Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003106.17ON67567531670.0
Kpol_1045.726.17ON69570415470.0
TDEL0G045206.17ON67971213720.0
ZYRO0C07876g6.17ON68171513131e-172
SAKL0E01100g6.17ON71072912051e-156
Ecym_30216.17ON67471011971e-155
Kwal_56.224116.17ON68971311711e-151
KNAG0M011406.17ON59467911571e-150
Skud_5.276.17ON61568011551e-149
KLTH0C11308g6.17ON69070111201e-143
ACR009W6.17ON68070011181e-143
YEL062W (NPR2)6.17ON61546811111e-143
KLLA0D01067g6.17ON66071610971e-140
Smik_5.256.17ON61536510751e-138
Suva_5.56.17ON61936910741e-137
TBLA0G010106.17ON71047410811e-137
CAGL0L13288g6.17ON64670910681e-136
NDAI0D008606.17ON66669110691e-136
NCAS0H008706.17ON6123679611e-121
KAFR0L003806.17ON5404676498e-76
Ecym_54352.616ON721138751.9
NCAS0B007208.765ON1272112725.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00310
         (675 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...  1224   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   600   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   533   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   510   e-172
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   468   e-156
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   465   e-155
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   455   e-151
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   450   e-150
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   449   e-149
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   436   e-143
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   435   e-143
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   432   e-143
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   427   e-140
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   418   e-138
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    418   e-137
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   421   e-137
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   416   e-136
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   416   e-136
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   374   e-121
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   254   8e-76
Ecym_5435 Chr5 complement(891353..893518) [2166 bp, 721 aa] {ON}...    33   1.9  
NCAS0B00720 Chr2 (105858..109676) [3819 bp, 1272 aa] {ON} Anc_8....    32   5.8  

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score = 1224 bits (3167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/675 (90%), Positives = 610/675 (90%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
           TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 361 LLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTAYPNHD 420
           LLSALPFKKGRKMVKNRR             LRQNLNSKASSFISDEGHHNDDTAYPNHD
Sbjct: 361 LLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNHD 420

Query: 421 SIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSXXX 480
           SIY                 MHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNS   
Sbjct: 421 SIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRD 480

Query: 481 XXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNI 540
                               CHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNI
Sbjct: 481 NFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNI 540

Query: 541 FSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVA 600
           FSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVA
Sbjct: 541 FSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVA 600

Query: 601 FKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELSRXXX 660
           FKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELSR   
Sbjct: 601 FKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELSREEV 660

Query: 661 XXXXXXXXXYRIINC 675
                    YRIINC
Sbjct: 661 ETLLNELTEYRIINC 675

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/704 (47%), Positives = 434/704 (61%), Gaps = 47/704 (6%)

Query: 5   FDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLTLK 64
           FDGF PIH IFYSVFHPTEG KV Y+FPP+NL    INFD+I++YVIPKPQLC+KLLTLK
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQCQF 124
           Y NYRI+GYPI IN S+YARNNFSFNLVFVFPYEC+TSPYE V+ +LGKMF  LE Q QF
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKCEKDMAYFDFK-LISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQD 183
           LSK EKD+AYFDFK ++ + +DQD S  +P+ +     N     + ++   +  +T+++ 
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQD-SKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSK- 181

Query: 184 KANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIK 243
               K   YLF KY  IQ ++ ND+   S+ D +MR++QDLN+YSEC IPID GNA+DIK
Sbjct: 182 ----KNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIK 237

Query: 244 LFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDA 303
           LFP L PP  +IS+EDVPI  VNL +IIDVNWDPTMLKIVP+IDG+NSI KIA LS+SD 
Sbjct: 238 LFPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDT 297

Query: 304 MLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLS 363
           +LVIECI+HF+YYGCV++SDIFQFSNIYAPTS + +FLTDP +ATECQ YVT PE S L 
Sbjct: 298 VLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLH 357

Query: 364 ALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEG--HHNDDTAYPNHDS 421
            LP +   K+    +              +  ++S+A+SF+S  G   HN++++  +   
Sbjct: 358 QLPLESLSKL----KLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSD 413

Query: 422 IYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSXXXX 481
           +Y                 ++ N   LPT+STLFDLYRSLSQGV L+EWY+ NF      
Sbjct: 414 LYLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNN 473

Query: 482 XXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQ-SYTYNI 540
                              C S+P+  N+E  +K+   K++QN  +  K+K Q   + +I
Sbjct: 474 GIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDI 533

Query: 541 FSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSING--------- 591
           FSTSDIK G DL +   +++ TLD+D+AD VL NVYKKL+       S N          
Sbjct: 534 FSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEK 593

Query: 592 -------QGQHP-----------SKVAFK---NQSYDNDLPGLMNNLGIEATKFSREINI 630
                  +  +P           SKV+F+   N  Y      +  N  I   +  R+ N 
Sbjct: 594 KSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQN- 652

Query: 631 NDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
             +  LL+AL+S ENLD IC  LE  R            +++IN
Sbjct: 653 --EQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/712 (44%), Positives = 406/712 (57%), Gaps = 72/712 (10%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F+GF+PIH IFY+VFHPTEGTKV YEFPP NL    INFDAIKNY+IPKPQLCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LTLKY NYRI  YP+ +NS +YARN FSFN VFVFPY+C+TSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQD-KSNTEPDNNILSKTNSMILPTISNIDTTVGST 179
           Q   LSK EKD  ++ FK +    DQD KS  E  ++ LSK+ +                
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQA---------------- 164

Query: 180 NTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNA 239
                       Y   KY+ I   I++     S+ D+++RV+QDLN+YSEC IPID+GNA
Sbjct: 165 ------------YASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNA 212

Query: 240 IDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299
           +DIK+FP + PP  +IS+EDVP+ TVNLNK+IDVNWDPTMLKIVPYI+GLNSI KIA LS
Sbjct: 213 VDIKIFPMMTPPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLS 272

Query: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359
            SD  LVIECI+H +YY CV+L+DIFQFSNIYAPTSS+  FLTD  L+TECQ YV   ED
Sbjct: 273 VSDPGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEED 332

