Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J003006.16ON98298242880.0
Kpol_1045.736.16ON96293213451e-169
TDEL0G045306.16ON95878911011e-134
ZYRO0C07898g6.16ON97491610261e-123
CAGL0B03641g6.16ON9888789891e-117
YEL061C (CIN8)6.16ON10007979871e-117
Smik_5.266.16ON10027999811e-116
NCAS0H008806.16ON10048009771e-115
Ecym_30206.16ON9448169611e-114
Suva_5.66.16ON9997999491e-111
KAFR0L003706.16ON9638039431e-111
Skud_5.286.16ON9987949421e-110
SAKL0E01078g6.16ON9488049371e-110
NDAI0D008706.16ON10698159391e-109
KLTH0C11330g6.16ON9418148801e-102
ACR010C6.16ON9458148671e-100
KNAG0M011306.16ON9508107882e-89
Kpol_1032.66.16ON10046477721e-86
KLLA0D01045g6.16ON9655216625e-72
Kwal_56.224036.16ON9435316562e-71
TPHA0M002406.16ON9396246412e-69
TBLA0A072306.16ON10975345833e-61
SAKL0F12298g7.387ON11122272972e-26
ACR228C7.387ON11291642972e-26
Ecym_46887.387ON11341642953e-26
Suva_2.547.387ON11102192911e-25
Skud_2.417.387ON11103472901e-25
Smik_2.537.387ON11132192892e-25
YBL063W (KIP1)7.387ON11112192873e-25
NCAS0E026407.387ON11023062839e-25
TDEL0C016007.387ON11052422802e-24
ZYRO0B03234g7.387ON11382702712e-23
TPHA0E008907.387ON12322162679e-23
NDAI0E043007.387ON11862312605e-22
KAFR0L017107.387ON11512242472e-20
TBLA0D006407.387ON11421682382e-19
SAKL0G05016g5.531ON5041801951e-14
Kwal_47.190933.528ON8191761943e-14
KLTH0G01606g3.528ON8191771908e-14
ZYRO0B04290g3.479ON7311611899e-14
SAKL0F01760g3.528ON8091781872e-13
KLTH0G03850g5.531ON4731701843e-13
TPHA0D032003.479ON7241621853e-13
ZYRO0E08668g3.528ON7781791853e-13
Kwal_YGOB_55.211643.479ON6571611843e-13
Kwal_55.21164singletonOFF5881611843e-13
TDEL0F036403.479ON7041611818e-13
TDEL0D059603.528ON7331781801e-12
TBLA0C039403.479ON7391751792e-12
AGR253W3.479ON7091611782e-12
TBLA0C049603.528ON8011841772e-12
ADR145C2.633ON6351611773e-12
Skud_16.4353.479ON7291601764e-12
SAKL0G18920g2.633ON6491121754e-12
KLLA0B10956g3.479ON6901591754e-12
KAFR0B065903.479ON7061611755e-12
CAGL0I07029g3.528ON7051801737e-12
KLLA0A01606g3.528ON7691791739e-12
YPR141C (KAR3)3.479ON7291601729e-12
KLLA0B00759g5.531ON4561701701e-11
Ecym_34152.633ON6621691711e-11
Kpol_505.393.479ON6921611711e-11
KNAG0A078803.479ON7641641702e-11
Skud_7.533.528ON8051771683e-11
TPHA0D041903.479ON6721601683e-11
CAGL0D04994g3.479ON6921591683e-11
Kpol_423.83.528ON8061781674e-11
TPHA0D034803.528ON8471761674e-11
Smik_16.3883.479ON7291611665e-11
Smik_7.483.528ON8051751666e-11
Suva_16.4693.479ON7311611656e-11
Suva_7.443.528ON8051771649e-11
KAFR0F042103.528ON6721121631e-10
YGL216W (KIP3)3.528ON8051771631e-10
NCAS0E005503.528ON7841791631e-10
Kpol_1004.255.531ON5061161602e-10
NCAS0F034703.479ON6981651612e-10
TBLA0C053103.479ON6761611602e-10
KLTH0F14498g3.479ON7021591603e-10
NDAI0B057703.479ON7631651593e-10
Kwal_47.186085.531ON4791691574e-10
Ecym_12003.528ON8331791585e-10
KAFR0H024108.678ON6581111575e-10
SAKL0F03168g3.479ON7061591551e-09
ZYRO0D12650g5.531ON4781201541e-09
Ecym_44073.479ON7111611541e-09
Ecym_40665.531ON4781751532e-09
Skud_11.1482.633ON6561241532e-09
AER441C3.528ON8181731496e-09
KNAG0B005203.528ON7231771479e-09
KNAG0J017208.678ON6251581461e-08
SAKL0H06490g8.678ON6571101452e-08
Skud_16.1278.678ON7064251452e-08
Kpol_1050.1033.479ON6971651442e-08
Smik_11.1602.633ON6561211371e-07
NDAI0I029603.528ON8681091362e-07
NCAS0C013508.678ON6551791352e-07
Suva_11.1452.633ON6571121352e-07
KLLA0D05951g8.678ON6681091334e-07
YKL079W (SMY1)2.633ON6561101334e-07
Kwal_26.88068.678ON7151781317e-07
ZYRO0E01078g2.633ON6681111309e-07
ACR145W8.678ON6851111309e-07
Suva_16.1558.678ON7041291272e-06
YPL155C (KIP2)8.678ON7061291245e-06
Ecym_23958.678ON6871601246e-06
CAGL0M02189g8.678ON6721111236e-06
Kpol_1013.78.678ON6201131236e-06
TDEL0B072702.633ON6441121237e-06
KLTH0D11286g8.678ON6781071237e-06
Smik_6.3528.678ON7151271237e-06
Kpol_1019.112.633ON6471131237e-06
ZYRO0F07414g8.678ON6541541202e-05
NCAS0H031802.633ON6601101182e-05
TPHA0N016502.633ON682851173e-05
TBLA0C018808.678ON4681421173e-05
TBLA0A008202.633ON8031041121e-04
TPHA0D012708.678ON6961111121e-04
NDAI0E02090singletonON685911102e-04
TDEL0A062408.678ON6371111093e-04
KAFR0C040202.633ON6671111058e-04
CAGL0L05104g2.633ON675411010.003
KNAG0M025402.633ON5221121000.003
KNAG0H003602.633ON681129960.009
TBLA0C008002.633ON693187960.012
NDAI0C004802.633ON59884880.082
KLTH0G18480g8.39ON775137781.5
Kpol_534.32.315ON344111734.2
Ecym_43118.259ON1376135735.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00300
         (982 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...  1656   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   522   e-169
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   428   e-134
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   399   e-123
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   385   e-117
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   384   e-117
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   382   e-116
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   380   e-115
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   374   e-114
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   370   e-111
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   367   e-111
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   367   e-110
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   365   e-110
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   366   e-109
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   343   e-102
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   338   e-100
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   308   2e-89
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   301   1e-86
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   259   5e-72
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   257   2e-71
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   251   2e-69
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   229   3e-61
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   119   2e-26
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   119   2e-26
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   118   3e-26
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   116   1e-25
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   116   1e-25
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   115   2e-25
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   115   3e-25
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   113   9e-25
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   112   2e-24
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   108   2e-23
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   107   9e-23
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   104   5e-22
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   100   2e-20
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....    96   2e-19
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...    80   1e-14
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...    79   3e-14
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...    78   8e-14
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    77   9e-14
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...    77   2e-13
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...    75   3e-13
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...    76   3e-13
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...    76   3e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    75   3e-13
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    75   3e-13
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...    74   8e-13
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...    74   1e-12
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...    74   2e-12
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...    73   2e-12
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...    73   2e-12
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...    73   3e-12
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...    72   4e-12
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...    72   4e-12
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...    72   4e-12
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...    72   5e-12
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...    71   7e-12
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...    71   9e-12
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...    71   9e-12
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...    70   1e-11
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...    70   1e-11
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...    70   1e-11
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...    70   2e-11
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)    69   3e-11
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    69   3e-11
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    69   3e-11
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...    69   4e-11
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...    69   4e-11
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    69   5e-11
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)    69   6e-11
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...    68   6e-11
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)    68   9e-11
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...    67   1e-10
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...    67   1e-10
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...    67   1e-10
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....    66   2e-10
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...    67   2e-10
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...    66   2e-10
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    66   3e-10
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    66   3e-10
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...    65   4e-10
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...    65   5e-10
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...    65   5e-10
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    64   1e-09
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...    64   1e-09
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    64   1e-09
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...    64   2e-09
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    64   2e-09
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...    62   6e-09
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...    61   9e-09
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    61   1e-08
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    60   2e-08
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    60   2e-08
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...    60   2e-08
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    57   1e-07
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...    57   2e-07
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...    57   2e-07
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    57   2e-07
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    56   4e-07
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    56   4e-07
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...    55   7e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    55   9e-07
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    55   9e-07
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    54   2e-06
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    52   5e-06
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    52   6e-06
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    52   6e-06
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....    52   6e-06
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    52   7e-06
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    52   7e-06
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    52   7e-06
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    52   7e-06
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...    51   2e-05
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     50   2e-05
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    50   3e-05
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    50   3e-05
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    48   1e-04
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    48   1e-04
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    47   2e-04
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    47   3e-04
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    45   8e-04
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    44   0.003
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    43   0.003
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    42   0.009
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    42   0.012
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    39   0.082
KLTH0G18480g Chr7 (1593284..1595611) [2328 bp, 775 aa] {ON} weak...    35   1.5  
Kpol_534.3 s534 (8057..9091) [1035 bp, 344 aa] {ON} (8057..9091)...    33   4.2  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    33   5.4  

