   L NFE  FPL+D+L D D + STLL
Sbjct: 458  ------SNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLL 511

Query: 528  IKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYI 587
            I+ L+ +N +AA IL EI   SCT SE+ +Y N  +   R  AHYI  +I +LE +G+Y 
Sbjct: 512  IQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYF 571

Query: 588  NWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSL 647
            NW  KD+ G T LF +FRSYD   Y   +   LDQ + WY NN+  F    H D  G++L
Sbjct: 572  NWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTL 631

Query: 648  LHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDK 707
            LH++KS +  LLK  D+++N P+ KG+TPLM Y +YNRI NI+TI++D RL+   +Q+  
Sbjct: 632  LHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPL 691

Query: 708  YLNCLDYGKNFTVF-NLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYTTNI 766
             +  LD+ KN  V   +L A  ++    E   I   R+E+  W + I  +    +Y+ ++
Sbjct: 692  VMTSLDFTKNPKVTKTILDATFNR----EPVVIHSLRFEERKWKIGIFSEGIFKKYSLDL 747

Query: 767  IKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLS 826
            I   +YY  +  ++ +Y   F P   + + L +++  + +  + RL+             
Sbjct: 748  I---QYY--LRYLKIMYPCSFHPVQLLTNEL-RLLGIYGVPGVLRLQ------------- 788

Query: 827  ALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSID-------DHSSFKPLSAEDINNIKA 879
            +   F+K+D L          W+    ++ +  +D       +   F  L  E+IN I+ 
Sbjct: 789  SYHTFKKLDMLFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEPEEINGIQT 848

Query: 880  FCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQ 939
            F  ++  E  K  N +    KL+I  +IK+ D+ T  +    LG+  S   ++++  +  
Sbjct: 849  FLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTN 908

Query: 940  SISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSI 999
                +    + YYE ++++ +++   + L +   S +  K ++W K   +L+E +KE+  
Sbjct: 909  CAWSY---DLSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWKHFGELMELKKEWKK 964

Query: 1000 KFLQSNEETGNLSEN-TSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEE 1058
             F        + + N    +       +R +   +LK + L    +LKK+G EI+  HE 
Sbjct: 965  NFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSL----NLKKIGGEIKTTHES 1020

Query: 1059 LAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQSNLVQRI 1100
            +A   + ++  K +F  + +V+  V      ++E   ++Q++
Sbjct: 1021 IAVGINLFIEFKEQFYHDHIVKSIVD---QRIRENKQIMQQL 1059

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  431 bits (1107), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 328/1112 (29%), Positives = 546/1112 (49%), Gaps = 63/1112 (5%)

Query: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60
            M Y++PVL NPLINAVFNCP P  S  KK+++ +    F+L+ P   +LL Y+D  S + 
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR--QSLCIPIK 118
             ++LCY   FV+ HI++LD      +         + Y K+L+GK +LLR  Q +     
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREGLQE---------EEY-KTLSGKTILLRSQQGIIFTAA 110

Query: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPF 178
             + ++R+ +++ A LLTNFN+YL G   F I+H+D+PL        DE + F  ++    
Sbjct: 111  AFDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPL-TGRLARRDEWQCFRVTKNQE- 168

Query: 179  HSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQ-----AMEPLQNIG 233
            H+      G L   + N    +   QL +   ++   L   +K  +     ++    ++ 
Sbjct: 169  HTNGPKNSGKLSHGDNN----ISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLA 224

Query: 234  SELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKIL---- 289
            S  F        + ++    FQ   NL    +EYIE  LY D W +L    RD  +    
Sbjct: 225  SH-FVQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSS 283

Query: 290  DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVI 349
            D+ L+  +S+  + +  Y    + F L  I   E  +  AV  F+ I   N +S K  VI
Sbjct: 284  DYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVI 343

Query: 350  FKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK 409
             +TL  +    S   + D+   +   IDADTLVSLF +++C A V+D+  H+ YLQ F K
Sbjct: 344  IETLQTL----SRSLLVDD---RAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTK 396

Query: 410  DENTVKFGALGYTLSTIEATLSYFYE----LSNSDESRIQLQKLSLLEDFLIKIRSQHDD 465
            D N V FG L Y +ST+EA L YF       S     R  L     + +  I + +  D 
Sbjct: 397  DTNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGSIDLNA--DT 454

Query: 466  LIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNF-EDIFPLDDLLYDTDVSGS 524
             +P++   D  + RT  G+S L++ + +++ E   E + N  E  FPL+DLL+D    GS
Sbjct: 455  TVPLD---DLLKIRTSDGQSCLAVCLQHRRTEEF-ELIKNTREAWFPLEDLLHDETTDGS 510

Query: 525  TLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIG 584
             LLI  L+      A +LI    ++CT  EL+ + N T+K +R+  HY+    ++++ +G
Sbjct: 511  NLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVG 570