Query: 360 SLLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGH-----HNDDT 414
           S L  LPFK+      N                 Q  +   ++ +S  G      +N+  
Sbjct: 333 STLPRLPFKR-----VNHSATESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMP 387

Query: 415 AYPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQIN 474
           A  + +S+Y                  +    YLPTKS LFDLYRSLSQG  L EWY ++
Sbjct: 388 ALISEESLYRTGKHSQSSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVH 447

Query: 475 FNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVK-NKS 533
           + +                       C+SYP+ KN E F     L         VK NK+
Sbjct: 448 YGTIRANRIDVRRFITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKA 507

Query: 534 QSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKL----STNGRPTTS- 588
           ++ + NIFSTSDIKFGV+      K    L++D+AD VL NVYKKL    ST+ RP ++ 
Sbjct: 508 KNPSKNIFSTSDIKFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSAD 567

Query: 589 --------------INGQ---------GQHPSKVAFKNQSYDNDLPGLMNNLGIEATKFS 625
                          +G             PSKV+F  Q     +   M++   +  K  
Sbjct: 568 PIARLYRERSLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSN-DKVKMD 626

Query: 626 REININDK---IYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
            E  +  +   + LL+++++A++LD IC  LE+SR            Y+IIN
Sbjct: 627 EEAKLERRERDLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIIN 678

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  510 bits (1313), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 317/715 (44%), Positives = 400/715 (55%), Gaps = 90/715 (12%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F+GFVPIH +FY+VFHPT+GT+V YE+PP NL  + INFDAIKNY+IPKPQLCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LTLKY  YRIV YP+ +NS  YARN FSFN VFVFPY+CETS YEP + RLGKMF  LE 
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQD-KSNTEPDNNILSKTNSMILPTISNIDTTVGST 179
           Q Q LSK E D  YFDFKL  N  +QD K N E     L+K+  M L             
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMAL------------- 181

Query: 180 NTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNA 239
                          +KYN I   ++++K   S+ D++MR+FQDLN+YSEC IPID+GNA
Sbjct: 182 ---------------AKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNA 226

Query: 240 IDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299
           +DIK+FP   PP   IS+EDVPI TVNL  IIDVNWDPTMLKIVPYIDGLNSI KIA LS
Sbjct: 227 VDIKIFPLKTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLS 286

Query: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359
           +SD  LV+EC++H VYY CVIL+DIFQFSNIYAPTS I  FLTDPTLA+ECQ +VT    
Sbjct: 287 DSDVSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGH 346

Query: 360 SLLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTA---- 415
           S LS +PF++ RK                   + Q+ N ++ S  +     +D  +    
Sbjct: 347 SSLSEMPFERLRKF--------------DLDDMDQSKNQESGSRTTSMSSKSDSKSKRPF 392

Query: 416 -YPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQIN 474
            Y    + Y                  H    +LPTK+ LFDLYR+LSQGV + EWY +N
Sbjct: 393 FYSAPRNPYRFNQRSQSSFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLN 452

Query: 475 FNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVK---- 530
           + +                       C S+P+ K    F   + L    N  ++ K    
Sbjct: 453 YQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKG 512

Query: 531 NKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPT---- 586
            K+ + +  +FSTSD+K G     +  K      VD+AD VL NVYKKLS    P     
Sbjct: 513 QKNLAESKYVFSTSDMKLG-----EGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDD 567

Query: 587 ---------------TSINGQG-QHP------SKVAFKNQSYDNDLPGLMN-----NLGI 619
                          ++++G    HP      SKVAF + + D+ +P  ++     N   
Sbjct: 568 YPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAF-DMNKDDPVPYSLSQQKGKNKER 626

Query: 620 EATKFSREININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
           EA K  R  N N KI LL+++ +A+ LD IC  LE  R            Y+IIN
Sbjct: 627 EAAKLDRAKN-NQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIIN 680

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  468 bits (1205), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 296/729 (40%), Positives = 390/729 (53%), Gaps = 75/729 (10%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M++ FDGFVPIH +FYSVFHPTEGTKV Y+FPP+NL  + INFD IKNYVIPKPQLC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LT KY  YR+  YP+ +N+S YARN+F+FN VFVFPY C TSPYEP V RLGKMF  LE 
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNL-------IDQDKSNTEPDNNILSKTNSMILPTISNID 173
           Q Q LSK E D  YF  K   +        +DQ  S+   D                  +
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDT-----------------E 163

Query: 174 TTVGSTNTQDKANSKEVE---YLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSEC 230
              G  N+QD     ++E       KY+ I + ++  K +LS+ D++ +++QDLN+YSEC
Sbjct: 164 QGTGLNNSQDSKEQGKIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSEC 223

Query: 231 YIPIDDGNAIDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLN 290
           +IPID GN++DIKLFP L PP   +S EDVPI TVNL K+IDVNWDPTMLKIVP+I+G+N
Sbjct: 224 FIPIDSGNSVDIKLFPLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVN 283

Query: 291 SIFKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATEC 350
           SI KIA  S+SD  LVIEC++H +YY CV+L+DIFQFSNIYA TS I++FLTDPTLA+EC
Sbjct: 284 SIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASEC 343

Query: 351 QIYVTSPEDSLLSALPFKKGRKMVK-NRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGH 409
           Q YVTS  D  L  LPF+    ++  +               +R + N   S     E  
Sbjct: 344 QTYVTS-SDLELYRLPFESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELS 402

Query: 410 HNDDTAYPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEE 469
              +    +  S                     ++R  LPTKS LFDLYRSL QG  ++E
Sbjct: 403 TRRNNFSSSSASSLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKE 462

Query: 470 WYQINFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIV 529
           WY+INF                         C++YP+ KN  A   L  LK+  +   + 
Sbjct: 463 WYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLR 522

Query: 530 K----NKSQSYTYNIFSTSDIKFGVDLY-------TDTKKKLHTLDVDVADRVLNNVYKK 578
           +     + +++T N+FST+DIK  VDL         +   + HT +VD+A+ VL + YKK
Sbjct: 523 RKLKFREKKNFTNNVFSTADIK--VDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKK 580