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score = 1656 bits (4288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 854/982 (86%), Positives = 854/982 (86%)

Query: 1   MIESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTL 60
           MIESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTL
Sbjct: 1   MIESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTL 60

Query: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120
           DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 121 ESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXX 180
           ESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID              
Sbjct: 121 ESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGAT 180

Query: 181 XXXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPXXXXX 240
               KKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPP     
Sbjct: 181 GSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNNSIS 240

Query: 241 XXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRR 300
                             DYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRR
Sbjct: 241 NNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRR 300

Query: 301 IASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGA 360
           IASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGA
Sbjct: 301 IASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGA 360

Query: 361 FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATC 420
           FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATC
Sbjct: 361 FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATC 420

Query: 421 SVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYS 480
           SVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYS
Sbjct: 421 SVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYS 480

Query: 481 ELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNC 540
           ELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNC
Sbjct: 481 ELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNC 540

Query: 541 ALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLE 600
           ALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLE
Sbjct: 541 ALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLE 600

Query: 601 SNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQ 660
           SNFADIKNRMP             KAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQ
Sbjct: 601 SNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQ 660

Query: 661 LDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHE 720
           LDTNLKNLEESVEINHNKYSELLSDISEEF          FLKSSHEELIDTYINRTYHE
Sbjct: 661 LDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHE 720

Query: 721 VQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKWELASNEI 780
           VQGISVEFTENFKKLLDIYVEKN             EIVENELTQFNPEKKKWELASNEI
Sbjct: 721 VQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEI 780

Query: 781 IENFNESITKNKNKNSEILAKXXXXXXXXXXXFINNMSSIKKNVEIVEEFSEIFNSNDLI 840
           IENFNESITKNKNKNSEILAK           FINNMSSIKKNVEIVEEFSEIFNSNDLI
Sbjct: 781 IENFNESITKNKNKNSEILAKLLSESTSTSELFINNMSSIKKNVEIVEEFSEIFNSNDLI 840

Query: 841 KSEFLEXXXXXXXXXXXXXXXFNSSENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKE 900
           KSEFLE               FNSSENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKE
Sbjct: 841 KSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKE 900

Query: 901 IFEQMEQQKLGVNSSSKKKAYKQNLXXXXXXXXXXXTKLNSPLKVEIQSLSEIDMKRPIK 960
           IFEQMEQQKLGVNSSSKKKAYKQNL           TKLNSPLKVEIQSLSEIDMKRPIK
Sbjct: 901 IFEQMEQQKLGVNSSSKKKAYKQNLSPSKISPIKSSTKLNSPLKVEIQSLSEIDMKRPIK 960

Query: 961 RKXXXXXXXXXXXXXXKMIHKE 982
           RK              KMIHKE
Sbjct: 961 RKLNLNLDLSENLNSSKMIHKE 982

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  522 bits (1345), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 332/932 (35%), Positives = 507/932 (54%), Gaps = 51/932 (5%)

Query: 9   NITVAVRCREPIDEEKHSG--------SPTIISIGDNEDGTSNEVIVLDESTGRKKIYTL 60
           NI V  R +  ID EK            P +I     +D    E        G   I++ 
Sbjct: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREF-------GMDHIFSS 66

Query: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120
           D V      Q++L+ +++ P ++ F +GYN S + YG   SGK YTL GE   L ++  A
Sbjct: 67  DVV------QEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSE-A 119

Query: 121 ESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXX 180
              ++GV+PRVL  LF  L  N  DH++KCS+VEIYN+EL+DLL+D              
Sbjct: 120 SRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASI---- 175

Query: 181 XXXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPXXXXX 240
               KKLRIVDS S  +++  +SN +TRDNSPLT+SK IPTA++RK+MG++SL       
Sbjct: 176 ----KKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQAN 231

Query: 241 XXXXXXXXXXXXXXXXXXDYSLQSS-HERLNSIYIQNLQEITITEIEEGMAIIKKGLKNR 299
                             +YS Q    E+  + YIQNL+E  IT  +EG+ ++ +GLKNR
Sbjct: 232 TLSISRSNSFN-------EYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNR 284

Query: 300 RIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNG 359
           +IAS    S   ++S R+ +IF I LYKEEE  E+FR+SK +FV+ AG+E+       N 
Sbjct: 285 QIAS----SKNQKYSSRASTIFTIVLYKEEE-GEIFRVSKWNFVDLAGAEHSHKIEGTNQ 339

Query: 360 AF------NSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLK 413
            F      N  +Q+ NK++N +    +   F DSKLT L+++  +G ++++FI  +   K
Sbjct: 340 RFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNK 399

Query: 414 KQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIY 473
             LD     L    K++ +K  P  G  I KE+LIK +SNEL K KSDLLS KS + G+Y
Sbjct: 400 DSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKE-GVY 458

Query: 474 MDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRE 533
           M  +HY  LTK L+ +K +I + K  I+EL ++   +R +KR FEE+NE QRIKLQ++R+
Sbjct: 459 MSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRD 518

Query: 534 TISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELV 593
           ++S +   +EKQ +RE +L N   KL   + NM  ++ +Y+D+E  +Q ++K L+++EL 
Sbjct: 519 SVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELS 578

Query: 594 KLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVKELLTNSANQVLDT 653
           KLK+ L  N    +                   EI +I   S++++  L  +   ++ + 
Sbjct: 579 KLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEE 638

Query: 654 SPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXXXFLKSSHEELIDTY 713
           SPK F     ++  LE S   N+N  +ELLSD+SEEF          F K++HEEL+ TY
Sbjct: 639 SPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTY 698

Query: 714 INRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKW 773
           +N+TYH+VQ  S +F   F  LL+ Y+E N             E++ENE+  F P+K+KW
Sbjct: 699 VNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKW 758

Query: 774 ELASNEIIENFNESITKNKNKNSEILAKXXXXXXXXXXXFINNMSSIKKNVEIVEEFSEI 833
           E  S E+IE    S  + K KN  I+ K             + +S +K  +  +++ + I
Sbjct: 759 E-KSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANI 817

Query: 834 FNSNDLIKSEFLEXXXXXXXXXXXXXXXFNSSENSIDSFDNLKEAMQNVFKNEMKESYSN 893
             +N+++  EF+                  S+E SI +FD L ++++NVFKNE+  + + 
Sbjct: 818 IENNEVVTEEFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITG 877

Query: 894 DTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNL 925
               LKEIF+Q++QQ+L  N  ++K   +Q++
Sbjct: 878 YQSILKEIFDQLDQQRLTPNMRNRKSPVRQSV 909

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  428 bits (1101), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 268/789 (33%), Positives = 436/789 (55%), Gaps = 76/789 (9%)

Query: 9   NITVAVRCREPIDEE------KHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDA 62
           NITVAVRCR   + E           P +    +    T+ +V +  +     K YT+D 
Sbjct: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINS--KTYTVDE 73

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121
           V+G   +Q  +F +   P +  F  GYN +++ YG   +GK YT+ G+    +   + E 
Sbjct: 74  VFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYDGEL 129

Query: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXX 181
           SE+ G++PR+L +LF+ LE    D+++KCSFVE+YN+EL+DLL D               
Sbjct: 130 SESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS-------- 181

Query: 182 XXXKKLRIVDS-----ASNGLRSAGSSNSSTRDNSPLTNSKKIPTA-MMRKRMGKRSLPP 235
              +KLRI DS     A+N + +  S+ +S  ++    +S ++PTA  +RKR   ++ P 
Sbjct: 182 ---RKLRIFDSNTMSAATNSMSTGNSTKNSRNNSP--RSSSELPTATFLRKRW--KTAPS 234

Query: 236 XXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKG 295
                                    S Q+S ++   IYIQNLQ+  IT  +EG+ +++KG
Sbjct: 235 VTQ----------------------SHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKG 272

Query: 296 LKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNT 355
           LK+R++A+T      N+FS RSH+IF ITLYKE    E+FR+SK++ V+ AGSE    N 
Sbjct: 273 LKHRQVATT----KMNDFSSRSHTIFTITLYKEYN-GEIFRVSKMNLVDLAGSE----NI 323

Query: 356 SKNGA----------FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLF 405
           S++GA           N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T  
Sbjct: 324 SRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTAL 383

Query: 406 IANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSY 465
           IA I+P K   + TCS L  A K K IKN+P+ GSVI K+ L+K ++ EL K K+DLLS 
Sbjct: 384 IATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLST 443