Query: 585  KYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFG 644
              +NW  +D  G T LF I R+YD+  Y   +  A   A+   K  +  F+VS+HTD  G
Sbjct: 571  DILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKG 630

Query: 645  DSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQ 704
            ++LLH++KS VS+LL    +D+N  N KG+TPLM YV+YNRI N++TIL+D RLII K Q
Sbjct: 631  NTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQ 690

Query: 705  KDKYLNCLDYGKNFTVFNLLAAKLSKDVIFE-NAYISYARYEKSHWYLCISVQKDDLEYT 763
               YL+C DY KN  V   L  K +  + FE +  +   + E   W L I+V   + +  
Sbjct: 691  SGAYLSCFDYVKNPAVLKEL-GKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVP 749

Query: 764  TNIIK--LKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFL 821
              + K  L+     +      +   F+P  ++L  L+ + +   IL + ++  K +L   
Sbjct: 750  VKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSR-ILILNKMDTKRFLKRC 808

Query: 822  SHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFC 881
            S  LS ++  E++      D NL +         +  +     + K +  E++ +I++  
Sbjct: 809  SVTLS-MVSQERLFADAFTDSNLNLSSSRGLGSSESFT----QNMKMMEPEEVRSIQSIL 863

Query: 882  DFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSI 941
             F+  EI      +    KL++F  +K  DL+ +         Y +  +I      L   
Sbjct: 864  KFNLSEISALKTAMLLMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQ 923

Query: 942  SPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKF 1001
            +P++     +  ++ +I   + C+ +L   +   + D +  W     +LL  R+EY   F
Sbjct: 924  APNLFD---FEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSF 980

Query: 1002 LQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAE 1061
              +N    ++SEN+ +F  ++  T R + E+     +      L ++ T+I   +E LA 
Sbjct: 981  PDANRP--HVSENSGLFG-SYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAV 1037

Query: 1062 EFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093
            E ++++  K++F  +  +++    N+  L+EQ
Sbjct: 1038 ELNNFINFKNEFLKS-AIKEHADTNIKRLREQ 1068

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  398 bits (1022), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 246/723 (34%), Positives = 399/723 (55%), Gaps = 10/723 (1%)

Query: 376  IDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYE 435
            +DADTL+SLF L++CR+  + +  H+ YLQ+F  + ++ KFG LGY +ST+EA + YF +
Sbjct: 17   MDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFED 76

Query: 436  L----SNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRTQYGESILSLLI 491
                  N  ++    +K   L D L    +  +++  +  +KD   YR + G+SILS+ I
Sbjct: 77   FNKNTGNVAKANTLCEKTKNLLDKL-SCENPTNEVEDLATYKDILTYRNEQGQSILSICI 135

Query: 492  ANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCT 551
             N KN  L + L  +E+ FP++DLL D  + GSTLLI+ +K  NLEAA++LI+I   +CT
Sbjct: 136  TNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNCT 195

Query: 552  NSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGRTALFTIFRSYDQTT 611
              EL++Y NKTDK  RT+AHY+T E++IL+ IG YI+W  K+  G+T LF+IFRSYDQ  
Sbjct: 196  EEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPN 255

Query: 612  YSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNL 671
            Y   +K A D A  WY+ ++ +F   DHTD  G+SLLH+LK+ + +LL+   LDIN  N 
Sbjct: 256  YEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEENY 315

Query: 672  KGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKD 731
            KG+TPLM YVKY R+ NI  I +D RLI++K+Q   +  C DY K+ +V + +  +  KD
Sbjct: 316  KGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKD 375

Query: 732  VIFENAYISYARYEKSHWYLCI-SVQKDDLEYTTNIIKLKKYYNLINAMQKIYKSDFIPY 790
             +F   Y    RY   +    I SV   +  + T +I +K    L+ ++ K     F+P 
Sbjct: 376  SLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPL 435

Query: 791  SDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWIS 850
            +  +D +   +   ++  I +  + + L+ L++  + LL+ +KI      DE  I+ W+ 
Sbjct: 436  NTYIDEISH-LNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMR 494

Query: 851  SKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNT 910
                ++ +      + K +  E+IN I++F  F+F EI      +    K+ IF  +K+ 
Sbjct: 495  INTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSD 554

Query: 911  DLNTSYDILERLGSYFSNNEISRTLGDLQSISPH-VHSSMVYYELSQDILFMKKCTLILT 969
            D   +Y  L  +G    N+E S     +  I+ H + S +    L +++ F+++CT+ L+
Sbjct: 555  DFEDAYKGLNEMGRKLINSEASSAFKGI--ITNHNMFSELSLAALLENVRFLEQCTIQLS 612

Query: 970  SKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENTSVFRYAWNVTYRKE 1029
            S +   + +K+  W K   + L   K Y   F    +       ++      +  T R++
Sbjct: 613  SFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKREQ 672