Query: 579 L----------------------------STNG-----RPTTSINGQGQHPSKVAFKNQS 605
           L                            ST G     R  +S   + +  SKVAF+   
Sbjct: 581 LSIIESMDDNLYHVHNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGR 640

Query: 606 YDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXX 665
               +         E      +   +++  LL +++S +  D IC  LE  R        
Sbjct: 641 SPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLK 700

Query: 666 XXXXYRIIN 674
               Y IIN
Sbjct: 701 EMGHYNIIN 709

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  465 bits (1197), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 291/710 (40%), Positives = 391/710 (55%), Gaps = 73/710 (10%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M+N FDGFVPIH IFYS+FHPTEGTKV ++FPP +L  SGI+FD IKNYVIPKPQLC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LT KY +YR+V YP+ IN+S YARN+FSF+ VFVFPY+  TSPYEP + RLGKMF  LE 
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLIS-NLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGST 179
           Q Q LSK E+D  Y+  K      +DQ+    E  NN                       
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNN---------------------PQ 159

Query: 180 NTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNA 239
           N  DK      E+ F KY+ I  +I  ++ QLS+ D++ ++++DLN+YSEC IP+D GNA
Sbjct: 160 NCNDKIRRGHHEHAFEKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNA 219

Query: 240 IDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299
           IDIKLFP L PP    SVEDVPI  +NL   +DVNWDPTM+KIVPYI+G+NSI KI+  S
Sbjct: 220 IDIKLFPLLAPPNSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYS 279

Query: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359
           +SD  LV+EC++H +YY CV+L D+FQFSNIYAPTS +++FLTDP++A ECQ+YV S ED
Sbjct: 280 DSDVGLVMECVKHLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSED 339

Query: 360 SLLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISD---EGHHNDDTAY 416
           S L  LPF +GR    + R                  N +  SF S+       N +T+ 
Sbjct: 340 SELHQLPF-EGRPNANHSRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSL 398

Query: 417 PNHDSIYXXXXXXXXXXXXXXXXXMHQN-----RNYLPTKSTLFDLYRSLSQGVKLEEWY 471
           P+  SI                   H+N        LPT+S LFDLYRSLSQG  +++WY
Sbjct: 399 PSEPSITHSSKNSEFN---------HENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWY 449

Query: 472 QINFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLN--DLKNLQNGPKIV 529
           ++NF                         C+SYP+ K+      L   D  +L N     
Sbjct: 450 KMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSP 509

Query: 530 KNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSI 589
           KN + +   N+FST+DI       +  +KK    + D AD VL + YKKLS N R    +
Sbjct: 510 KNNNSN---NVFSTADICVDFGEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPL 566

Query: 590 NGQGQHPSKVAFKNQSYDN------------------DLPGLMNNLGIE-------ATKF 624
           + Q     K++ +N +  N                  D+   ++N   E       +T+ 
Sbjct: 567 D-QITRSKKLSLENDASANVDNRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTEL 625

Query: 625 SREININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
            R+     +  LL ++++ ++ D I   LE+++            Y IIN
Sbjct: 626 KRK--RQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIIN 673

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  455 bits (1171), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 278/713 (38%), Positives = 384/713 (53%), Gaps = 62/713 (8%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M+  FDGFVP+H I Y++FHPTEGTKV ++FPP  L  S I FD IKNYVIPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LT KY ++R+V YP+ + +  YARN+FSF+ VFVFPY+C TSPYE  + RLGKMF  LE 
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK E    YF  K   +      +N EP N+                +   G+  
Sbjct: 121 QSQILSKAENSHVYFQLKTRDS---HKHTNQEPVND----------------NELQGTLK 161

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
             + + S+   Y F KY+ I   +     ++S+ D++ ++++DLN+YSEC IPID GNA+
Sbjct: 162 NNEASQSESHGYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAV 221

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIKLFP L PP   +S EDVP+PTVNL K+IDVNWDPTMLKIVPYI+G NSI K+A LS+
Sbjct: 222 DIKLFPLLSPPSSCLSFEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSD 281

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           SD  LV+ECIRH +YY CVIL+DIFQF NIYAPTS ++ FLT+P LATECQIYVT  E +
Sbjct: 282 SDCNLVVECIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDEST 341

Query: 361 LLSALPF-KKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFIS--DEGHHNDDTAYP 417
            +S LPF +K  +   N                 + ++ K SSF +  D+   N  T   
Sbjct: 342 HISDLPFERKPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQS 401

Query: 418 NHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNS 477
           +  SI                     N+ +  +KS LFD+YRSLSQG  ++EWY+ +F  
Sbjct: 402 HTSSIQCHNVSDASLGNSEGG---FNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEK 458

Query: 478 XXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSY- 536
                                  C+S+P+ KN      +  L  L +G    + K  S  
Sbjct: 459 IRAARIDVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKAL-GLSDGDSSTEGKWLSGN 517

Query: 537 ---TYNIFSTSDIKFGVDLYTDTKKKL---HTLDVDVADRVLNNVYKKLSTNGRPTTSIN 590
              T N+ S ++I+ G++  +   ++    H  + D A+ +LN+VY+KL+ N       +
Sbjct: 518 SEPTNNVLSAAEIRIGLESSSSKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQ-S 576

Query: 591 GQGQHPSKVAFKNQSYDN-----------------------DLPGLMNNLGIEATKFSRE 627
            Q  +P    F N S D+                       D+  L+N+   E  K    
Sbjct: 577 SQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEV 636

Query: 628 ININ-----DKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIINC 675
           + +      D++ LL +++  EN D IC+ L   R            Y +++C
Sbjct: 637 MRLEEDKRKDELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  450 bits (1157), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 267/679 (39%), Positives = 363/679 (53%), Gaps = 89/679 (13%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F+GFVPIH +FY++FHPTEG+KV Y+FPP NL    INFDAIKNY+IPKPQLCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LT+KY NYRIV YP+ + SS YARN F FN VFVFPYEC TSPYEP + RLGKMF  LE 
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LS+ E+D + F    +    +  K+     + ++SKT S                 
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSF---------------- 164

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
           + DK    ++                    +S+ D++MR++QDLN+YSEC IPID+GNAI
Sbjct: 165 SPDKKTEGDIHL------------------ISVQDLIMRIYQDLNNYSECLIPIDEGNAI 206