Query: 466 KSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQR 525
           KS + GIYM + +Y ELT  LESYK +++  K +I  LT +   +  +K+   E+N+ QR
Sbjct: 444 KSKE-GIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQR 502

Query: 526 IKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLK 585
           IKLQN+R+ +S+L    EKQ+KRE  L      L + +G MQ  ++++  +E  +++K+ 
Sbjct: 503 IKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMG 562

Query: 586 LLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVKELLTN 645
            L++ E  ++K ++ SN  DI+ ++              + EI K+  ++Q +  ++  +
Sbjct: 563 DLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKD 622

Query: 646 SANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXXXFLKSS 705
              ++LD +P +F+     +  +E+ +   H   +E LSD+SEEF          F K++
Sbjct: 623 CVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNN 682

Query: 706 HEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVENELTQ 765
           HEE++ ++I+RTYH +Q  + +  + FK+++D ++EKN             +++  E+  
Sbjct: 683 HEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQL 742

Query: 766 FNPEKKKWE 774
           F P+KKKWE
Sbjct: 743 FEPQKKKWE 751

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  399 bits (1026), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 272/916 (29%), Positives = 472/916 (51%), Gaps = 60/916 (6%)

Query: 3   ESAKMENITVAVRCREPIDEEKHS------GSPTIISIGDNEDGTSNEVIVLDESTGRKK 56
           E A+  NITVAVR R   + E  +        P ++   +    T+++V +  +     K
Sbjct: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNS--K 67

Query: 57  IYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQN 116
            Y +D V+G   +Q+ +F E   P +  F  GYN +++ YG   +GK YT+ G+    + 
Sbjct: 68  TYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE---KL 124

Query: 117 ANNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXX 176
            N+  S++ G++PR+L +LF+ L+    D+++KCSFVE+YN+EL+DLL D          
Sbjct: 125 YNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSM--- 181

Query: 177 XXXXXXXXKKLRIVDSASNGL-----RSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKR 231
                   +KLRI DS S        R    +NS      P+ N +++ T  +   + K+
Sbjct: 182 --------RKLRIYDSGSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSSSLAKQ 233

Query: 232 SLPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNS---IYIQNLQEITITEIEEG 288
                                          Q   ++ +S   +YIQNLQ+  IT   +G
Sbjct: 234 QHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDG 293

Query: 289 MAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGS 348
           + +++KGL+NR++A+T      N+FS RSH+IF ITLY+E +  E+F++SK++ V+ AGS
Sbjct: 294 LQLLQKGLRNRQVATT----KMNDFSSRSHTIFTITLYREHQ-GEMFKVSKMNLVDLAGS 348

Query: 349 EYGDNNTSKNGA----------FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFD 398
           E    N S++GA           N +L +  ++IN + + S +  F +SKLT+LLQ++  
Sbjct: 349 E----NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLG 404

Query: 399 GITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKT 458
           G T+T  IA I+P K   + TCS L  A+K K IKN P+  S I K+ L+K ++ EL K 
Sbjct: 405 GNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKV 464

Query: 459 KSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFE 518
           KSDLLS K  + G+YM + +Y E+T  LESYK +IQ SK  I  L+ + + +  +K+   
Sbjct: 465 KSDLLSTKLRE-GVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASN 523

Query: 519 EINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEI 578
           E+NE QRIKLQN+++ +S L+  LE Q K+E EL ++   L S L   Q  +++Y  +E 
Sbjct: 524 EVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREK 583

Query: 579 HLQNKLKLLYDKELVKLKNSLESNFADIKNRMP-------XXXXXXXXXXXXXKAEILKI 631
            +  +++++  +E ++ +  L +N  DI+                        + E++++
Sbjct: 584 QISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVEL 643

Query: 632 ANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFX 691
              +Q + +++  +   ++L+ +P  F+ +   +  +E +V   H + +E LSDISE + 
Sbjct: 644 LGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYN 703

Query: 692 XXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXX 751
                    F K++HEE+++++I++TY ++Q  +    + FK+++D +++ N        
Sbjct: 704 NLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSL 763

Query: 752 XXXXXEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKN-SEILAKXXXXXXXXX 810
                E ++ E+  F P++KKWE  S ++I N  +SI+   N +    L+          
Sbjct: 764 QSATTEAIDKEMQLFEPQRKKWE-ESFDLINNC-DSISNGFNGDMRSALSDIKSTFGSST 821

Query: 811 XXFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEXXXXXXXXXXXXXXXFNSSENSID 870
                ++S +K  V+  E+ S I + N+++K +  +                 SS+  I 
Sbjct: 822 DVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHIS 881

Query: 871 SFDNLKEAMQNVFKNE 886
           +FD LKE ++N   +E
Sbjct: 882 AFDELKERIRNTIASE 897

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  385 bits (989), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 268/878 (30%), Positives = 451/878 (51%), Gaps = 72/878 (8%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEV-IVLDESTG-----RKKIYTLDA 62
           NI VAVRCR   + E  + S  ++ + DN  G +NEV I   +  G       K YT+D 
Sbjct: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDN--GVTNEVSINTTDDVGIAAKMNSKTYTVDK 90

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122
           V+G    QK +++E   P ++ F  GYN +I+ YG   +GK YT+ G+  +L N    ++
Sbjct: 91  VFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLHNGELGDA 149

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXXX 182
              G++PRVL  LF  LE+N +D+++KCSFVE+YN+EL+DLL                  
Sbjct: 150 A--GIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL---------DSTNTATNS 198

Query: 183 XXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTA-MMRKRMGKRSLPPXXXXXX 241
             KKLRI DS  NG  ++GSS+ S+  N+   ++     A M+R+++G+ +         
Sbjct: 199 DNKKLRIFDSNVNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISN 258

Query: 242 XXXXXXXXXXXXXXXXXDYSLQSSHERLN--------------------SIYIQNLQEIT 281
                                 ++H+ ++                    SIYIQNL+E  
Sbjct: 259 NNHNKFSRFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFH 318

Query: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341
           IT   EG+ +++KGLK R++AST      N+FS RSHSIF ITLYKE+   E+FR+SK++
Sbjct: 319 ITSAMEGLQLLQKGLKQRQVAST----KMNDFSSRSHSIFTITLYKEQN-GELFRVSKMN 373

Query: 342 FVNFAGSEYGDNNTSKNGAFNS----------NLQSFNKMINGMVNNSTYASFLDSKLTQ 391
            V+ AGSE    N S++GA N           +L +  ++IN + + S +  F +SKLT+
Sbjct: 374 LVDLAGSE----NISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTR 429

Query: 392 LLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKIL 451
           LLQ++  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L++ +
Sbjct: 430 LLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSI 489

Query: 452 SNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIR 511
           ++EL K KSDLLS KS + G+YM  +HY +L   +E YK +++ SK +I  LT +   ++
Sbjct: 490 TSELAKIKSDLLSTKSKE-GVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQ 548

Query: 512 IEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG---NMQK 568
            E+ + ++ N   +  + +L++ +  L  +L++Q  +E+   NI+  L  + G    M+K
Sbjct: 549 QERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKET---NIRSLLKDVQGANEEMKK 605

Query: 569 SVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEI 628
           ++  +  K+  LQ  +      E+  ++++L+ +   ++N                + E+
Sbjct: 606 TIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEV 665

Query: 629 LKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISE 688
           +K+   ++ +  +        +L  +P+ FE +   L N+ +  E NH+K +E LSD+SE
Sbjct: 666 VKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSE 725

Query: 689 EFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXX 748
           E+          F K++HEEL+  ++  TY +++  S +  +NF  +LD ++++N     
Sbjct: 726 EYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHML 785

Query: 749 XXXXXXXXEIVENELTQFNPEKKKWELASNEI--IENFNESITKNKNKNSEILAKXXXXX 806
                   E++ NEL  F  ++ KWE +S  I   ++ N S  +    N   L +     
Sbjct: 786 ENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSN---LVEIRDVV 842

Query: 807 XXXXXXFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEF 844
                     +SSI+      +   E+   ND+I+ + 
Sbjct: 843 SSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQI 880

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  384 bits (987), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 264/797 (33%), Positives = 419/797 (52%), Gaps = 45/797 (5%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 36  NITVAVRCRGRNEREISMKSSVVVNVPD-ITGSKEISINTTGDTGITAQMNAKRYTVDKV 94

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122
           +G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGELS 150

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXXX 182
           +  G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL                  
Sbjct: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL---DSNSNGSSNTGFDGQ 207

Query: 183 XXKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPXXX 238
             KKLRI DS++    ++ S++SS  ++   +    N      A++RKR+  +SLP    
Sbjct: 208 FMKKLRIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIK 267

Query: 239 XXXXXXXXXXXXXXXXXXXX---------------DYSLQSSHERLNSIYIQNLQEITIT 283
                                                S  + +++ N IYIQNLQE  IT
Sbjct: 268 QQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPNDQTNGIYIQNLQEFHIT 327

