Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003206.19ON34234216280.0
Kpol_1037.246.19ON36633412141e-167
KNAG0M011506.19ON30731010961e-150
Smik_15.1756.19ON31232110761e-147
Suva_15.1816.19ON33631810781e-147
CAGL0E02717g6.19ON32528310741e-146
YOR006C (TSR3)6.19ON31332110721e-146
Skud_15.1676.19ON31232210681e-146
TDEL0G045006.19ON30128210411e-142
SAKL0E01144g6.19ON43024310421e-140
KLLA0D01111g6.19ON31428110261e-139
ZYRO0C07832g6.19ON28124310051e-137
ACR007W6.19ON3133299941e-134
NCAS0H008106.19ON3233329781e-132
Ecym_30236.19ON3492439671e-130
Kwal_56.224216.19ON3373459651e-130
NDAI0D007906.19ON4013579591e-128
KLTH0C11264g6.19ON3463259401e-126
TBLA0A072506.19ON3043289111e-122
KAFR0L003906.19ON3293248891e-118
CAGL0E03454g4.46ON867104703.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00320
         (342 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   631   0.0  
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   472   e-167
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   426   e-150
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   419   e-147
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   419   e-147
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   418   e-146
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   417   e-146
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   416   e-146
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   405   e-142
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   405   e-140
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   399   e-139
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   391   e-137
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   387   e-134
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   381   e-132
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   377   e-130
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   376   e-130
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   374   e-128
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   366   e-126
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   355   e-122
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   347   e-118
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    32   3.6  

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/342 (96%), Positives = 330/342 (96%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 241 TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDALGNI 300
           TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLI            VRYDALGNI
Sbjct: 241 TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLISEEENESEEEEEVRYDALGNI 300

Query: 301 IESEEEAAELKYDSLGNLIEDDEQEVEEDLARTTEKLKKLET 342
           IESEEEAAELKYDSLGNLIEDDEQEVEEDLARTTEKLKKLET
Sbjct: 301 IESEEEAAELKYDSLGNLIEDDEQEVEEDLARTTEKLKKLET 342

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  472 bits (1214), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 234/334 (70%), Positives = 269/334 (80%), Gaps = 19/334 (5%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGAN-SKEAGFPVKLAMWDF 59
           MAKGKNK  E R+GKPSRGSNGH ++ NHK MEMK      G N S++  FPVKLAMWDF
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMK----KYGKNISQDDKFPVKLAMWDF 56

Query: 60  DHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECS 119
           DHCDPKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGKGV+CP+D+E VEEFGASVVECS
Sbjct: 57  DHCDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECS 116

Query: 120 WARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELL 179
           WARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D AAELL
Sbjct: 117 WARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELL 176

Query: 180 EHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQG 239
            +FSWGLGFLE+N+ELL++YQ+CTDSESVKK EEEWL KI++E+QERK+Q+RE DIW+ G
Sbjct: 177 SNFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMG 236

Query: 240 NTNRDLQDMSDDEEFDSEQY-----YSEENTERKIRYDNLGNVL----IXXXXXXXXXXX 290
           NTNR++    D+EE +S +      Y EEN  +  RYDNLGN++                
Sbjct: 237 NTNRNMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESEEDYDDYDDEEDRV 296

Query: 291 XVRYDALGNIIESE-----EEAAELKYDSLGNLI 319
            V+YD+LGNIIE+      EE  EL+YDSLGNLI
Sbjct: 297 EVKYDSLGNIIENSDYEQYEEEKELRYDSLGNLI 330

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  426 bits (1096), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 210/310 (67%), Positives = 245/310 (79%), Gaps = 12/310 (3%)

Query: 2   AKGKNKSSETRSGKPS-RGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
            KGKNKS    + + S +GSNGH +R NHKRME++  +   G       FPVK+AMWDFD
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTK-----FPVKMAMWDFD 58

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCPDD+  VEEFGASVVECSW
Sbjct: 59  HCDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSW 118

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDEVPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA++LL 
Sbjct: 119 ARLDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLS 178