Query: 241 DIKLFPTLMPPID-SISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299
           DIK+FP + PP    +S+EDVP+  V L KIID+NWDPTM+ I+P+I+G+NSI  IA LS
Sbjct: 207 DIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLS 266

Query: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359
           +SD  LVIECI+H +YY CVI++DIFQFSNIYAP+S I +FLTDPT+A +CQ YVT P+ 
Sbjct: 267 DSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKS 326

Query: 360 SLLSALPFKK---GRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTAY 416
           S L  +P +    G +  K+++                  ++ +S F S       +++ 
Sbjct: 327 SRLIHMPLQTSVPGSRNNKHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSL 386

Query: 417 PNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFN 476
            +  +                      +  Y PT+  LFDLYRSLSQG+ LE+WY  NF 
Sbjct: 387 SSEGT--------------PGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFT 432

Query: 477 SXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSY 536
           +                         SYP+ +      + N +   Q G   +  K+   
Sbjct: 433 TIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEK-----RRNSIIAKQMGKSKMAEKAPHS 487

Query: 537 TYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHP 596
               FSTSDIKF                 D  DR+ N++Y + S       S   + ++ 
Sbjct: 488 KNAFFSTSDIKF-----------------DDGDRLFNSLYARFS-----KVSFEKRREN- 524

Query: 597 SKVAFKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELS 656
              A + +S+  D  G  N    E    ++E    +K+ LL AL + E+ D IC  L  S
Sbjct: 525 ---ARERKSF--DAVGGTNGADKETMILTKE----EKLQLLGALDNLESFDKICVQLGRS 575

Query: 657 RXXXXXXXXXXXXYRIINC 675
           R            YR+INC
Sbjct: 576 RVEIANLIADIGEYRVINC 594

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  449 bits (1155), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 279/680 (41%), Positives = 370/680 (54%), Gaps = 72/680 (10%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           +T KY  YRIV YP+ INS +YARN FSFN VFVFPY+CETSPYEP + RLGKMF  LE 
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK EKD  +FD K + N      S   P        ++   PT SN  +    T 
Sbjct: 121 QNQLLSKSEKDAVFFDLKALEN------STITP--------STAGAPTTSNPSSNTTPTY 166

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
                ++K++    S+YN +   +   +   S+ D+LMR+FQDLN+YSEC IPID+GNA+
Sbjct: 167 PTSDKDAKDLRS--SRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAV 224

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LS 
Sbjct: 225 DIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSR 284

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           SD  LVIECIRH +YY CV LSDIFQFSNIYAP+S I  FLTD  +A++CQ YV  PE S
Sbjct: 285 SDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEIS 344

Query: 361 LLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTAYPNHD 420
            +S+LP  K                      +  N +S+ +SF S+     + +   +  
Sbjct: 345 KMSSLPLSKNLDSADRDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFS 404

Query: 421 SIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSXXX 480
           S+                        +LPT+S LFDLYRSLSQG  L+ WY+        
Sbjct: 405 SVCKDWRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKE 464

Query: 481 XXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLND----LKNLQNGPKIVKNKSQSY 536
                               C+S+P+  N ++  +       LK+  N  + +K K+Q  
Sbjct: 465 NNIDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDA 524

Query: 537 TYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHP 596
           ++++  + +                                    +G+P    N + + P
Sbjct: 525 SFSVVGSKN------------------------------------SGQPN---NVKSERP 545

Query: 597 SKVAFKNQSYDNDLPGLMNNLGIEAT--KFSREININDKIYLLDALQSAENLDNICSNLE 654
           SKV+F+ Q   +   G       EAT  K S E    ++  L ++++SAE+ DNIC  L 
Sbjct: 546 SKVSFEMQRAGSLATG-------EATIPKLSDE----EERILENSIRSAESFDNICVLLS 594

Query: 655 LSRXXXXXXXXXXXXYRIIN 674
            S+            +++IN
Sbjct: 595 KSKLEVENYLNELGEFKVIN 614

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  436 bits (1120), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 274/701 (39%), Positives = 376/701 (53%), Gaps = 73/701 (10%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M+  FDGFVP+HGIFYSVFHPTEGTKV ++FP   L  S I FD IKNYVIPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LT KY  +R+V YP+ + +  YARN+FSF+ VFVFPY+C TSPYEP +ERLGKMF  LE 
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK E    YF  K  +    Q   NTE        +                S +
Sbjct: 121 QSQILSKAENSSVYFQLKARNT---QKHGNTETAKGTEQPS----------------SLD 161

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
             + A  +   Y  +KY  I   ++    ++++ D++ ++++DLN YSEC IPID GNA+
Sbjct: 162 IGEIAQPENQGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAV 221

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIKLFP L PP    S+EDVPI TVNL K+IDVNWDPTMLKIVP+I+G+NSI K+A  S+
Sbjct: 222 DIKLFPLLSPPSSCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSD 281

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           SD  LV+ECI+H +YY CVIL+DIFQFSNIYA T+ ++ FLT+PTLA ECQIYV   E +
Sbjct: 282 SDVNLVVECIKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESA 341

Query: 361 LLSALPFKKG--RKMVKNRRXXXXXXX-----XXXXXXLRQNLNSKASSFISDEGHH--- 410
            L  LPF++G  R    N R                  LR+N  +    F+S++  H   
Sbjct: 342 HLPNLPFERGPSRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQ 401

Query: 411 NDDTAYPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEW 470
           +  ++ P H++                   +        +KS LFDLYRSL+QG  + EW
Sbjct: 402 SRSSSIPYHNT--------SDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREW 453

Query: 471 YQINFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVK 530
           Y+ +F                          +SYP+ +N   F++  +     N  +  K
Sbjct: 454 YKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRNI-GFAESVEALGATNHSRYAK 512

Query: 531 NKSQSYT----YNIFSTSDIKFGVD---LYTDTKKKLHTLDVDVADRVLNNVYKKLSTNG 583
            K    T     N+ S +DI+ G++       ++K       D A+ VL++VY+KL+ + 
Sbjct: 513 YKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSD 572