Query: 1030 EERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAH 1089
             E+RL   +    + LK+LG+EI V HE LAEE S+Y+  +        +  F + N++ 
Sbjct: 673  SEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNISV 732

Query: 1090 LKE 1092
            L+E
Sbjct: 733  LQE 735

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  398 bits (1022), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 336/1134 (29%), Positives = 551/1134 (48%), Gaps = 72/1134 (6%)

Query: 5    MPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFREL 64
            MP L NPL++AVFNC D  ASP +K+Y+ L D  F+LLVP  F L YY D  +     EL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 65   CYTYDFVAAHILIL---DKNSSTDKISSSNQKNGDVYLKSLNGK---EVLLRQSLCIPIK 118
            C++ +FV++HIL       N   D   S  +   +    + NGK    +  +QSL     
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSL-YTTD 119

Query: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTL-IDELKGFEESRELP 177
            G+  +   ++     L +F +YL GS  F +++ID PL  ++  L  ++L  F     L 
Sbjct: 120  GFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPN---LT 176

Query: 178  FHSQDKDKPGLLQRTEENKADRVKFI-QLFQERKDWTIE--LEKYLKKYQAMEPLQNIGS 234
             ++    +      + E    R   +  +   + +W      + Y K+    E +   G 
Sbjct: 177  INTTPSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPG- 235

Query: 235  ELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKL-----QEHYRDKIL 289
              F   ++ IY+ L  +  F     +  +  EY+E  +Y D+W  L      E  ++K  
Sbjct: 236  --FRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQS 291

Query: 290  D----FRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKK 345
            +    FR +S   LD LDT FY   F  F L DIV +E  + +A   F+ +   ++Y +K
Sbjct: 292  ESSDIFRFIS---LDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEK 348

Query: 346  VDVIFKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQ 405
              V+ +TL I++       ++     ++P I ADTLVSLF LL+ R  ++++  H+ YLQ
Sbjct: 349  CRVLVETLQILS-----KPVKRVGGYQVP-ITADTLVSLFILLIKRTKMKNIRCHLYYLQ 402

Query: 406  SFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQL--QKLSLLEDFLI---KIR 460
            +F++DEN++KFG LGY +ST+EA + Y  E   +D+ R+    +  + LE+FL    + +
Sbjct: 403  NFHQDENSIKFGLLGYAISTLEAVICYL-ETIETDKERLDCIEKNDANLEEFLTLLTRSK 461

Query: 461  SQHDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALL-NFEDIFPLDDLLYDT 519
               ++ + ++++   FRYR   G S LSL I N KN+   E L  N+E  F  +DLL D 
Sbjct: 462  CVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQ 521

Query: 520  DVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEI 579
               G+TLL++ L+  N E  E L +I   + T  EL  Y  K DK KR + HYI  +  +
Sbjct: 522  TTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTL 581

Query: 580  LEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWY---KNNDIIFKV 636
            L+KIGKYI W  KD  G+T L  IFRSYDQ  Y   ++ +   A+ WY   KN+   F+ 
Sbjct: 582  LQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFR- 640

Query: 637  SDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDG 696
             DHTD  G++LLHI+K  +S LL+  D+DIN  N +G++PL     Y+R +N++ +L+D 
Sbjct: 641  -DHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDP 699

Query: 697  RLIIKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISY--ARYEKSHWYLCIS 754
            RLI        +L      K+  + +     L  +  F N   S+   R       +  S
Sbjct: 700  RLIFSSFD---FLKQYPNTKSAPILSHYC--LDNEAPFRNIIASHFDFRISNKRSVVLTS 754

Query: 755  VQKDDLE--YTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRL 812
              K+D +    +   +LK    L   + K +   F P  ++LD L  + +  +   + + 
Sbjct: 755  RSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKS 814

Query: 813  K-IKNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWIS-SKLQQQEKSIDDHSSFKPLS 870
                  L  L++ L +++  E +    L    L+ + I+  K+   E+ +   S  K + 
Sbjct: 815  SFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQ 874

Query: 871  AEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNE 930
             E I  I  F  +  + + K    I    K SI  ++K+ D++ S +I+  LG+  S+ +
Sbjct: 875  PESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKK 934

Query: 931  ISRTLGDLQSISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKL 990
            I R +    +I         +  L   I F + C   + + +   +  K+  W K   +L
Sbjct: 935  IGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQL 994

Query: 991  LEHRKE-YSIKFLQSN-EETGNLSEN--TSVFRYAWNVTY--------RKEEERRLKFAM 1038
            LE  KE  S+   +S+ ++T N S N  TS   +   +          R + + R + A+
Sbjct: 995  LELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAI 1054

Query: 1039 LELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKE 1092
             +L+R LK L  EI   +  +  E+  ++  +SKF  + ++ K+V LN+  LK+
Sbjct: 1055 SDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKK 1108

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  380 bits (975), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 348/1183 (29%), Positives = 581/1183 (49%), Gaps = 127/1183 (10%)