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           +FSWGLGFLELNKELLE+YQKCTD ESVKK EE+WL KI++E Q+RK+++R+GDIW+ GN
Sbjct: 179 NFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGN 238

Query: 241 TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDALGNI 300
            NR++  M+       E+   EE     IRYDNLGN +I            +RYD LGN+
Sbjct: 239 VNRNMNKMT----LSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEISSIRYDNLGNV 294

Query: 301 I--ESEEEAA 308
           I  ES+EEA+
Sbjct: 295 IVDESDEEAS 304

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/321 (66%), Positives = 246/321 (76%), Gaps = 11/321 (3%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK+ E ++G+P RG+NGH +R NH+RMEMK+ N      S +  FPVKLAMWDFD
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYEN------SDKVKFPVKLAMWDFD 54

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDD E VE+ GASVVECSW
Sbjct: 55  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSW 114

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELL 
Sbjct: 115 ARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLS 174

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWG+GFLELNKELLE+YQ+CTD++SVK+ EEEWL+K++KE QERKSQ++E DIW+ GN
Sbjct: 175 HFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGN 234

Query: 241 TNRDLQDMSDDEEFDSEQYYSEENTERK--IRYDNLGNVLIXXXXXXXXXXXXVRYDALG 298
            NR       DE          E+   K  + YD+LGN +                D   
Sbjct: 235 INRRGGGWQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEEN 294

Query: 299 NIIESEEEAAELKYDSLGNLI 319
           ++ E++E  +   YDSLGNLI
Sbjct: 295 DLEENKEPVS---YDSLGNLI 312

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  419 bits (1078), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 209/318 (65%), Positives = 239/318 (75%), Gaps = 23/318 (7%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK+ E ++G+P RG+NGH +R NHKRMEMK+ N      S+   FPVKLAMWDFD
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDN------SEMTNFPVKLAMWDFD 78

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDD E VE+ GASVVECSW
Sbjct: 79  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSW 138

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ LL 
Sbjct: 139 ARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLS 198

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWGLGFL+LN+ELLE+YQKCTDS SVKK EEEWL+K++KE QERKSQS++ DIW+ GN
Sbjct: 199 HFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGN 258

Query: 241 TNR--DLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXX---------- 288
            NR  +     + E  +       E+ ++ I YD+LGN +                    
Sbjct: 259 VNRKDNGAQSDESESEEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKMLSEGSEDEES 318

Query: 289 -----XXXVRYDALGNII 301
                   V YD+LGNII
Sbjct: 319 EFEEDEEPVSYDSLGNII 336

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  418 bits (1074), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 231/283 (81%), Gaps = 11/283 (3%)

Query: 2   AKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDH 61
            KGKNKS +      S GSNGHHTR NH+ MEMK+        SK++ FPVKLAMWDFDH
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGG-----SKDSSFPVKLAMWDFDH 58

Query: 62  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWA 121
           CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGK VVCPDD+E VE  GASVVECSWA
Sbjct: 59  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWA 118

Query: 122 RLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEH 181
           RL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA ELL H
Sbjct: 119 RLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSH 178

Query: 182 FSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGNT 241
           FSWGLGFLELNK+LLE YQ+CTDSES+KKVEE+WL++ID+EVQERK +++  D+W+ GNT
Sbjct: 179 FSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNT 238

Query: 242 NR------DLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVL 278
           NR         D  ++ E ++E+   +  T + +RYDNLGN++
Sbjct: 239 NRGNSGLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII 281

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  417 bits (1072), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 211/321 (65%), Positives = 240/321 (74%), Gaps = 11/321 (3%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK  E ++G+P RG+NGH +R NH+RMEMK+ N      S++  FPVKLAMWDFD
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDN------SEKMKFPVKLAMWDFD 54

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDD E VE+ GASVVECSW
Sbjct: 55  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSW 114

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELL 
Sbjct: 115 ARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLS 174

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWG+GFLELNKELLE+YQ+CTD +SVK+ EEEWL+K++KE QERKS+++E DIW+ GN
Sbjct: 175 HFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGN 234