Query: 584 RPTTSINGQGQHP-SKVAFKNQSYDNDLPG----------LMNNLGIEATKF-------- 624
           + T  +  QG +P SKV  +N     D+            + N +  +  K         
Sbjct: 573 KKTDHV-AQGNNPISKVFGRNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADE 631

Query: 625 --------SREININDKIYLLDALQSAENLDNICSNLELSR 657
                   S E   N+++ LL +++S  N D IC+ L   R
Sbjct: 632 RRRSEILRSIEEKRNEELILLKSVRSVHNFDKICTLLGKDR 672

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  435 bits (1118), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 270/700 (38%), Positives = 367/700 (52%), Gaps = 54/700 (7%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M N FDGFVPIH IFY++FHPTEGTKV ++FP  +L KSGI FD IKNYVIPK QLC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           +T K+ +YR+V YP+ I +  YARN+FSFNLVFVFPY+  TSPYEP + RL KM   LE 
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK E+D  Y+  K       + K+  E D+                       T+
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTE-ESDSK--------------------AKTH 166

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
             DK  S+      +KY+ I  +I +D+  L + D++ ++++DLN+YSEC IP+D GNAI
Sbjct: 167 NLDK-KSRAQHNATTKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAI 225

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIKLFP L PP   +S EDVPI  VNL  ++DVNWDPTMLKIVP+I+G+NSI KI+  S+
Sbjct: 226 DIKLFPLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSD 285

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           S   LV+ECI+H VYY CV L D+FQFSNIYAPT+ + DFL D  L  ECQ+YV S ED 
Sbjct: 286 SAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDC 345

Query: 361 LLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTAYPNHD 420
            +  LPF+       +R               R    ++A SF S+       +      
Sbjct: 346 EIHRLPFESRPNGGHSRNQTASTNTVYTLR--RTTSTNRADSFSSNAEFSQKSSGI---S 400

Query: 421 SIYXXXXXXXXXXXXXXXXXMHQN-RNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSXX 479
           S+                  +  N +  LPT+  LFDLYRSL+QG  L+EWY+ N+++  
Sbjct: 401 SLAQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIR 460

Query: 480 XXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYN 539
                                C+SYP+ K+      L     +      +   + S   N
Sbjct: 461 ENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGT-SAGNN 519

Query: 540 IFSTSDIKFGVDLYTDTKKKLHTLD-VDVADRVLNNVYKKLSTNGRPTTSIN--GQG-QH 595
           +FSTSDI+   D  + ++     L+  DVA+ VL   Y+KLS       SI+   +G Q 
Sbjct: 520 VFSTSDIRVDFDGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQA 579

Query: 596 PS--KVAFKNQSYDNDLPGL--------MNNLGIEATKFSREININD-----------KI 634
           PS  + A K  S    +  L        + N  +      RE    D           + 
Sbjct: 580 PSDNEAAMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEF 639

Query: 635 YLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
            LL +++S ++ D I   LE+++            Y I+N
Sbjct: 640 LLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  432 bits (1111), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 244/468 (52%), Positives = 301/468 (64%), Gaps = 16/468 (3%)

Query: 5   FDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLTLK 64
           F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+  KNY+IPKP LCHKL+T K
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLITFK 64

Query: 65  YNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQCQF 124
           Y  YRIV YP+ INS +YARN FSFN VFVFPY+CETSPYEP + RLGKMF  LE Q Q 
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 125 LSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQDK 184
           LSK E+D  +FD K++ N      S T P     S T     P  S+  T    T+ +D 
Sbjct: 125 LSKSERDPVFFDLKVLEN------STTTPSTAGPSST-----PNPSSNTTPTHPTSEKDT 173

Query: 185 ANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIKL 244
            + +      S+Y+ +   +   +   S+ D+LMR+FQDLN+YSEC IPID+GNA+DIK+
Sbjct: 174 KDMRS-----SRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKI 228

Query: 245 FPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDAM 304
           FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LSNSD  
Sbjct: 229 FPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPG 288

Query: 305 LVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLSA 364
           LVIECIRH +YY CV LSDIFQFSNIYAP+S I +FLTDP +A++CQ YVT PE S +S 
Sbjct: 289 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISN 348

Query: 365 LPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTAYPNHDSIYX 424
           LP  K                      +  N +S+ +SF S      + +   +  SIY 
Sbjct: 349 LPLNKSLGSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYK 408

Query: 425 XXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQ 472
                           ++    +LPT+S LFDLYRSLSQG  L+ WY+
Sbjct: 409 DWRQSQTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYE 456

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  427 bits (1097), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 289/716 (40%), Positives = 391/716 (54%), Gaps = 99/716 (13%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M ++FDGFVPIH +FY++FHPTEG+KV ++FPP++L    I+FD IKNY+IPKPQLC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LT KY  YRIV YP+ +N+  YARN+F+FN VFVFPY+C TSPYEP + RLGKMF  LE 
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK E++  YF          Q KSN   D+N   ++  M   TIS   T + ST 
Sbjct: 121 QSQILSKSEQNPVYF----------QLKSN---DSNAADQSTEMGSITISE-HTDIKSTG 166

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
              +      +YL     +I+   KN K  L + D+LM++F DLN+YSEC IPID+GN+I
Sbjct: 167 DDGE------KYL----EIIKELAKNQK-SLIIEDLLMKLFLDLNNYSECLIPIDEGNSI 215

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIKLFP   PP  +ISVEDVPI  VNL+ IIDVNWDPTM+KIVPYI+G+NS+ +IA  + 
Sbjct: 216 DIKLFPVRTPPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSAR 275

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           SD  LV ECI+H +YY CVILSDIFQFSNIYAPTS I +FLT+P +A  CQ++V    DS
Sbjct: 276 SDVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQG--DS 333

Query: 361 L-LSALPFK--------KGRKMV------KNRRXXXXXXXXXXXXXLR---QNLNSKASS 402
           L  S LPF+         GRK          RR             +R   +N  S +S+
Sbjct: 334 LKQSLLPFEGRPNNIYPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSST 393

Query: 403 FISDEGHHNDDTAYPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLS 462
                 H +++T+    +                     +Q +  LPT+S LFDLY+SLS
Sbjct: 394 SSYFRAHASENTSLATGE---------------------NQMKRILPTRSCLFDLYKSLS 432