Query: 15   AVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFRELCY-TYDFVAA 73
            AVFNCPDP  SPFKKL+  L+++ F+LLVP    LL Y DS   +S  ELCY   DF+ +
Sbjct: 16   AVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLGS 75

Query: 74   HILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR-QSLCIPIKGYFSK-RKSQMRDA 131
            HIL    +++ D    S   N D    +LNG + +++ +   I  +G FS  ++ ++   
Sbjct: 76   HILTW--SNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFSNDQRFKILKI 133

Query: 132  TLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF-EESRELPFHSQDKDKPGLLQ 190
              LTNFNDY HGS  F ++ ID P+ VS     D LK     +R+L   SQ+K+ P +  
Sbjct: 134  HPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK--SQEKETPLVQD 191

Query: 191  RTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDIVNMIYNTLKE 250
             ++++K+    F     + + W ++       Y+          +LF ++VN  +  +  
Sbjct: 192  LSQQSKS---SFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVNEAFIEIDS 248

Query: 251  EQRFQRFT-----NLYDIAYEYIESLLYQDIWNKLQEHYRDKILDF-------RLVSQLS 298
            ++ FQ+        L+ + ++Y+E  LY +IW+++ +   + + ++        L+   S
Sbjct: 249  KKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQHLIKHFS 308

Query: 299  LDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITG 358
            +  +D  FY+     F L  +  +E  +  +V+    +KS  SY++K  ++ ++L IIT 
Sbjct: 309  IVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQIITD 364

Query: 359  KNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGV--EDVFLHVQYLQSFYKDENTVKF 416
             N+      +      LIDAD L++L  L++ ++ +   D+  ++ YL+ F  DE++  F
Sbjct: 365  SNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSF 424

Query: 417  GALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPI-----NQ 471
            G L YT++T       F+ +S+  E+ I   +L    D LI+     DDL  +     N 
Sbjct: 425  GILNYTIAT-------FHMVSHVLENVIDWDRLKEKSD-LIEELIMTDDLSTLSSTFEND 476

Query: 472  FKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCL 531
             K    YR   GES+L+L I NK+N+   + L+ +EDI  +D +  D  +  STLL++ +
Sbjct: 477  KKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAI 536

Query: 532  KERNLEAAEILIEI-FQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWT 590
            +  N EAA IL+++ FQN     EL++Y N+ D   R + HY+   + IL+ IG++INW 
Sbjct: 537  RSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFINWK 596

Query: 591  LKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHI 650
             KD+ GRT LFTIFRSYDQ+ Y   +      A+ WY  N++ F+++DH D  G+SLLHI
Sbjct: 597  QKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHI 656

Query: 651  LKSQVSLLLKFEDLDINIP------NLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQ 704
            L++ +S+LL +   D NIP      N KG TPLM Y KY R DNI+ I+++ +LI  K Q
Sbjct: 657  LQNNISILLDYAK-DQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQ 715

Query: 705  KDKYLNCLDYGKNFTVFNLLAA-KLSKDVIFENAYISYARYEKS-------HWYLCISVQ 756
               +++C DY  + ++ N +    LS   +F    +   + + S         Y+  ++ 
Sbjct: 716  SPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTIL 775

Query: 757  KDDLEYTTNIIKLKKYYNLI---NAMQKIYKSDFIPYSDMLD----CLKKIIEGHN---I 806
             D+ + +T + K  K+ +L+     M++ Y   F+P   +L+     L K  + +N    
Sbjct: 776  IDEADKST-LTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRT 834

Query: 807  LPIR---RLKIKNYLNFLSHGLSALLYFE--KIDPLTLLDENLIIKWIS---SKLQQQEK 858
            +P+R   +L+I+ +L  L+  L  LL+F+   I    LL E  +++WIS   SKL++   
Sbjct: 835  IPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSST 894

Query: 859  SIDDHSSFKPLSA---------EDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKN 909
            +    S  +             E+IN I+ F  F+  E+   +  ++   KL IF  +K 
Sbjct: 895  TPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKT 954

Query: 910  TDLNTSYDILERLGSYFSNNE----ISRTLGDLQSISPHVHSSMVYYELSQDILFMKKCT 965
             D++ +      L    +N E    I ++   + S        ++   L +DI F  +CT
Sbjct: 955  LDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECT 1014

Query: 966  LILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKF------------------------ 1001
            L L   + + IK K+  W K   +LLE  K Y   F                        
Sbjct: 1015 LKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGNNANTNTNT 1074

Query: 1002 -----------LQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGT 1050
                       L  + E  N S N        N   + + ER+    + E    L+ LG+
Sbjct: 1075 NTNTNTNSPQRLHHHSEHQNNSNNGVFANLIEN--QKNKLERKTSHHIDETISLLESLGS 1132