Query: 284 EIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFV 343
              EG+ +++KGLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++ V
Sbjct: 328 NAMEGLNLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMNLV 382

Query: 344 NFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNF 397
           + AGSE  + + + N      G+ N +L +  ++IN +V+ S +  F +SKLT+LLQ++ 
Sbjct: 383 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSL 442

Query: 398 DGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVK 457
            G T+T  IA I+P K   + TCS L  A+K K IKN+P+ GS I K+ L+K ++ EL K
Sbjct: 443 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAK 502

Query: 458 TKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTF 517
            KSDLLS KS + GIYM + HY  L   LESYK ++Q  K  I  LT K   +  +K   
Sbjct: 503 IKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKS 561

Query: 518 EEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKE 577
           +E  + Q  ++++L+ TI +L   L+KQ K E E+ +   KL  +   MQ ++  Y  +E
Sbjct: 562 KETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRE 621

Query: 578 IHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQS 637
           + L  K ++   KE+ KLK++L      ++                 K E+L +    Q 
Sbjct: 622 LDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTMQE 681

Query: 638 KVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXX 697
           K + +  +   ++L+ SPK+F  +   +  +    +  +   +E LSDISEE        
Sbjct: 682 KAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYL 741

Query: 698 XXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXE 757
              F K++H+EL++ +++ TY  ++  + EF ENFKK+L+ ++++N              
Sbjct: 742 KNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSA 801

Query: 758 IVENELTQFNPEKKKWE 774
           +++ E+  F P++ KWE
Sbjct: 802 VIDQEMDLFEPKRVKWE 818

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  382 bits (981), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 262/799 (32%), Positives = 420/799 (52%), Gaps = 47/799 (5%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 36  NITVAVRCRGRNEREISMKSSVVVNVPD-ITGSKEISINTTGDTGITAQMNAKRYTVDKV 94

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122
           +G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 95  FGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGELS 150

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXXX 182
           ++ G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL                  
Sbjct: 151 DSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL---DNNSNSSSNNGFDGQ 207

Query: 183 XXKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPXXX 238
             KKLRI DS++    ++ S++SS   +   +    N      A++R+R+  +SLP    
Sbjct: 208 FMKKLRIFDSSTANNTTSNSASSSRSSSRNSSPRSLNDLTPKAALLRRRLRTKSLPNTIK 267

Query: 239 XXXXXXXXXXXXXXXXXXXXDYSLQ-----------------SSHERLNSIYIQNLQEIT 281
                                 S                   + +++ N IYIQNLQE  
Sbjct: 268 QQQQHQQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPNDQSNGIYIQNLQEFH 327

Query: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341
           IT   EG+ +++KGLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++
Sbjct: 328 ITNAMEGLKLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMN 382

Query: 342 FVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQN 395
            V+ AGSE  + + + N      G+ N +L +  ++IN +V+ S +  F +SKLT+LLQ+
Sbjct: 383 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQD 442

Query: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNEL 455
           +  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L+K ++ EL
Sbjct: 443 SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMEL 502

Query: 456 VKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKR 515
            K KSDLLS KS + GIYM++ HY  L   LESYK ++Q  K  I  LT K + +  EK 
Sbjct: 503 AKIKSDLLSTKSKE-GIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLLVKEKL 561

Query: 516 TFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSD 575
             +E  + Q  ++++L+ TI +L   L+KQ K E E+     KL  +   MQ +++ Y  
Sbjct: 562 KSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMALQDYKR 621

Query: 576 KEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQS 635
           +E+ L  K +     E+  +K +L S  + ++ R               K E+L +    
Sbjct: 622 RELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLTLMETM 681

Query: 636 QSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXX 695
           Q K + +  +   ++L+ SPK+F  +   +  +    E  +   +E LSDISEE      
Sbjct: 682 QEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEENNNLKQ 741

Query: 696 XXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXX 755
                F +++H+EL+  +++ TY +++  + +F ENFKK L+ ++E+N            
Sbjct: 742 YFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMKNLTTTT 801

Query: 756 XEIVENELTQFNPEKKKWE 774
             +++ E++ F P++ KWE
Sbjct: 802 SAVIDQEMSLFEPKRVKWE 820

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  380 bits (977), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 270/800 (33%), Positives = 421/800 (52%), Gaps = 62/800 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR   + E +S SP ++++ D   G     I     TG       K YT+D V
Sbjct: 30  NITVAVRCRGRNEREINSKSPVVVTVPD-ITGAQEISINTTGETGITAQMNSKTYTVDKV 88

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESE 123
           +G   DQ  +F E   P ++ F  GYN +++ YG   +GK YT+ G+    QN     S+
Sbjct: 89  FGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGT-MLSD 147

Query: 124 NLGVVPRVLSRLF--------KDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXX 175
             G++PR+L +LF         D+  +  D ++KCSFVE+YN++L+DLL           
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLL----NYDSNDE 203

Query: 176 XXXXXXXXXKKLRIVDSASNGLRSAGSSNSST--------RDNSPLTNSKKIPTAMMRKR 227
                    +KLRI DS +N   ++ S+ SS         R +S L N+     AM +K 
Sbjct: 204 QQQQQQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNANATNLAMRKKS 263

Query: 228 MGKRSLPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEE 287
           +                                S+    E  N IYIQNLQE  IT  +E
Sbjct: 264 I-------RYNYNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEFHITNAKE 316

Query: 288 GMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAG 347
           G+++++KGLK+R++AST      N+FS RSH+IF ITLYKE + N +FR+SK++ V+ AG
Sbjct: 317 GLSLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKEHKDN-LFRLSKMNLVDLAG 371

Query: 348 SEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGIT 401
           SE  + + + N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  G T
Sbjct: 372 SENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGGNT 431

Query: 402 RTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSD 461
           +T  IA I+P K   + TCS L  A+K K IKN+P+ GSVI K+ L+K +++EL K KSD
Sbjct: 432 KTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVKSD 491

Query: 462 LLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEIN 521
           L+S KS D GIYM  +HY EL   LES K ++Q SK  I +L+ + + +  +KR+  E+N
Sbjct: 492 LMSTKSKD-GIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEVN 550

Query: 522 ERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEK-------YS 574
           E QRIKL NL++++SNLN  LE Q+ +E+       KL   +G ++KS EK       Y 
Sbjct: 551 ELQRIKLNNLKDSMSNLNEKLEIQNGKET-------KLMEQIGQLEKSREKLNSLVKNYQ 603

Query: 575 DKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQ 634
            K+  L+ ++  + ++ L +LK  L S+   I  R               K EI  +  +
Sbjct: 604 TKQSQLKTQISNILNENLFELKKILNSHKDAI--RQSEGNFDVEMNLKVIKDEITSMLEK 661

Query: 635 SQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXX 694
           +Q K + +      + L+ +P   +++  ++  +E  V   +N+ +E LSDISEE+    
Sbjct: 662 TQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLK 721

Query: 695 XXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXX 754
                 F +++HE+L++ +IN T   +   S E    FK ++D ++ +N           
Sbjct: 722 QYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTA 781

Query: 755 XXEIVENELTQFNPEKKKWE 774
             +++  E+  F P++ KWE
Sbjct: 782 TNDVITKEMELFKPKRNKWE 801

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  374 bits (961), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 255/816 (31%), Positives = 424/816 (51%), Gaps = 87/816 (10%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG--------RKKIYTL 60
           NITVAVRCR   + E  + S  ++++ D     SNEV +   +TG          + YT+
Sbjct: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTG--SNEVSI--NTTGDIGIAGKMNSRTYTV 77

Query: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120
           D V+G   DQK +F     P +  F  GYN +++ YG   +GK YT+ G+    +   + 
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYDG 133

Query: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXX 179
           E S++ G++PRVL RLF  LE+  +DH++KCS++E+YN+EL+DLL D             
Sbjct: 134 ELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS-------- 185

Query: 180 XXXXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNS------KKIPTAMMRKRMGKRSL 233
                K+LRI DS +     AGS N+S ++    ++S        IPT   R  + K+ L
Sbjct: 186 -----KRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL 240

Query: 234 PPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIK 293
                                           +E+ ++IYIQNLQE  IT   EG+++++
Sbjct: 241 --------------------------------YEQSSAIYIQNLQEFHITNAREGISVLQ 268

Query: 294 KGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDN 353
           KGLK+R++AST      N+FS RSH+IF I LYK  E  E+FR+SK++ V+ AGSE    
Sbjct: 269 KGLKHRQVAST----KMNDFSSRSHTIFTIMLYKSYE-GELFRISKMNLVDLAGSENISR 323

Query: 354 NTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIA 407
           + ++N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T  IA
Sbjct: 324 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIA 383

Query: 408 NIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKS 467
            I+P K   D T S L  ATK K IKN P+ GS + K+ L+K +S+EL K KSD LS K+
Sbjct: 384 TISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKA 443

Query: 468 NDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIK 527
            + GIYM  +HY E+   LE+Y+ +IQ SK  +   + + + +  +K+  +++NE Q +K
Sbjct: 444 KE-GIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMK 502