Query: 463 QGVKLEEWYQINFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNL 522
           QG  +++WY+ NF                          +SYP+ KN   +  L  L  +
Sbjct: 433 QGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNVGTWDILKSL--V 490

Query: 523 QNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLD-VDVADRVLNNVYKKLST 581
              PK       S   NIFS +DIK       DTK++ +  D +D AD +L ++Y+KLS 
Sbjct: 491 SKEPKTHYGSGSS--KNIFSAADIKV-----VDTKEEGNQSDKLDAADELLKSLYQKLSL 543

Query: 582 NGRPTTSINGQGQH----PSKVAF-------------KNQSYDNDLPGLMN------NLG 618
                 +++   ++    PS  AF             +  S+D    G         +LG
Sbjct: 544 KQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLG 603

Query: 619 IEATKFSREININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
                   +    +++ LL++L +AE  D +C+ L+ SR            Y I+N
Sbjct: 604 DGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  418 bits (1075), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/365 (60%), Positives = 263/365 (72%), Gaps = 16/365 (4%)

Query: 5   FDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLTLK 64
           F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL+T K
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLITFK 64

Query: 65  YNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQCQF 124
           Y  YRIV YP+ INS +YARN FSFN VFVFPY+CETSPYEP + RLGKMF  LE Q Q 
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 125 LSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQDK 184
           LSK EKD  +FD K + N      S   P        ++   P  SN  +    T+    
Sbjct: 125 LSKSEKDPVFFDLKALEN------STIAP--------STACPPATSNTSSNTTPTHPTSD 170

Query: 185 ANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIKL 244
            ++K++    S+YN +    +  +   S+ D+LMR+FQDLN+YSEC IPID+GNA+DIK+
Sbjct: 171 KDAKDLRN--SRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKI 228

Query: 245 FPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDAM 304
           FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LSNSD  
Sbjct: 229 FPLLRPPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPS 288

Query: 305 LVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLSA 364
           LVIECIRH +YY CV LSDIFQFSNIYAP+SSI +FLTDP +A +CQ YVT PE S +S+
Sbjct: 289 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISS 348

Query: 365 LPFKK 369
           LP  K
Sbjct: 349 LPLNK 353

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  418 bits (1074), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/369 (59%), Positives = 262/369 (71%), Gaps = 11/369 (2%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           +T KY  YRIV YP+ INS +YARN FSFN VFVFPY+CETSPYEP + RLGKMF  LE 
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK E+D  +FD K I N +    +   P     S  +S   PT          T+
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPAT---SNPSSNTTPT--------HPTS 169

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
            +D  + +   +   KYN I   +   +   S+ D+LMR+FQDLN+YSEC IPIDDGNA+
Sbjct: 170 DKDAKDLRSNRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAV 229

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+  S+
Sbjct: 230 DIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSH 289

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           SD  LVIECIRH +YY CV LSDIFQFSNIYAP+S I +FLTDP +AT+CQ YVT PE S
Sbjct: 290 SDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEIS 349

Query: 361 LLSALPFKK 369
            LS LP  K
Sbjct: 350 KLSNLPLNK 358

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 90/234 (38%), Gaps = 45/234 (19%)

Query: 441 MHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSXXXXXXXXXXXXXXXXXXXXXXX 500
           + +   +LPT+S LFDLYRSLSQG  L+ WY++ F +                       
Sbjct: 430 ISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYR 489

Query: 501 CHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKL 560
           C+S+P+  +  +     D K +      V  K  S   N     D               
Sbjct: 490 CYSFPVMIHVGS----RDTKEMTP----VATKEPSNEDNSLKKRDYN------------- 528

Query: 561 HTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVAFKNQSYDNDLPGLMNNLGIE 620
           H+L V               T  + TT  N + + PSKV+F+ Q          N+L   
Sbjct: 529 HSLSV---------------TGSKSTTQTNVKSERPSKVSFEMQR--------ANSLATG 565

Query: 621 ATKFSREININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
             K  + ++  +K  L  +++SAEN D IC  L  S+            +++IN
Sbjct: 566 KNKIPK-LSDEEKKILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVIN 618

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  421 bits (1081), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 240/474 (50%), Positives = 301/474 (63%), Gaps = 48/474 (10%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F+GFVPIH +FYS+FHPTEGTKV YEFPP NL    INFD IKNY+IPKPQLCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LTLKY +YR+V YP+ INSSLYARN FSFN VFVFP  CETSPYEP++ RLGKMF  LE 
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QCQFLSKCEKDMAYFD--FKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGS 178
           Q Q LS+ E D  YFD    L+S         +E D+ +    N+ IL          G 
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLS---------SEQDSIMHQDKNTSIL----------GF 161

Query: 179 TNTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGN 238
           +  +   + +  +   S+Y   ++         S+ D++MR+FQDLN+YSEC IPID+GN
Sbjct: 162 SRKRFSFSKRPTDLSLSEYPDNES-----GSNFSVQDLIMRIFQDLNNYSECLIPIDEGN 216

Query: 239 AIDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANL 298
           ++DIK+FP+++PP  SIS EDVP+  V+L+ ++DVNWDPTMLKIVP+ID +NSI +IA L
Sbjct: 217 SVDIKIFPSMVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAAL 276

Query: 299 SNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPE 358
           SNSD   V+ECIRH VYY  VILSDIFQF+NIYAPTS + DFLTD  LAT+CQ YV  P+
Sbjct: 277 SNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPK 336

Query: 359 DSLLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDT-AYP 417
           +S    LP +K                      L +  NS ++ + ++E   NDD   +P
Sbjct: 337 NSNFGKLPLEKS-----------------INTDLDEYSNSGSAIYPNNEILENDDRLRWP 379

Query: 418 NHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWY 471
               +Y                   +  NYLPTKS LFDLYRSLSQG  L +WY
Sbjct: 380 ----MYYKPRNSQSSLSSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWY 429

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 31/145 (21%)

Query: 559 KLHTLDVDVADRVLNNVYKKLST-NGRPTTSI-------------------NGQGQHPSK 598
           K   L+  +AD+VL+++++KL+  +  P + I                    G     +K
Sbjct: 569 KRQILNSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTGNK 628