Query: 241 TNRDLQDMSDDEEFDSEQYYSE--ENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDALG 298
            NR       D     E       E   + I YD+LGN +                D   
Sbjct: 235 INRRGNGSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKSREAQSEESEDEES 294

Query: 299 NIIESEEEAAELKYDSLGNLI 319
              E+ E    L YD LGNLI
Sbjct: 295 GSKENGE---PLSYDPLGNLI 312

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  416 bits (1068), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 246/322 (76%), Gaps = 13/322 (4%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK+ E ++ +  RG+NGH  R NHK MEMK+        S++  FPVKLAMWDFD
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDK------SEKMKFPVKLAMWDFD 54

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCP+D E VE+ GASVVECSW
Sbjct: 55  HCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSW 114

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARL+EVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG++D A+ELL 
Sbjct: 115 ARLEEVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLS 174

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWGLGFL+LNKELLE+YQ+CTD++SVKK E+EWLEK++ E QERKS +++ DIW+ GN
Sbjct: 175 HFSWGLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGN 234

Query: 241 TNRDLQDMSDDE---EFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDAL 297
            NR    +  DE     DSEQ    EN+E+ I YD LGN +             V  D  
Sbjct: 235 INRRGNGVQSDELESGEDSEQ-SGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEE 293

Query: 298 GNIIESEEEAAELKYDSLGNLI 319
            +  E+E+    + YDSLGNLI
Sbjct: 294 SDFGENEK---PVNYDSLGNLI 312

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  405 bits (1041), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/282 (70%), Positives = 231/282 (81%), Gaps = 11/282 (3%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M+KGKNK+ E ++G   +GSNGH +R NHKRMEMK         +++  FPVKLAMWDFD
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMK-------RGTEDTKFPVKLAMWDFD 53

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDDK  VEE GASVVECSW
Sbjct: 54  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSW 113

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELL 
Sbjct: 114 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLS 173

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWGLGFLELN+ELLE+YQ+CTD++SVK  E  WL KI KEV+ERKSQ+++ DIW+ GN
Sbjct: 174 HFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGN 233

Query: 241 TNRD----LQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVL 278
            NR     L D  ++E  + E+   EE+  + +RYD LGN++
Sbjct: 234 VNRKGTTFLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  405 bits (1042), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/243 (77%), Positives = 210/243 (86%), Gaps = 4/243 (1%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK+ E RS +P RG+NGH +R NHKRMEMK     +  N     FPVKLAMWDFD
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNK----FPVKLAMWDFD 56

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCP+D+  VEE GASVVECSW
Sbjct: 57  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSW 116

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDEVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+ELL 
Sbjct: 117 ARLDEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLS 176

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           +FSWGLGFLELNKELLE+YQ+CTD++SVK  EE WL+KI++E Q+RK QS+E DIW+ GN
Sbjct: 177 NFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGN 236

Query: 241 TNR 243
            NR
Sbjct: 237 VNR 239

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  399 bits (1026), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 196/281 (69%), Positives = 226/281 (80%), Gaps = 10/281 (3%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK S TR  +  +GSNGH +R NHKRMEMK  ++ T      + FPVKLAMWDFD
Sbjct: 1   MGKGKNKESSTRP-RSQKGSNGHSSRLNHKRMEMKHVDSTT------SKFPVKLAMWDFD 53

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRVGQKFQG+VVSPNGK VVCPDDK  VEE GASVVECSW
Sbjct: 54  HCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSW 113

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDEVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLAA+LL 
Sbjct: 114 ARLDEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLS 173

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           +FSWG  FLELNKELL++YQ+CTD +SVK  EE+WL+KI++E  ERK Q++  DIW+ GN
Sbjct: 174 NFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGN 233