Query: 528 LQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLL 587
           +  L+ TI  L   +E+Q + E +L +   KL   L  M+ S++ Y   E+ LQN +K +
Sbjct: 503 ITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEV 562

Query: 588 YDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVKELLTNSA 647
             + +   + S++ +   +K RM              +    +  +  +S   ++ TN  
Sbjct: 563 LYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV 622

Query: 648 NQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXXXFLKSSHE 707
             V D     ++Q    L +L+  V+      +  L++++EE           FLK++++
Sbjct: 623 KIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQ 682

Query: 708 ELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVENELTQFN 767
           E++D  + + YH+ +  S     +   +++ ++E++             E+++ EL  F 
Sbjct: 683 EMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQ 742

Query: 768 PEKKKWELASNEIIENFNESITKNK---NKNSEILA 800
           P K++W L+     EN NE    ++   NK++++L 
Sbjct: 743 PVKERWVLS----FENINECDAAHQQFENKSTKLLT 774

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  370 bits (949), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 261/799 (32%), Positives = 420/799 (52%), Gaps = 50/799 (6%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI--------YTL 60
           NITVAVRCR   + E    S  ++++    D T +E + ++ +TG   I        YT+
Sbjct: 36  NITVAVRCRGRNEREIGMKSSVVVNV---PDITGSEEVSIN-TTGDTGITAQMNAKRYTV 91

Query: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120
           D V+G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N 
Sbjct: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNG 147

Query: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXX 179
           E S+  G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL               
Sbjct: 148 ELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL---DNNSNNSSNNGF 204

Query: 180 XXXXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPP 235
                KKLRI DS +    ++ S++SS  ++   +    N      A++RKR+  +SLP 
Sbjct: 205 EGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPN 264

Query: 236 XXXXXXXXXXXXXXXXXXX--------------XXXXDYSLQSSHERLNSIYIQNLQEIT 281
                                                  S  + +++ N IYIQNLQE  
Sbjct: 265 TIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFH 324

Query: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341
           IT   EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++
Sbjct: 325 ITNAMEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMN 379

Query: 342 FVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQN 395
            V+ AGSE  + + + N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ+
Sbjct: 380 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQD 439

Query: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNEL 455
           +  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L+K ++ EL
Sbjct: 440 SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMEL 499

Query: 456 VKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKR 515
            K KSDLLS KS + GIYM + HY  L   LESYK ++Q  K  I  L+ K + +  +K 
Sbjct: 500 AKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKL 558

Query: 516 TFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSD 575
             ++  + Q  ++++L+ TI+ L   L+KQ K E E+     KL  +   MQ +++ Y  
Sbjct: 559 KSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKR 618

Query: 576 KEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQS 635
           +E+ L  K +    KE+  LK +L S  + ++                 K E+L +    
Sbjct: 619 RELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM 678

Query: 636 QSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXX 695
           Q K + +  +   ++L+ SPK+F  +   +  +    +  +N  +E LSDISEE      
Sbjct: 679 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 738

Query: 696 XXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXX 755
                F K++H+EL++ +I+ TY +++  + EF ENFK  L+ ++E+N            
Sbjct: 739 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 798

Query: 756 XEIVENELTQFNPEKKKWE 774
             ++  E+  F P++ KWE
Sbjct: 799 SAVINQEMDLFEPKRVKWE 817

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  367 bits (943), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 264/803 (32%), Positives = 413/803 (51%), Gaps = 62/803 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR     E  + S  ++++ D   G+    I   E  G       K YT+D V
Sbjct: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIM-GSKEVAINTSEDIGFTAQMNSKTYTVDKV 76

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGE---YSELQNANNA 120
           +G    Q  +FDE   P +  F  GYN +++ YG   +GK YT+ G+   Y+E       
Sbjct: 77  FGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE------E 130

Query: 121 ESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXX 180
            S++ G++PR+L +LF+ LE    DHI+KCSFVE+YN+EL+DLL                
Sbjct: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL---------HGDCNND 181

Query: 181 XXXXKKLRIVDSASNGLRSAGSSNSS--TRDNSPLTNSKKIPTAMMRKR---MGKRSLPP 235
               KKLRI DS     RS   +NS   + +N+     K    A++R R     KRS   
Sbjct: 182 NGNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQ 241

Query: 236 XXXXXXXXXXXXXXXXXXXXXXXD--------------YSLQSSHERLNSIYIQNLQEIT 281
                                  +               ++QS  ++   IYIQNLQE  
Sbjct: 242 TIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQS--DQTAGIYIQNLQEFH 299

Query: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341
           IT  +EG+ +++KGLK R++AST      N+FS RSH+IF ITL+KE +  E+FR+SK++
Sbjct: 300 ITTAKEGIKLLQKGLKYRQVASTK----MNDFSSRSHTIFTITLFKEVK-GEIFRLSKMN 354

Query: 342 FVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQN 395
            V+ AGSE  + + + N      G+ N +L +  ++IN + + + +  F +SKLT+LLQ+
Sbjct: 355 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQD 414

Query: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNEL 455
           +  G T+T  IA I+P K  L+ TCS L  A+K K IKN+P+ GS I K+ L+K ++ EL
Sbjct: 415 SLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTEL 474

Query: 456 VKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKR 515
            K KSDLLS KS D GIYMD++HY ELT  L++YK +IQ  K +I  LT +   +  +KR
Sbjct: 475 TKIKSDLLSTKSKD-GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKR 533

Query: 516 TFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGN-MQKSVEKYS 574
           T  E NE QRIK+Q + E++  L   +E+Q   E+EL+  KI++ +   + + K +++  
Sbjct: 534 TINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDG-KIQIFTKTNSKLTKIIDEMK 592

Query: 575 DKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQ 634
           ++E  + +K K L D  L  +   L     + K++               K+E+  + + 
Sbjct: 593 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLST 652

Query: 635 SQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXX 694
           ++   ++       + L  +P  F++++ N+ NL+      +++ +E LSD+SEE+    
Sbjct: 653 ARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFK 712

Query: 695 XXXXXXFL---KSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXX 751
                 F    K    EL++ YIN T   ++  S +     + LL+ ++  N        
Sbjct: 713 QFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSL 772

Query: 752 XXXXXEIVENELTQFNPEKKKWE 774
                E++ NEL +  P+  KWE
Sbjct: 773 SNVTTELMSNELDRLKPKLSKWE 795

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  367 bits (942), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 257/794 (32%), Positives = 416/794 (52%), Gaps = 43/794 (5%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 38  NITVAVRCRGRNEREIGMKSSVVVNVPD-ITGSKEVSINTTGDTGITAQMNAKRYTVDKV 96

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA--NNAE 121
           +G    Q  +F+E   P ++ F  GYN +++ YG   +GK YT+ G+  +L N   N+A 
Sbjct: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGELNDAA 155

Query: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXX 181
               G++PRVL +LF  LE   +D+++KCSF+E+YN+EL+DLL                 
Sbjct: 156 ----GIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLL---DNNSNGSSNNGFDG 208

Query: 182 XXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPXX 237
              KKLRI DS++    ++ S++SS  ++   +    N      A++RKR+  +SLP   
Sbjct: 209 QFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTI 268

Query: 238 XXXXXXXXXXXXXXXXXXXXX-----------DYSLQSSHERLNSIYIQNLQEITITEIE 286
                                             S  + +++ N IYIQNLQE  IT   
Sbjct: 269 KQQQQQQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGIYIQNLQEFHITNAL 328

Query: 287 EGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFA 346
           EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++ V+ A
Sbjct: 329 EGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMNLVDLA 383

Query: 347 GSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGI 400
           GSE  + + + N      G+ N +L +  ++IN +V+ S +  F +SKLT+LLQ++  G 
Sbjct: 384 GSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGN 443

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKS 460
           T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ + K+ L+K ++ EL K KS
Sbjct: 444 TKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKS 503

Query: 461 DLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEI 520
           DLLS KS + GIYM + HY  L   LES+K ++Q  K  I  L  K + +  +K    E 
Sbjct: 504 DLLSTKSKE-GIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRET 562

Query: 521 NERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHL 580
            + Q  ++++L+ TI++L   L+KQ K E E+     KL  +   MQ +++ Y  +E+ L
Sbjct: 563 IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDL 622

Query: 581 QNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVK 640
             K +    KE+  LK +L     +++ +               K E+L +    Q K +
Sbjct: 623 NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAE 682

Query: 641 ELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXXX 700
            +  +   ++L+ SPK+F  +   +  +    +  +   +E LSDISEE           
Sbjct: 683 LMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNH 742

Query: 701 FLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVE 760
           F K++H+EL++ +I+ TY  ++  + +F ENFK  L+ ++E+N              +++
Sbjct: 743 FFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVID 802

Query: 761 NELTQFNPEKKKWE 774
            E+  F P + KWE
Sbjct: 803 QEMDLFEPRRAKWE 816

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  365 bits (937), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 253/804 (31%), Positives = 427/804 (53%), Gaps = 52/804 (6%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIV--LDE----STGRKKIYTLDA 62
           NITV+VRCR   + E  + S  ++++ D     SNEV +   DE    +    K YT+D 
Sbjct: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTG--SNEVSINTTDELGITAQMNSKTYTVDK 75