Query: 599 VAFKNQSYDNDLPGLMNNLG-----IEATK--FSREININD-KIYLLDALQSAENLDNIC 650
           V+F N S D+D     NNL      ++++K   +++   N  +  LL++L+ A+N+D IC
Sbjct: 629 VSF-NLSRDSDT--TQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKIC 685

Query: 651 SNLELSRXXXXXXXXXXXXYRIINC 675
             L+  R            Y IINC
Sbjct: 686 IKLQKPRKEVEELLSEIGDYVIINC 710

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  416 bits (1068), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 285/709 (40%), Positives = 379/709 (53%), Gaps = 97/709 (13%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           M + F+GFV IH IFYS FHPTEG+KV ++FPP +L  SGINFD+IKNYVIPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           +T KY NYRI  YP+ +NSS+YARN FSFN VFVFP+ CETSPYEP +ERLGKMF  LE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180
           Q Q LSK E D   F      NL   DK N   DN+    +N ++   IS+I TT     
Sbjct: 121 QNQILSKSENDTIMF------NLKSADK-NFNIDND---SSNYILGDDISSIMTT----Q 166

Query: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240
            +DK         + + N I + IK      +++D+LMR++QDLN+YSEC IPIDDGNA+
Sbjct: 167 QKDK---------YERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAV 217

Query: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300
           DIKLFP L PP   IS+E VPI  VNL KI+DVNWDP ML I+PYI+G+N+I++I+ LS+
Sbjct: 218 DIKLFPLLTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSH 277

Query: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360
           ++  LVIECIRH VYY C++L+DIF+FSN+YAPTSS+  FL DP +ATECQ YV  P +S
Sbjct: 278 NEESLVIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINS 337

Query: 361 LLSALPF--KKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHNDDTAYPN 418
            ++ L      G+    N               +    NS ++S  S  G  ND      
Sbjct: 338 KMNDLSLYPHHGKHSAFN-------------GDIGSRNNSVSTSLYSFNG--NDSRPQSR 382

Query: 419 HDSIYXXXXXXXXXXXXXXXXXMHQNRN-------YLPTKSTLFDLYRSLSQGVKLEEWY 471
             S+                     N N       +LPT+S LFDLYRSLSQG+ L+EWY
Sbjct: 383 SSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWY 442

Query: 472 QINFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKN 531
             N                          C         E +S +N   +LQ        
Sbjct: 443 MQNHKIIRDNRIDVRRFITFGVLRRIIYRC---------ETYSVINSTDHLQ-------- 485

Query: 532 KSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLS----TNGR--- 584
                  N++  ++++  + +   +K + + +D   AD  L N YKKLS    + G    
Sbjct: 486 -------NLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKS 538

Query: 585 -----------PTT-----SINGQGQHPSKVAFKNQSYDNDLPGLMNNLG--IEATKFSR 626
                      PT      S   + +  SKV+F+    D +     +N+   I+ T + +
Sbjct: 539 HNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKK 598

Query: 627 EININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIINC 675
              +  +I +L AL  AE LD IC  LE+ R             ++INC
Sbjct: 599 LSKMQRRI-MLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  416 bits (1069), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 272/691 (39%), Positives = 371/691 (53%), Gaps = 53/691 (7%)

Query: 3   NSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLT 62
           N F+GF+PIH IFYS+FHPTEGTKV YEFPPSNL  S I+FDAIKNY+IPK QLC+KLLT
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  LKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQC 122
            KY NYRIV YPI INS  YARN FSFN VFVFPY+CETSPYEP + RLGKMF  LE Q 
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 QFLSKCEKDMAYFDFKLI----SNLIDQDKSNTEPDNNILSKTNSMILPTI-----SNID 173
           Q LSK E D  YF         + +I  +  N    N  L K  + I  T      SN  
Sbjct: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRI 190

Query: 174 TTVGSTNTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIP 233
               S +  +  ++       + YN I+ Y+ N+  ++S+ D++MR++QDLN+YSEC IP
Sbjct: 191 LEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNS-RISVQDLIMRIYQDLNNYSECLIP 249

Query: 234 IDDGNAIDIKLFPTLM-PPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSI 292
           IDDGN +DIK+FP L  PP +S+S+EDVP+  V+L KI DVNWDPTMLK++P+I+G+N I
Sbjct: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309

Query: 293 FKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQI 352
            KI+ LSNS  MLVIECI+H +YY CVI++DIFQFSN Y+ TS I+ FLTDP +AT CQ 
Sbjct: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369

Query: 353 YVTSPEDSLLSALPFKKGRKMVKNRRXXXXXXXXXXXXXLRQNLNSKASSFISDEGHHND 412
           YV  P  S L+ LPF                           N + K  SF S    +N 
Sbjct: 370 YVVLPLGSKLTRLPF---------HIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG 420

Query: 413 DTAYPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQ 472
            +++   D                       +  +LPTK +LF+LYRSL+Q   L+ WY+
Sbjct: 421 RSSFSADDR---KQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNWYK 477

Query: 473 INFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNK 532
           +N+ +                       CHSYP+            +  + + P+  K+ 
Sbjct: 478 LNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV-----------ITPVVSAPESAKST 526

Query: 533 S------QSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDV-DVADRVLNNVYKKLSTNGRP 585
           S         +         K  +  +      + +  V D  D+++ + Y+KL      
Sbjct: 527 SPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLE----- 581

Query: 586 TTSINGQGQHPSKVAFKNQ-SYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAE 644
                 +G++ SKV+F ++ ++ ND             K   ++ +  +  LLD++ + +
Sbjct: 582 ------KGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMD 635

Query: 645 NLDNICSNLELSRXXXXXXXXXXXXYRIINC 675
           N+D IC  L   R            Y++INC
Sbjct: 636 NMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/367 (55%), Positives = 251/367 (68%), Gaps = 24/367 (6%)