Query: 1051 EIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093
             +  KHE LAEE + Y+  K++F    +++ FV  ++  L+E 
Sbjct: 1133 GLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEH 1175

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  353 bits (905), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 343/1192 (28%), Positives = 562/1192 (47%), Gaps = 163/1192 (13%)

Query: 10   NPLINAVFNC--PDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFR----- 62
            NPLI  +F+    D    P KKL+ +L+   F+LL P   ILL Y DS SNI+ R     
Sbjct: 7    NPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDS-SNITPRNPYNG 65

Query: 63   -------ELCY-TYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQS-- 112
                   +LC  +YDF+A+HIL+ D         S   KN    ++S+NGK + +++   
Sbjct: 66   SNAKPLEDLCMNSYDFIASHILLYD---------SKVIKNDQCVMESINGKTITIKRVTG 116

Query: 113  ----------LCIPIKGYFSKRKS-QMRDATLLTNFNDYLHGSGHFGIMHIDYPL----- 156
                      +  P K Y + +K  ++    L  NFN YL G  ++ I +IDYPL     
Sbjct: 117  NGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNII 176

Query: 157  -----GVSDWTLID------------ELKGFEESRELPFHSQDKDKPGLLQR-----TEE 194
                    D  LI+            +L+   + +     +  K +P + Q      T+ 
Sbjct: 177  KNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKL 236

Query: 195  NKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ-NIGSELFHDIVNMIYNTLKEEQR 253
             K DRV +  L    +  T  +E+     QA++  Q ++  E+  DI   ++  LK+E+R
Sbjct: 237  IKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKR 296

Query: 254  FQRFT--NLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLDMLDTTFYN-RT 310
            +   +  NL ++ YE+IE  L+ DIW ++   + +   DF  +S +S++ L   FY+   
Sbjct: 297  YNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNN 356

Query: 311  FKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDNTL 370
            FKNF+L DIV ME  + +AV+ F+   +  ++ +K   + KTL I+T             
Sbjct: 357  FKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTIN----------- 405

Query: 371  PKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATL 430
                L DADTL+ L ++++CR  V ++  H+ YLQ+F  D NT+KFG LGY++ST+EA  
Sbjct: 406  ---KLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAIT 462

Query: 431  SYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFK----DYFRYRTQYGESI 486
             YF  +S+S ++         L  F  K+ + +D ++  N  K    D   YR+Q GES+
Sbjct: 463  YYFDHISHSHKAD--------LIAFCDKLHNLYDTIL--NNIKSLDNDILSYRSQNGESL 512

Query: 487  LSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIF 546
            LSL I N K +   E L  +E  FP++D+L D+D++GS+LL++  K  N  A+EIL+ I 
Sbjct: 513  LSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTIL 572

Query: 547  QNSCTNSELLNYYNKTDKTKRTLAHY--ITDEIEILEKIGKYINWTLKDLKGRTALFTIF 604
            +NSC   EL  + NKTDK  R++AHY  + + I IL + G  I+W LKD+K  T L TIF
Sbjct: 573  KNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIF 632

Query: 605  RSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLK---- 660
            + +      S IKI     L WYK ++  F +  H D  G++LLH++K  ++ L++    
Sbjct: 633  KVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPEL 692

Query: 661  FEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTV 720
             E ++IN  N KG++P M Y K NR DNI+ IL++  LI  + Q    +   +   N  V
Sbjct: 693  CETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNL-YNSKV 751

Query: 721  FNLLAAKLSKDVIFENAYISYARYEKSH---------WYLCISVQKDDLEYTTN------ 765
             +LLA    + + F    +   R+             W + IS+ + + E+ T+      
Sbjct: 752  NHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICR 811

Query: 766  --IIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHN---------ILP----IR 810
               +KLK   +L++   + YK   +P    L+    +I+ +N          LP    I 
Sbjct: 812  TKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLID 871

Query: 811  RLKIKNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWI------------SSKLQQQEK 858
            +L+I+  L  +S+ L+ L      D   L DE  +  ++            S+K   +  
Sbjct: 872  KLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNN 931

Query: 859  SIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDI 918
            S       K    EDIN I+ F  F+  E+    N I +   +SI  + K  DLN+S   
Sbjct: 932  SDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFF 991

Query: 919  LERLGSYFSNNEISRTLGDLQSISP---HVHSSMVYYE-------------LSQDILFMK 962
             ++       N +S  L    +  P   + ++S  +Y+             L ++++F +
Sbjct: 992  FQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFE 1051

Query: 963  KCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSEN-TSVFRYA 1021
            K    L           +  W     +LL++  +Y+  +     +  N  E+  ++F   
Sbjct: 1052 KLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKR 1111

Query: 1022 WNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKF 1073
             N       ER +   +      L++   +I+  HE LA E ++++  K+KF
Sbjct: 1112 VNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKF 1163

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  210 bits (534), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 233/844 (27%), Positives = 390/844 (46%), Gaps = 121/844 (14%)