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121
           V+G   DQ  +F +   P +  F  GYN +++ YG   +GK YT+ G+    +   + E 
Sbjct: 76  VFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD----ERLYDGEL 131

Query: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXX 181
           S+  G++PR+L +LF  LE+   D+++KCSF+E+YN+EL+DLL                 
Sbjct: 132 SDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL-----------NEPQES 180

Query: 182 XXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPXXXXXX 241
              KKLRI DS +    S  +S +++ +         + T+   KR+ K  +P       
Sbjct: 181 GVIKKLRIFDSNTTSSNSRNNSRNNSPN--------LVGTSGTFKRIFKTPVP--YKQQQ 230

Query: 242 XXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRI 301
                            +   QS  E+ ++IYIQNLQE  IT  ++G+ ++++GLK+R++
Sbjct: 231 QHQQHLQQQQQQQPRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQV 290

Query: 302 ASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN--- 358
           AST      N+FS RSH+IF I LYK     EVFR+SK++ V+ AGSE    + ++N   
Sbjct: 291 AST----KMNDFSSRSHTIFTIMLYKNHN-GEVFRVSKMNLVDLAGSENISRSGAQNQRA 345

Query: 359 ---GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQ 415
              G+ N +L +  ++IN + + + +  F +SKLT+LLQ++  G T+T  IA I+P K  
Sbjct: 346 KEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 405

Query: 416 LDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMD 475
            + T S L  ATK K IKN+P+ G+++ K+ L+K ++ EL K KSD LS KS D GIYM 
Sbjct: 406 AEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKD-GIYMT 464

Query: 476 EKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETI 535
           + HY ELT  LE+YK ++Q  K  I ++  +   +  +KR   E++E QRIK+++L + I
Sbjct: 465 QDHYKELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKI 524

Query: 536 SNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLK-LLYDKELVK 594
           ++L   ++KQ K E +L      L   +  +Q S++   D ++  +++++ +LYD  +  
Sbjct: 525 AHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYD-HVTS 583

Query: 595 LKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVKELLTNSANQVLDTS 654
            K S+    A +K                 + E+ ++     S   ++  +   ++L+++
Sbjct: 584 FKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESN 643

Query: 655 PKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXXXFLKSSHEELIDTYI 714
           PK+FE +  +L ++   V+   N+  + L DISEE+            K++HEE +  ++
Sbjct: 644 PKHFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHV 703

Query: 715 NRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKWE 774
           ++TYH ++  + E    FK+++D ++E+N             E+V  E+  F P K+KWE
Sbjct: 704 DKTYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWE 763

Query: 775 LASNEIIENFNESITKNKNKNSEI 798
            +    +EN N+  + N   +S +
Sbjct: 764 SS----LENINKCDSLNNTFDSTV 783

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  366 bits (939), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 259/815 (31%), Positives = 419/815 (51%), Gaps = 67/815 (8%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEV-IVLDESTG-----RKKIYTLDA 62
           NITVAVRCR   + E    S  I+++ D     SNEV I   +  G       K YT+D 
Sbjct: 53  NITVAVRCRGRNEREIKLKSSVIVTVPD--INGSNEVSINTTDDVGITAQMNSKTYTVDK 110

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121
           V+G   +Q+ +FDE   P +  F  GYN +++ YG   +GK YT+ G+    +   N E 
Sbjct: 111 VFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGEL 166

Query: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXX 181
           SE+ G++PR+L +LF  LE N  D+++KCSF+E+YN++L+DLL D               
Sbjct: 167 SESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNI--- 223

Query: 182 XXXKKLRIVDS---------ASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKR----- 227
               KLRI DS          SN    A S N+S R N   +N        +R++     
Sbjct: 224 ---NKLRIFDSSTASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSR 280

Query: 228 --------------------MGKRSLPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSS-- 265
                               M K S                            SL++   
Sbjct: 281 YSNPENSNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQ 340

Query: 266 HERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITL 325
            +  N IYIQNLQE  I+  +EG+A+++KGLK R++AST      N+FS RSH+IF ITL
Sbjct: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVAST----KMNDFSSRSHTIFTITL 396

Query: 326 YKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNS 379
           YKE +   +FR+SK++ V+ AGSE  + + + N      G+ N +L +  ++IN + + +
Sbjct: 397 YKEHQ-GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN 455

Query: 380 TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKG 439
            +  F +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G
Sbjct: 456 NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 515

Query: 440 SVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNS 499
           S+I+K+ L+K ++ EL + KSDLLS KS + GIYM ++HY +L   L+++K +   SK  
Sbjct: 516 SIISKDILLKNITTELSQVKSDLLSTKSKE-GIYMSQEHYQKLMNELDNHKTEADESKRI 574

Query: 500 INELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKL 559
           I  L+ +   +  +KRT  E+NE QRIKL   +++I+ L   +E Q+ +E  L +   KL
Sbjct: 575 IERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKL 634

Query: 560 HSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXX 619
            +     +K +E Y  ++I +++K++ + + +L+ L+N L+ +   IK            
Sbjct: 635 QTSCDTFKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGS 694

Query: 620 XXXXXKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKY 679
                + E++K+   +Q K ++         L  +P+ F+++  ++ ++   ++ +H   
Sbjct: 695 NLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAV 754

Query: 680 SELLSDISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIY 739
           ++ LSDISEE+            +++HE+LI+ +IN T   +   +      FK +++ +
Sbjct: 755 AQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKH 814

Query: 740 VEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKWE 774
           +E N             E++  E+  F P KKKWE
Sbjct: 815 LESNRNLMLNSFKAATDEVINKEMELFIPRKKKWE 849

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  343 bits (880), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 252/814 (30%), Positives = 412/814 (50%), Gaps = 109/814 (13%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR   ++E  + S  ++++ D   GT+   I     TG       K YT+D V
Sbjct: 8   NITVAVRCRGRNEKEVKAKSSVVVAVPD-VTGTNEVSINTTGDTGITAQINSKTYTVDRV 66

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122
           +G   DQ  +F     P ++ F  GYN +++ YG   +GK YT+ G+    +   + E S
Sbjct: 67  FGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----ERLYDGELS 122

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXXX 182
           E  G++PRVL +LF  L+++ +D++IKCSF+E+YN+EL+DLL                  
Sbjct: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLL-----------DETPDSS 171

Query: 183 XXKKLRIVDSASNGLRSA------------GSSNSSTRDNSPLTNSKKIPTAMMRKRMGK 230
             +KLRI DS +N   S             GS++ + R   P T             M K
Sbjct: 172 MPRKLRIFDSVTNPNSSRSSSRNSSPKPPEGSTSGTKRRIRPNT-------------MYK 218

Query: 231 RSLPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMA 290
            S  P                             S E  ++I+IQNLQE  I + +EG+ 
Sbjct: 219 PSRSPTVKPTL-----------------------SSELNSAIHIQNLQEFHIMDAKEGIR 255

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEY 350
           ++++GL++R++AST      N+ S RSH+IF I LY++    E FR+SK++ V+ AGSE 
Sbjct: 256 LLQRGLRHRQVAST----KMNDVSSRSHTIFTIMLYRKCN-GESFRVSKMNLVDLAGSEN 310

Query: 351 GDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTL 404
              + ++N      G+ N +L +  ++IN + + + +  F +SKLT+LLQ++  G T+T 
Sbjct: 311 ISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTA 370

Query: 405 FIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLS 464
            IA I+P K   + T S L  ATK K IKN+P+ GS I K+ L+K ++ ELVK +SDLL+
Sbjct: 371 LIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLA 430

Query: 465 YKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQ 524
            KS D GIYM +++Y ELT  LE+YK ++Q  K +I  L+ +   +  EKR   E+NE Q
Sbjct: 431 TKSKD-GIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQ 489

Query: 525 RIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKL 584
           R+K++ L   I  L   +++Q K E EL N+  +L   L  MQ S++ Y D+    Q ++
Sbjct: 490 RLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEM 549

Query: 585 -KLLYD----------KELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIAN 633
            ++LY+           E+ KLK + E  F D+   +                E+ +I +
Sbjct: 550 ERVLYENIGSFKHSLLNEIEKLKGTEEDGF-DVDANIDTLTK-----------ELNRIYD 597

Query: 634 QSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXX 693
              +   E+     N++ + +P Y + +   ++++   V    +     LS ISEE+   
Sbjct: 598 FINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHL 657

Query: 694 XXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXX 753
                  F K++ ++ +D +++RTYH+++  +       +++++  +E N          
Sbjct: 658 KDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKN 717

Query: 754 XXXEIVENELTQFNPEKKKWELASNEIIENFNES 787
              E+V  E+   +P K+ WE +    +EN NE 
Sbjct: 718 AASEVVAKEMGLLDPVKQAWESS----LENINEC 747

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  338 bits (867), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 251/814 (30%), Positives = 408/814 (50%), Gaps = 82/814 (10%)