Query: 3   NSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLT 62
           N F+GF+PIH IFYS+FHPTEGTKV YEFPP NL    INFD IKNY+IPK QLC++LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  LKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQC 122
            KY NYRIV YPI IN+  YARN FSFN VFVFPYECETSPYEP + RLGKMF  LE Q 
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQ 182
           Q LSK E D  YF           D   TEP   I+ + +       S+ +      N  
Sbjct: 130 QILSKAENDPIYF---------KSDYVPTEPTTTIIPQISP------SHRNKRNNDHNDN 174

Query: 183 DKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAIDI 242
           +  +  E ++   + + +  +        S+ D++MR++QDLN+YSEC IPID GN I+I
Sbjct: 175 NDGSRFETDFFGEEEDGVTKF--------SVQDLIMRIYQDLNNYSECLIPIDKGNDINI 226

Query: 243 KLFPTLMPPIDS-ISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNS 301
           K+FP L PP +  IS+EDVP+  +NLN +IDVNWDPTML IVPYI+G+N I KIA L+ +
Sbjct: 227 KVFPLLKPPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKA 286

Query: 302 DAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDSL 361
           D +LVIECI+H VYY CVI++DIFQFSN+YAPTS I  FLTD  +AT+CQ YV  P  S 
Sbjct: 287 DPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSK 346

Query: 362 LSALPFK 368
           LS LPF+
Sbjct: 347 LSHLPFE 353

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  254 bits (649), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 171/467 (36%), Positives = 230/467 (49%), Gaps = 76/467 (16%)

Query: 210 QLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIKLFPTLMPPID-SISVEDVPIPTVNLN 268
           + S+ D+LMR++QDLN+YSEC IPID+GN I+IK+FP L PP    IS+EDVP+  VNL+
Sbjct: 147 KFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVNLD 206

Query: 269 KIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFS 328
           KI+D+NWDPTML I+P+IDG+NSI  I++LS+SD  LVIECI+H +YY CVI++DIFQFS
Sbjct: 207 KIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQFS 266

Query: 329 NIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLSALPFKKGRK-MVKNRRXXXXXXXXX 387
           NIYAP+S I +FL DP +A  CQ YV  P  S ++ LP    +   + N           
Sbjct: 267 NIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKALSSS 326

Query: 388 XXXXLRQNLNSKASSFISDEGHHNDDTAYPNHDSIYXXXXXXXXXXXXXXXXXMHQNRNY 447
                    +  A + +S+  HH+  T+                           +    
Sbjct: 327 RSSFSSYFSHKSAYARVSETAHHHQSTS---------------TLSSSEGQQDNPRQGQV 371

Query: 448 LPTKSTLFDLYRSLSQGVKLEEWYQINFNSXXXXXXXXXXXXXXXXXXXXXXXCHSYPLP 507
           LP+K TLFDLYRSL+ G  +E WY+ NF++                        H YP+ 
Sbjct: 372 LPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIM 431

Query: 508 KNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDV 567
           ++    S L  L + QN  KIV            STSDIKF                 DV
Sbjct: 432 EHKTFKSPL--LSDRQND-KIV-----------LSTSDIKF-----------------DV 460

Query: 568 ADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVAFKNQSYDNDLPGLMNNLGIEATKFSRE 627
            DR+LN++Y KL                 SKV F     D  L   + N        SR 
Sbjct: 461 GDRILNSIYNKL-----------------SKVTFDR---DKKLESKIGN--------SRN 492

Query: 628 ININDKIYLLDALQSAENLDNICSNLELSRXXXXXXXXXXXXYRIIN 674
           +  ++K  L +AL+  E+ D ICS L  S+            Y  IN
Sbjct: 493 LGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTIN 539

 Score =  178 bits (451), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%)

Query: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60
           MN  F+GF PIH IF+S+FHPTEG+KV Y+FPP NL    INFD+IKN+VIPKPQLCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120
           LTL+Y NYR+V YP+ ++SS YARN FSFN VF+F Y+C+T PYEP +ERLGKMF  LE 
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QCQFLSKCEKDMAYF 135
           Q Q LSK ++  A+F
Sbjct: 121 QSQILSKSQRTSAFF 135

>Ecym_5435 Chr5 complement(891353..893518) [2166 bp, 721 aa] {ON}
           similar to Ashbya gossypii ADR126C
          Length = 721

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 60/138 (43%), Gaps = 24/138 (17%)

Query: 88  SFNLVFVFPYECETSPYEPVVERLGKMFCELEGQCQFLSKCEKDMAYFDFKLI------- 140
           SF++V    YE  T P+EP V R+ +       + Q ++    D    D+K++       
Sbjct: 519 SFSIVEDVAYEW-TMPFEPSVVRIAREIM----KAQSIANSRFDRYSGDYKIVAIKSGIL 573

Query: 141 -----SNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN-------TQDKANSK 188
                SN I+ D S  +   N+L K +  +  ++  +D+     N        + +  ++
Sbjct: 574 RIGNLSNQINVDMSTLQSHQNMLLKKHEHLQKSMQELDSLAARFNYDIRILDIRMRDINE 633

Query: 189 EVEYLFSKYNVIQNYIKN 206
            +  L SK   ++NYIKN
Sbjct: 634 SISQLGSKLQKVENYIKN 651

>NCAS0B00720 Chr2 (105858..109676) [3819 bp, 1272 aa] {ON} Anc_8.765
           YOR296W
          Length = 1272

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 18/112 (16%)

Query: 82  YARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQCQFLSKCEK--------DMA 133
           Y R  F   L FVF  EC        + +   MF        FL+KC K         +A
Sbjct: 334 YPRETFVALLCFVFRKECPADSKSINLSQ-AAMF--------FLTKCSKYWRVDFPTTLA 384

Query: 134 YFDFKLI-SNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQDK 184
              +     +++ QD  N E   N+ S     IL +  NIDT++ +T  +D+
Sbjct: 385 ALVYSAANKSILSQDFLNPELTENLFSMIRRRILKSDDNIDTSIWNTTDRDQ 436

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,837,472
Number of extensions: 3326226
Number of successful extensions: 12158
Number of sequences better than 10.0: 74
Number of HSP's gapped: 12592
Number of HSP's successfully gapped: 84
Length of query: 675
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 559
Effective length of database: 40,180,143
Effective search space: 22460699937
Effective search space used: 22460699937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)