Query: 269  ESLLYQDIWNKL-QEHYRDKILDFRLVSQLSLDMLDTT-FYNRTFKNFQLIDIVNMEACM 326
            E+ LY  IWNKL  +    + +D      +S   L+   +Y+  F  F L D+V +E  +
Sbjct: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238

Query: 327  VQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFA 386
              A   F  ++ + S+ +K+D++  T NI+T K          LP+L  IDAD L++   
Sbjct: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILTSK----------LPQLE-IDADNLLNFML 287

Query: 387  LLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQL 446
            +++ R  + ++  H  YLQ+F   +N   FG L Y +ST+ A L Y              
Sbjct: 288  IIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYY-------------- 332

Query: 447  QKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNF 506
                 +++ L K +   D +      ++  +YR + GES L   I  K N+ L E L + 
Sbjct: 333  -----IDNNLDKFKRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTLRELLFSS 387

Query: 507  EDI--FPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDK 564
            E I  FP++D+L D  + GSTLL+  +K  N  AA ILI I  N+ T  E+  Y N  D+
Sbjct: 388  EYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDE 447

Query: 565  TKRTLAHYITDEIEILEKIGKYINWTLKDLK-GRTALFTIFRSYDQTTYS------STIK 617
              R + H+IT++  +L KIG Y+NW  KD + G+T LF IFRSYDQ+  S       + +
Sbjct: 448  NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507

Query: 618  IALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPL 677
             A+D            F++  H D   ++LLHILK+ + ++L    L IN PN  GMTPL
Sbjct: 508  FAMDSG---------DFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPL 558

Query: 678  MTYVKYNRIDNIKTILED---GRLIIKKLQK--DKYLNCLDYGKNFTVFNLLAAKLSKD- 731
            M + KY R+ NI+ +L      R+ I + Q+  + + NC     +  + NLL     K+ 
Sbjct: 559  MVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNY 618

Query: 732  VIFENA-------YISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYYNLINAM--QKI 782
             IF N        ++  +++   + Y      K + +Y T    +K    LIN +     
Sbjct: 619  SIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTSNS 678

Query: 783  YKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLLDE 842
            + S F+P   + + L  I      +   + KI  ++N L+  L  +L+ E +     + E
Sbjct: 679  HVSSFLPLYKVFNELNGIAS----MISTKSKIL-FINNLNVILDTILFLELVPREGFILE 733

Query: 843  NLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK-- 900
              +  ++ +  Q++ K++   S  K L  EDIN I  F  F+  E+    N ++  L+  
Sbjct: 734  ARLKDYLRN--QRKIKTVATKS--KKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQM 789

Query: 901  ----LSIFGE-IKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVYYELS 955
                L +F + I   DL    D++  L +   N   +  + + Q +   + +++ + ++ 
Sbjct: 790  NSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNILISNFQILENSIDNTLHFLKVF 849

Query: 956  QDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENT 1015
            Q+                    +K+  W K N +L+   K      L SN +        
Sbjct: 850  QN--------------------EKIRKWWKLNNELINLTK------LASNSD-------D 876

Query: 1016 SVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNS 1075
             + R  +N   RKE   +L   + +  R + +L  +I V HE LA E +++++ K  F +
Sbjct: 877  DLLRSFFN---RKE---KLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFIT 930

Query: 1076 NLLV 1079
              LV
Sbjct: 931  RTLV 934

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  157 bits (398), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 156/291 (53%), Gaps = 13/291 (4%)

Query: 2   AYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISF 61
            Y +P L NPL+NA+FNCP+P  SP KKL+  L+ + F+LL P    LL Y D  S +  
Sbjct: 3   VYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPL 62

Query: 62  RELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKG 119
            +LCY  +F+ ++IL++ +NS        N  + D + ++L+GK V++  + ++   + G
Sbjct: 63  HDLCYNAEFINSYILLMTENSYI------NTNSRDSHYETLDGKTVVIQWKNNVIHALNG 116

Query: 120 YFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFH 179
           +  +R+ ++ +  +L NFNDY  G+  F I+ ID PL   ++   D L+ F    ++P +
Sbjct: 117 FHIRRRLKILETKILPNFNDYFEGAADFIILFIDQPLNC-EFVPNDYLQCFHNYEKIPKN 175

Query: 180 SQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHD 239
           +     P L    +  + +R  F  +         +L +    Y+ + P  +    +F  
Sbjct: 176 AH--AMPNL--SIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFES 231

Query: 240 IVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILD 290
           IV   ++ +K +  F+ F+NLYD+ ++Y E  LY DIW++L  H++   +D
Sbjct: 232 IVQQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVD 282

>ZYRO0E00528g Chr5 complement(32878..33987) [1110 bp, 369 aa] {ON}
           highly similar to gnl|GLV|KLLA0B03564g Kluyveromyces
           lactis KLLA0B03564g and similar to YPR191W
           uniprot|P07257 Saccharomyces cerevisiae YPR191W QCR2 40
           kDa ubiquinol cytochrome-c reductase core protein 2
          Length = 369