Query: 241 TNRDLQDMSDDEEFDSEQYYSEENT---ERKIRYDNLGNVL 278
            NR  +D+      + E+ Y   ++    R I+YD+LGNV+
Sbjct: 234 VNRASRDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  391 bits (1005), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 178/243 (73%), Positives = 209/243 (86%), Gaps = 3/243 (1%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KGKNK+ E RS +P RG+NGH+++ NHK MEMK    G  +NS +  FPVKL MWDFD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKH---GGASNSNKTNFPVKLGMWDFD 57

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG GVVCP+DK  VEE GASVVECSW
Sbjct: 58  HCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSW 117

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDEVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELL 
Sbjct: 118 ARLDEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLS 177

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           +FS+G  FLE+N ELLE+YQ+CTD+ESVK  E  WLEKI+KE+++RK+Q++  DIW+ GN
Sbjct: 178 NFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGN 237

Query: 241 TNR 243
            NR
Sbjct: 238 VNR 240

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  387 bits (994), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/329 (58%), Positives = 238/329 (72%), Gaps = 36/329 (10%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           MAKGKNK +E R  KP++GS+ H+ ++N +R E+K        ++KE  FP KLAMWDFD
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKH------GHTKETEFPAKLAMWDFD 53

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+DKE VE+ G SVVECSW
Sbjct: 54  HCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSW 113

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARLDE+PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELL 
Sbjct: 114 ARLDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLS 173

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWG GFLELN+ELLE YQ+CTD  S+K  EE WL+K+++E ++R+ Q+ E DIW+ GN
Sbjct: 174 HFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGN 233

Query: 241 TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDALGNI 300
            NR   +M       S    S++N++ +   D                   V +D + + 
Sbjct: 234 VNRKAPNMR------SSMLDSDDNSDSEYASD-------------------VDHDLVSDT 268

Query: 301 IESEEEAA----ELKYDSLGNLIEDDEQE 325
            E E+ A     ++ YDSLGN+IE+  +E
Sbjct: 269 EEGEDIAIGSKRDVTYDSLGNVIENGRRE 297

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  381 bits (978), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 252/332 (75%), Gaps = 20/332 (6%)

Query: 1   MAKGKNKSSET--RSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWD 58
           M KGKNK  +     G+  RG+NGH +R NHK MEM+       +N K+   PVKL MWD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKK--IPVKLGMWD 58

Query: 59  FDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVEC 118
           FDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV P+D + ++EFGA+VVEC
Sbjct: 59  FDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVEC 118

Query: 119 SWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDL 174
           SWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR D 
Sbjct: 119 SWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDW 178

Query: 175 AAELLEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGD 234
           AA+LL +FSWG+ FL LN+EL E+Y +CTDS+S+++ +E WL KID+E +ERK Q+++ D
Sbjct: 179 AADLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDND 238

Query: 235 IWLQGNTNR---DLQD--MSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXX 289
           IWL GNTNR   +L+D  +SD +E + E+   +  TE+ ++YDNLGNV+           
Sbjct: 239 IWLMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVI-----ESSEDE 293

Query: 290 XXVRYDALGNIIESEEEAAELKYDSLGNLIED 321
             +RYD LGN+IE EEE    +YD+LGNLIE+
Sbjct: 294 ITLRYDNLGNVIEEEEEEK--RYDALGNLIEN 323

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  377 bits (967), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 174/243 (71%), Positives = 202/243 (83%), Gaps = 8/243 (3%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           M KG+NK  +    +  +GSNGH +RTNH+R+E K+ NA  G+      FPV LAMWDFD
Sbjct: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKY-NAIQGSK-----FPVTLAMWDFD 52

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLERLGLIKSLRV QKFQGIVVSPNGK VVCP+D+E  E++G SVVECSW
Sbjct: 53  HCDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSW 112

Query: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180
           ARL+E+PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA  LL 
Sbjct: 113 ARLEEIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLS 172

Query: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240
           HFSWGLGFLELNKE+LE+YQKCTD +S+K  EE WL++I+ E  ER+ Q++E DIW+ GN
Sbjct: 173 HFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGN 232

Query: 241 TNR 243
            NR
Sbjct: 233 VNR 235

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  376 bits (965), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 199/345 (57%), Positives = 244/345 (70%), Gaps = 36/345 (10%)