Query: 1   MIESAKME-NITVAVRCREPIDEEKHSGSPTIISI----GDNEDG--TSNEVIVLDESTG 53
           M++ A+ E NITVAVRCR   + E  + S  ++++    G NE    T++EV +  +   
Sbjct: 13  MLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNS 72

Query: 54  RKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSE 113
           R   YT+D V+G   DQ  +F E   P +  F  GYN +++ YG   +GK YT+ G+  +
Sbjct: 73  R--TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EK 129

Query: 114 LQNANNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXX 173
           L +   ++S   G++PR++ +LF  LE+  +D ++KCS++E+YN+EL+DLL         
Sbjct: 130 LYDGQLSDSA--GIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLL--------- 178

Query: 174 XXXXXXXXXXXKKLRIVDSAS-NGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRS 232
                      K+LRI DS+S N    A S ++S R+          P         +R 
Sbjct: 179 ----DESHDSSKRLRIFDSSSMNHSSRASSQSNSPRE----------PEVAHNGFSRRRQ 224

Query: 233 LPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMAII 292
            PP                           Q   E  + IY+QN+QE  I    EG+ ++
Sbjct: 225 RPPPVKANRMSATK----------------QQLSESGSGIYVQNVQEFHIINAREGINVL 268

Query: 293 KKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGD 352
           +KGLK+R++AST      N+FS RSH+IF I LYK  +  E+FR+SK++ V+ AGSE   
Sbjct: 269 QKGLKHRQVAST----KMNDFSSRSHTIFTIMLYKNCD-GELFRVSKMNLVDLAGSENIS 323

Query: 353 NNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFI 406
            + ++N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T  I
Sbjct: 324 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALI 383

Query: 407 ANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYK 466
           A I+P K   D T S L  A K K IKN P+ G+++ K+ L+K +S+EL K KSD LS K
Sbjct: 384 ATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTK 443

Query: 467 SNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRI 526
           S D GIYM  +HY E+   LE+ + +IQ SK  I  LT + N +  +K+  +E+ E Q  
Sbjct: 444 SKD-GIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNS 502

Query: 527 KLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKL 586
           K++ L+ TI  L   +E+Q   E+EL     KL   L  MQ S++ Y   E+ LQN +K 
Sbjct: 503 KIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKE 562

Query: 587 LYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXXKAEILKIANQSQSKVKELLTNS 646
           +  + +   + S+  +   +K  M              K  I  I       +K +  N 
Sbjct: 563 VLYQGITSYRESMNQHLEKVKVSM-------LDKNLSIKENINNITTIFDDTLKSVEANG 615

Query: 647 ANQ-------VLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFXXXXXXXXX 699
           ++        + +T   Y ++ +  + +L+  +    N  +  L++ISEE          
Sbjct: 616 SDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQ 675

Query: 700 XFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNXXXXXXXXXXXXXEIV 759
              K+S +E++D  +   Y +V+  S +       ++  +VE++             EI+
Sbjct: 676 HLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEII 735

Query: 760 ENELTQFNPEKKKWELASNEIIENFNESITKNKN 793
           +NE + F P + +W +AS    +N N+    ++N
Sbjct: 736 DNERSLFQPIRDRW-IAS---CDNINQCDASHQN 765

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  308 bits (788), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 226/810 (27%), Positives = 393/810 (48%), Gaps = 108/810 (13%)

Query: 9   NITVAVRCREPIDEEKHSGSPTI-----------ISIGDNEDGTSNEVIVLDESTGRKKI 57
           NITVAVRCR     E  + SP +           +SI  N  G S       E+  + K 
Sbjct: 26  NITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSI--NTSGGSGI-----EAQLQAKT 78

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           YT+D VYG    QK +F++   P +  F  GYN +++ YG   +GK YT+ G+      A
Sbjct: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVE--MGA 136

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLI----DXXXXXXX 173
               +   G+ PR+L +LF+ L+   +D+++KCSFVE+YN++LRDLL     D       
Sbjct: 137 EGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTEN 193

Query: 174 XXXXXXXXXXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRM----- 228
                      KKLRI DS            +++R NSP+TN+   PT   R        
Sbjct: 194 SSKQPESLNASKKLRIFDS------------NNSRSNSPVTNTNN-PTHKARSDYLKKKL 240

Query: 229 ------------------GKRSLPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLN 270
                             GK  +PP                                   
Sbjct: 241 KSNRKKSLDDMSLNANAGGKTHVPPTQT-------------------------------- 268

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            IYIQNL++  I+  +EG+ ++++GL+ R++A+T      N+ S RSH+IF ITLYK+ +
Sbjct: 269 GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATT----KLNDVSSRSHTIFTITLYKKFK 324

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASF 384
            ++++R+SK++ V+ AGSE  +   + N      G+ N +L +  ++IN + + S +  F
Sbjct: 325 -DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPF 383

Query: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444
            +SKLT+LLQ++  G T+T+ IA I+P K   + TCS L  A+K K IKN+P+ GS I K
Sbjct: 384 RESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIK 443

Query: 445 ESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELT 504
           + L+K +S EL+K ++DL   KS + GIY+ +K+Y E+   L+++K ++   K + + L 
Sbjct: 444 DILLKDVSQELIKMRADLWCTKSKE-GIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLV 502

Query: 505 KKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG 564
           ++   +  EK++  E  +  + +L NLR  + ++   L + + + ++L      ++ I  
Sbjct: 503 QENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQT 562

Query: 565 NMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXX 624
            ++  +E Y  K    ++K + L   EL  L   + S +  +KN +              
Sbjct: 563 ELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN-VNSGNYQIHTHIDSI 621

Query: 625 KAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLS 684
           + E++ +   ++   + L  +  + +L  +PK F+ +  N+ ++    E ++ + +   S
Sbjct: 622 RGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFS 681

Query: 685 DISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNX 744
           D+SEEF          F +++H E+I T+ +     +Q +S +  ++ +  +  Y+  N 
Sbjct: 682 DLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNA 741

Query: 745 XXXXXXXXXXXXEIVENELTQFNPEKKKWE 774
                       +++  E+  F P+K KWE
Sbjct: 742 QMVTNSINDVAMDVINKEMDLFAPKKSKWE 771

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  301 bits (772), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 203/647 (31%), Positives = 359/647 (55%), Gaps = 16/647 (2%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            IYIQNL+E  IT  +EG+ ++++GL+ R++AST      N+FS RSH+IF I LYKE +
Sbjct: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVAST----KMNDFSSRSHTIFTINLYKEHD 357

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASF 384
             ++FR+SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + + + +  F
Sbjct: 358 -GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF 416

Query: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444
            +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  A K K IKN+P+ GS+ITK
Sbjct: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITK 476

Query: 445 ESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELT 504
           + L+K +++EL K K+DLLS KS D G+YM + HY ELT  LESYK ++Q  K  I+ LT
Sbjct: 477 DILVKNIASELAKVKADLLSTKSRD-GVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535

Query: 505 KKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG 564
            +   +  +K+   E++  Q+IKLQ+++++IS+L+ ++EKQ ++E  L ++ +KL S   
Sbjct: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSI 595

Query: 565 NMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXXX 624
            MQ +++ +S++E   Q K+K ++++EL++LK+ L  N   I  ++              
Sbjct: 596 EMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKI 655

Query: 625 KAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLS 684
           K E+  I + +Q++   +  +   Q++  SP     L+ ++  +++  ++ + + S  +S
Sbjct: 656 KDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISIS 715

Query: 685 DISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNX 744
           +++ E           F KS HEE+++ +I +TY  ++  S    E  K  L++Y+E++ 
Sbjct: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775

Query: 745 XXXXXXXXXXXXEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKXXX 804
                       +IV++E+  F P+KKKWE  S E+I   +    K     S +L+    
Sbjct: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWE-DSFEMINKCDSLNNKYFGDISALLSNMKT 834

Query: 805 XXXXXXXXFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEXXXXXXXXXXXXXXXFNS 864
                     +++S ++K  +     +++  ++  I  +F E                  
Sbjct: 835 SVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITM 894

Query: 865 SENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKEIFEQMEQQKLG 911
           +E+SI++FD L E++ + F+   K + +N    L E    M+Q K G
Sbjct: 895 NESSINAFDKLSESIHSAFE---KYNTANTISRLDESTNLMKQNKDG 938

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 107/196 (54%), Gaps = 21/196 (10%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NI VAVRCR   + E  + S  ++S+ D   G+S   I   E  G       K YT+D V
Sbjct: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVA-GSSEIAINTTEDVGIAGQMNSKTYTVDKV 72

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122
           +G   +Q+ +F+E   P +  F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 73  FGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD----ERLYNGELS 128

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXXX 182
           ++ G++PRVL +LF  +E   +D+IIKCSF+E+YN+EL+DLL                  
Sbjct: 129 DSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL----------DECQAINS 178

Query: 183 XXKKLRIVDSASNGLR 198
             KKLRI DS ++ +R
Sbjct: 179 TAKKLRIFDSNASQIR 194

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  259 bits (662), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 164/521 (31%), Positives = 293/521 (56%), Gaps = 14/521 (2%)