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 10/90 (11%)

Query: 772 YYNLINAMQKI-YKSDFIPYS---DMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSA 827
           YY  +NA+  + YK+ F PY     +L   K  +E HNI P+RR +   Y      GL  
Sbjct: 101 YY--VNALGNVLYKTSFRPYELPESVLPAAKHDLELHNICPVRRAEDLLYNITYRRGLGN 158

Query: 828 LLYFEKIDPLTLLDENLIIKWISSKLQQQE 857
            ++++ ++ +TL D    IK  +SK+  +E
Sbjct: 159 PVHYDGVEKVTLDD----IKEFASKVYTKE 184

>KAFR0B00530 Chr2 complement(108516..111212) [2697 bp, 898 aa] {ON}
           Anc_7.510 YER024W
          Length = 898

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 58/128 (45%), Gaps = 31/128 (24%)

Query: 359 KNSDDTIR-DNTLPKLPLID-ADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK---DENT 413
           KN  DT   +++LPKLPL D  DTL  L      +  +E ++    Y   +YK   D   
Sbjct: 15  KNGGDTFEFEDSLPKLPLPDLRDTLTYL------KKSLEPLY----YADGYYKHPLDPRQ 64

Query: 414 VKFGALGYTLSTIE---------ATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD 464
           +K  AL   LS  E         A L++++E  NS      L KL L  +     R  HD
Sbjct: 65  IK--ALDEILSNFEKSIASRKLHAKLAHYHETENS-----YLDKLHLDINNHTSTREVHD 117

Query: 465 DLIPINQF 472
           D++P N F
Sbjct: 118 DILPRNPF 125

>Kwal_47.18202 s47 complement(731252..731890) [639 bp, 212 aa] {ON}
           YDR304C (CPR5) - Cyclophilin D, Peptidyl-prolyl
           cis-trans isomerase D [contig 197] FULL
          Length = 212

 Score = 34.7 bits (78), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 6/64 (9%)

Query: 381 LVSLFALLLC-RAGVEDVFLHVQY--LQSFYKDENTVKFGALGYTLSTIEATLSYFYELS 437
           LVS+FALL+C RA  + V  H  +  +Q   KD   +  G  G   +    T++ FYELS
Sbjct: 7   LVSVFALLICARAATDAVVTHKVFFDIQHGDKDVGRIVIGLFG---NVAPKTVANFYELS 63

Query: 438 NSDE 441
            S++
Sbjct: 64  TSED 67

>TBLA0E00610 Chr5 complement(120051..120863) [813 bp, 270 aa] {ON}
           Anc_3.440 YPR116W
          Length = 270

 Score = 35.0 bits (79), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 923 GSYFSNNE---ISRTLGDLQSISPHV-HSSMVYYELSQDILFMKKCTLILTSKLASFIKD 978
            SY +N+E   + +  G  Q + P + HSS+  Y LS DI   K    I  +KL SFI+ 
Sbjct: 123 NSYLANSEAVLLKQIKGKYQWVPPSIIHSSVRKYNLS-DISIEKDAIEIYKNKLVSFIEQ 181

Query: 979 KLSIWLKKNTK 989
           KL I  KK+ K
Sbjct: 182 KLVIASKKDYK 192

>Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W
           (REAL)
          Length = 877

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 535 NLEAAEILIEIFQNS---CTNSELLNYYNKTD--KTKRTLAHYITDEIEILEKIGKYINW 589
           N  + ++L+E F N+   C+N +      + D  K K  L  Y++D  +I EK+GKY +W
Sbjct: 174 NTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKIRLQSYVSDSSKINEKVGKYKSW 233

Query: 590 TLKDLKGRTALFTIFR 605
            L+ L+ R    T  +
Sbjct: 234 -LETLQERITTLTSHK 248

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
           (REAL)
          Length = 877

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 521 VSGSTLLIKCLKERNLEAAEILIEIFQNS---CTNSELLNYYNKTD--KTKRTLAHYITD 575
            +G  +L   +   N  + ++L+E F N+   C+N +      + D  K K  L  Y+ D
Sbjct: 160 TNGKPILHTPVDTSNTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNVKLKARLQSYVFD 219

Query: 576 EIEILEKIGKYINWTLKDLKGRTALFTIFRSYDQT 610
             +I EK+GKY  W L+ L+ R    T  ++   T
Sbjct: 220 SGKINEKVGKYKTW-LETLQERITTLTSHKNNQDT 253

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
            (REAL)
          Length = 114

 Score = 32.3 bits (72), Expect = 1.7,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 11/74 (14%)