Query: 12  RSGKPSRGSN----GHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDHCDPKRC 67
           + G+ ++GSN    GH  R++   +E K      GA++    FPVKLAMWDFD CDPKRC
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKH-----GAHNNGRNFPVKLAMWDFDQCDPKRC 57

Query: 68  SGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWARLDEVP 127
           SGKKLERLG+IKSLRVGQKFQGIVVSPNGKGVVCP+DK+ VEE GA+VVECSWARL+E+P
Sbjct: 58  SGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIP 117

Query: 128 FNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEHFSWGLG 187
           FNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA ELL HFSWGLG
Sbjct: 118 FNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLG 177

Query: 188 FLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGNTNR---- 243
           FLELNKEL+E+YQKCTD+ESVK+ E  WLEKI++E  ER++ S   D+W+ GN NR    
Sbjct: 178 FLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPL 237

Query: 244 ------------DLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXX 291
                       +  D  D+E+ D+E  Y+  N +R ++YDNLGN +             
Sbjct: 238 GNDTESSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEIYPSESSESSEER- 296

Query: 292 VRYDALGNIIESEEEAAELKYDSLGNLI--EDDEQEVEEDLARTT 334
              D L      E+E  + K+DSLGN+I  E +   + E L++ T
Sbjct: 297 ---DDL-----DEQEEVKYKFDSLGNIIGKEHENGTLNESLSKLT 333

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  374 bits (959), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/357 (56%), Positives = 249/357 (69%), Gaps = 37/357 (10%)

Query: 1   MAKGKNKSSETRSGKP--SRGSNGHHTRTNHKRMEMKFSNAGTGA---NSKEAGF----- 50
           M KGKNKS +     P   RG+NGH +R NHK MEMK  N  T     N  + G      
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 51  ----PVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKE 106
               PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 107 TVEEFGASVVECSWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 162
            ++EFGA+VVECSWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 163 AACFAIVGRVDLAAELLEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKE 222
           AACFAI+GR D A++LL +FSWGL FL+LN+EL E+Y KCTDS+SVK  +EEWL+KI++E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 223 VQERKSQSREGDIWLQGNTNR---DLQDMS--------DDEEFDSEQYYSEENTERKIRY 271
             ERK Q++E DIW+ GNTNR   +L+ M+        ++E  + E         +++RY
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRY 344

Query: 272 DNLGNVL-IXXXXXXXXXXXXVRYDALGN-------IIESEEEAAELKYDSLGNLIE 320
           DNLGNV+              +RYD LGN         E +EE  EL+YDSLGN+IE
Sbjct: 345 DNLGNVIEDTDEEYLSEEEKEIRYDNLGNIIESEEEEEEEKEEGIELRYDSLGNIIE 401

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  366 bits (940), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 228/325 (70%), Gaps = 24/325 (7%)

Query: 2   AKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDH 61
            KG NK     S KPS G    HT T H+ +E K      GAN     FPVKLAMWDFD 
Sbjct: 7   GKGSNKQRGAHSSKPSSG----HTST-HRHVESKH-----GANKSGKNFPVKLAMWDFDQ 56

Query: 62  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWA 121
           CDPKRCSGKKLERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D+  VEE GA+VVECSWA
Sbjct: 57  CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWA 116

Query: 122 RLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEH 181
           RLDEVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA ELL H
Sbjct: 117 RLDEVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSH 176

Query: 182 FSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGNT 241
           FSWGL FLELNKELLE+YQ+CTD++S+KK E+ WLE+I+KE QERK+++   D+WL GN 
Sbjct: 177 FSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNV 236

Query: 242 NRD-----LQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDA 296
           N        Q+ + DE      +   EN+E +                       V+YD+
Sbjct: 237 NHKKGHGVTQNENKDEAEVGSTWEQGENSEYESDE--------SAADGEEAYHGPVKYDS 288

Query: 297 LGNIIESEEEAAELKYDSLGNLIED 321
           LGN I +  E+++ +Y     L+E+
Sbjct: 289 LGNEI-TLSESSDPEYSDSEELLEE 312

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 188/328 (57%), Positives = 230/328 (70%), Gaps = 30/328 (9%)

Query: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60
           MAKGKNK  E RS + S          N +R E K S       S +  FPVKLAMWDFD
Sbjct: 1   MAKGKNKGHEERSNRKS---------NNSRRNESKHS---LSIKSTKTNFPVKLAMWDFD 48

Query: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120
           HCDPKRCSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D+ET+E++G +VVECSW
Sbjct: 49  HCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSW 108

Query: 121 ARLDEVPFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAEL 178
           ARLDEVPFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A+++
Sbjct: 109 ARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKV 168

Query: 179 LEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQ 238
           LE FSWG  FLELN ELL++Y  CTDS SV+K ++EWLEKI+ E +ERK +    D WL 
Sbjct: 169 LEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLI 228

Query: 239 GNTNRDLQDMSDDEEFDSEQYYSEEN----TERKIRYDNLGNVLIXXXXXXXXXXXXVRY 294
           GNTNR  ++++D   FD+    +E+N    +    RYD LGN++             ++Y
Sbjct: 229 GNTNR--KNLND---FDNSSESTEDNISTVSSADERYDALGNLI-------SNDSHSLKY 276

Query: 295 DALGNIIESEEEAAELKYDSLGNLIEDD 322
           D+LGN+IESE +A   KYD LGN+IED+
Sbjct: 277 DSLGNVIESEGDALPPKYDKLGNIIEDN 304

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  347 bits (889), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 180/324 (55%), Positives = 229/324 (70%), Gaps = 34/324 (10%)

Query: 13  SGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDHCDPKRCSGKKL 72
           +G     SNGHH+R N+K+ME K         S+E  FPVKLAMWDFDHCDPKRCSGKKL
Sbjct: 16  NGAIRTNSNGHHSRHNNKKMEFK------QHVSRETSFPVKLAMWDFDHCDPKRCSGKKL 69

Query: 73  ERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWARLDEVPFNKIG 132
           ERL LI+SL++ QKFQGI VSPNGK  V P+D+E V EFG +VVECSWAR+DE+PF+K  
Sbjct: 70  ERLNLIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFS 129

Query: 133 G-KHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEHFSWGLGFLEL 191
             K +RLLPYLVAANQVNYGRPW+LNCVEA+AAC AIVG +DLA ELL HFSWG+ FL+L
Sbjct: 130 TPKLDRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKL 189

Query: 192 NKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKS--QSREGDIWLQGNTNRDLQDMS 249
           N+ELLE+YQ+CTDS+ ++  ++ W+++I+KEVQERK+   ++  DIW+ GN NR  +   
Sbjct: 190 NRELLEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDE--- 246

Query: 250 DDEEFDSEQYYSEENTERKIRYDNLGNVLIXXXXXXXXXXXXVRYDALGNII-------- 301
                  E    E++ + ++ YDNLGN++             VRYD LGNII        
Sbjct: 247 -----SDEDNEDEDSEDEEVTYDNLGNII-------ENEPREVRYDNLGNIIEESSEESS 294

Query: 302 --ESEEEAAELKYDSLGNLIEDDE 323
             E E+E  ++KYDSLGN+IE+ E
Sbjct: 295 GEEEEDEEEDVKYDSLGNVIEESE 318

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 134 KHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEHFSWGLGFLE--L 191
           K+E+  P L+ A +    +  ++  +E + A    VG +D A E L  F   L      L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 192 NKEL--LEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREG 233
           N+E+  L M QK TD++      E  + +++++++ +   S+E 
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKEN 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,710,356
Number of extensions: 1707156
Number of successful extensions: 10794
Number of sequences better than 10.0: 179
Number of HSP's gapped: 10814
Number of HSP's successfully gapped: 196
Length of query: 342
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 232
Effective length of database: 40,868,139
Effective search space: 9481408248
Effective search space used: 9481408248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)