Query: 1005 NEETGNLSENTSVFRYAWNVTYRKEE-------ERRLKFAMLELERDLKKLGTEIRVKHE 1057
            NEE   L E+T V++   NV    E+       E+RL+F    +E ++K+    IR K E
Sbjct: 36   NEEFDQLKEDTPVYKLTGNVLLPVEQSEARGNVEKRLEF----IETEIKRCEKNIRGKQE 91

Query: 1058 ELAEEFSDYVRMKS 1071
            EL +  ++ V++ +
Sbjct: 92   ELEQVRNELVKLNN 105

>Ecym_3383 Chr3
           complement(726214..728388,728450..728491,728584..728595)
           [2229 bp, 742 aa] {ON} similar to Ashbya gossypii
           AFL199C 2-introns
          Length = 742

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 14/77 (18%)

Query: 808 PIRRLKIKNYLNFLSHGLSALLYFE----------KIDP----LTLLDENLIIKWISSKL 853
           P+RR   + Y NFL  G    +Y             + P    +  L E+ II+ IS+K+
Sbjct: 283 PLRRSLFQVYSNFLPKGSKPFIYLSLVIAPANVDVNVHPTKREVRFLHEDEIIECISNKV 342

Query: 854 QQQEKSIDDHSSFKPLS 870
           Q++ + I    SFKP S
Sbjct: 343 QEELQKIASSKSFKPGS 359

>NDAI0H00870 Chr8 complement(195210..196154) [945 bp, 314 aa] {ON}
           Anc_5.623 YDR262W
          Length = 314

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 70  FVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQS 112
           FV +HI+  D N S         K G+V LKS+NG E+LL+++
Sbjct: 228 FVRSHIVAYDDNRSN---ILETPKKGEVLLKSVNGNEILLKRN 267

>CAGL0F04389g Chr6 complement(437622..440642) [3021 bp, 1006 aa]
           {ON} similar to uniprot|P38065 Saccharomyces cerevisiae
           YBL037w APL3
          Length = 1006

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 7/108 (6%)

Query: 219 YLKKYQAMEPLQNIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWN 278
           Y K  Q  EPL   G+ LF + ++ I + +     F  FT  Y     + +++    I  
Sbjct: 550 YFKNSQTSEPLIKTGAFLFGEFIDQITDLISVADLFNIFTTKYFTVTNFTKAM----ILT 605

Query: 279 KLQEHYR--DKILDFRL-VSQLSLDMLDTTFYNRTFKNFQLIDIVNME 323
            + + YR  D I    + + Q+ L  LD    +R+++   ++ I  ME
Sbjct: 606 TVMKLYRCSDSIYTGAVKIYQMELSSLDIELQSRSYEYLNILRIARME 653

>CAGL0A00473g Chr1 complement(51137..53497) [2361 bp, 786 aa] {ON}
           similar to uniprot|P25339 Saccharomyces cerevisiae
           YGL014w
          Length = 786

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 4/108 (3%)

Query: 513 DDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHY 572
           D ++   D++G+ ++ KCL++ N E ++ + +   N C   E+  + +     +R L H 
Sbjct: 576 DTVILSKDLNGNHVIQKCLQKLNPEDSQFIFDAAGNEC--GEIATHRHGCCVLQRCLDHG 633

Query: 573 ITDEI-EILEKIGKYINWTLKDLKGRTAL-FTIFRSYDQTTYSSTIKI 618
              +  ++ EK+ KYI+    D  G   + + I +  ++  Y  T KI
Sbjct: 634 TKTQFKDLCEKLLKYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKI 681

>KAFR0H01100 Chr8 (199377..202412) [3036 bp, 1011 aa] {ON} Anc_3.325
           YBL037W
          Length = 1011

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 52/112 (46%), Gaps = 5/112 (4%)

Query: 215 ELEKYLKKYQAMEPLQNIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQ 274
           +L  YL++ Q  EP+    + +  +  ++I   +   + F  FT+ Y  +    ++++  
Sbjct: 548 KLVDYLQENQTSEPILKSAAFIIGEYGDLISEKVTIPKLFNLFTDKYFASSNLTKAMILT 607

Query: 275 DIWN--KLQEHYRDKILDFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEA 324
            +    K Q      ++ F    Q+ L+ LD     R+F+  +LI +VN+ A
Sbjct: 608 TMMQLYKFQPEISSHVIKFF---QIELNSLDIELQRRSFEYLKLIQVVNLSA 656

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%)

Query: 957 DILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEY 997
           D   MKK  LI TS  A+   D L IWL+ NT +L+ ++++
Sbjct: 207 DYQIMKKLNLIETSTDANNKIDSLKIWLQSNTTILDFKRQF 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,418,802
Number of extensions: 6202359
Number of successful extensions: 23870
Number of sequences better than 10.0: 156
Number of HSP's gapped: 24584
Number of HSP's successfully gapped: 159
Length of query: 1107
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 987
Effective length of database: 39,721,479
Effective search space: 39205099773
Effective search space used: 39205099773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)