Query: 267 ERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY 326
           E+ ++IYIQ+LQE  IT+ +EG+ +++KGL +R++AST      N+ S RSH+IF +TLY
Sbjct: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST----KMNDVSSRSHTIFTLTLY 319

Query: 327 KEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNST 380
           K     E FR+SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + + + 
Sbjct: 320 KNFN-GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 378

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGS 440
           +  F +SKLT+LLQ++  G T+T  IA I+P K   + T S L  ATK K IKN+P+ GS
Sbjct: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438

Query: 441 VITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSI 500
            + K+ L+K +S+EL K KSD LS KS + GIYM   HY+E+   +E+YK +IQ S+  I
Sbjct: 439 FMMKDILVKNISHELAKLKSDFLSTKSKE-GIYMSHLHYNEVMNDIENYKTEIQESRREI 497

Query: 501 NELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLH 560
            +L+ +   +  +K++ ++  E QR++++NL+ ++  L   ++ + K E EL N+ +KL 
Sbjct: 498 EKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLK 557

Query: 561 SILGNMQKSVEKYSDKEIHLQNKL-KLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXX 619
             + NMQ +++ + D E  LQ+ + K+LYD  +++ +  +E+   ++K +          
Sbjct: 558 DAVRNMQGALKTHEDHEQRLQSDIQKMLYD-NILEYRRKIETKLDNLKQQALEQSFTIDD 616

Query: 620 XXXXXKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKY 679
                K  +  +    +     +  N A +V+   PK+F  + + L ++   V+ + ++ 
Sbjct: 617 DINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRL 676

Query: 680 SELLSDISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIY 739
            E LS I+ E           F +++H+E+++ + ++TYH++   S         ++  +
Sbjct: 677 KEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDH 736

Query: 740 VEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKWELASNEI 780
           VE+N             E++  E++ F P +K WE + N I
Sbjct: 737 VEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHI 777

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  257 bits (656), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 175/531 (32%), Positives = 292/531 (54%), Gaps = 18/531 (3%)

Query: 264 SSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNI 323
           S  E  ++I+IQNLQE  I + +EG+ ++++GL++R++AST      N+ S RSH+IF I
Sbjct: 230 SPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVAST----KMNDVSSRSHTIFTI 285

Query: 324 TLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVN 377
            LYK+    E FR+SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + +
Sbjct: 286 MLYKKCN-GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 344

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPK 437
            S +  F +SKLT+LLQ++  G T+T  IA I+P K   + T S L  ATK K IKN+P+
Sbjct: 345 KSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQ 404

Query: 438 KGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSK 497
            GS I K+ L+K ++ ELVK KSDLLS KS D GIYM +++Y ELT  LE+YK +++  K
Sbjct: 405 VGSFIMKDVLLKSVTAELVKIKSDLLSTKSKD-GIYMSQENYKELTNELENYKTEVEECK 463

Query: 498 NSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKI 557
            ++ +++ + + +  EKR   E+NE Q++KL+ L   I  L   +++Q K E EL N+  
Sbjct: 464 RAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQ 523

Query: 558 KLHSILGNMQKSVEKYSDKEIHLQNKL-KLLYDKELVKLKNSLESNFADIKNRMPXXXXX 616
           +L   L  MQ+S+  Y D+      ++ ++LYD  +   K SL      +K  +      
Sbjct: 524 ELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDN-IGSFKKSLMDEIEKLKINVDENGDD 582

Query: 617 XXXXXXXXKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINH 676
                     E+ +I +   S   E+  N   +V D +P YF+ + + ++++   V    
Sbjct: 583 VEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYS 642

Query: 677 NKYSELLSDISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLL 736
           +     LS ISEE+          F K++ +E +D +++RTYH+++  +       +++L
Sbjct: 643 SNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREML 702

Query: 737 DIYVEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKWELASNEIIENFNES 787
           +  ++ N             E+V  E+   +P K+ WE +    +EN NE 
Sbjct: 703 NEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENS----LENINEC 749

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 96/162 (59%), Gaps = 11/162 (6%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63
           NITVAVRCR   ++E  + S  ++++ D   GT+   I     TG       K YT+D V
Sbjct: 8   NITVAVRCRGRNEKEVKARSSVVVAVPD-VTGTNEVSINTTGDTGITAQINSKTYTVDKV 66

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122
           +G   DQ  +F     P ++ F  GYN +++ YG   +GK YT+ G+    +   + E S
Sbjct: 67  FGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----ERLYDGELS 122

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164
           E  G++PRVL +LF  L + G+D++IKCSF+E+YN+EL+DLL
Sbjct: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  251 bits (641), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 184/624 (29%), Positives = 320/624 (51%), Gaps = 19/624 (3%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           SIYIQNL+E  I    EG+ +++KGLK R++AST      N+ S RSH+IF I LYKE +
Sbjct: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKM----NDVSSRSHTIFTINLYKEHK 292

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASF 384
             E+F++SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + + + +  F
Sbjct: 293 -GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPF 351

Query: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444
            +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  ATK K IKN+P+ GS+I K
Sbjct: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMK 411

Query: 445 ESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELT 504
           +  +K L+NEL K K DL S K  D G+YM + HY +LT  LESYK +IQ     +  L 
Sbjct: 412 DVRLKDLNNELAKIKRDLTSTKQKD-GVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLE 470

Query: 505 KKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG 564
            +   +  +K+   E+N+ Q + L  +  T+SN+   LE Q K+E  L  ++   HS   
Sbjct: 471 LQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQIL--VEELAHSREK 528

Query: 565 N--MQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXX 622
           +  M+  +++YS+KE  +Q+ +K +++ EL+KLK  L  N   I                
Sbjct: 529 SLKMKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIK 588

Query: 623 XXKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSEL 682
             K +++ I  +SQ   K+L    + Q++  +P   E   +++K  +E  E       E 
Sbjct: 589 LIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFEN 648

Query: 683 LSDISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEK 742
           L  I +++          F KS+H  +++ ++N T   ++    +  + F++ ++ + E+
Sbjct: 649 LESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQ 708

Query: 743 NXXXXXXXXXXXXXEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKX 802
           N             ++++NE+  F   K +W+++  +I  N  + +  + +       + 
Sbjct: 709 NEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKI--NHCDYLNNSYHDQMHTYLRN 766

Query: 803 XXXXXXXXXXFI-NNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEXXXXXXXXXXXXXXX 861
                      I  +M+ IK NV+ +    ++ N++  I   + +               
Sbjct: 767 MKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQIS 826

Query: 862 FNSSENSIDSFDNLKEAMQNVFKN 885
            NS++NS+  FD + +++Q  F N
Sbjct: 827 LNSTQNSLLVFDEICKSIQFAFAN 850

 Score =  123 bits (308), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 101/164 (61%), Gaps = 9/164 (5%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISI----GDNEDG--TSNEVIVLDESTGRKKIYTLDA 62
           NI VAVRCR     E  S S  I+S+    G NE    TS++++    +    K YT+D 
Sbjct: 16  NIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122
           V+G   +Q+ +F+E   P +  F  GYN +++ YG   +GK YT+ G+  +L   + ++S
Sbjct: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD-EKLYKGDLSDS 134

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
              G++PRVL +LF+ +E   ++++IKCSF+E+YN+EL+DLLID
Sbjct: 135 A--GIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLID 176

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  229 bits (583), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 165/534 (30%), Positives = 278/534 (52%), Gaps = 29/534 (5%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N IYIQNLQE  I    +G+ +++KGL++R++AST      N+ S RSH+IF ITLYKE 
Sbjct: 332 NQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTK----MNDVSSRSHTIFTITLYKEH 387

Query: 330 EVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYAS 383
               ++R+SK++ V+ AGSE  + + +++      G+ N +L +  ++IN + + S +  
Sbjct: 388 N-GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIP 446

Query: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVIT 443
           F +SKLT+LLQ++  G T+T+ I+ I+P K  +D T S L  A+K K IKN+P  GS I 
Sbjct: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIM 506

Query: 444 KESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINEL 503
           K+ L+K ++ EL K KSDL+S +  D G+YM ++HY EL   LESYK ++Q SK +   L
Sbjct: 507 KDVLLKNITTELNKIKSDLMSTRLKD-GVYMSQQHYKELNNDLESYKTEVQESKRANERL 565

Query: 504 TKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSIL 563
             +   +  +K+   E+NE QRI+++   E I  L   L++  KRE  L  +  +L ++ 
Sbjct: 566 ISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVG 625

Query: 564 GNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPXXXXXXXXXXXX 623
            +MQ ++E Y ++++ ++   K + + E   LKN L    ++I   +             
Sbjct: 626 TSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNS 685

Query: 624 XKAEI----------------LKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKN 667
               I                LKI  Q Q K + + ++   ++L   P    +    + +
Sbjct: 686 SIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINS 745

Query: 668 LEESVEINHNKYSELLSDISEEFXXXXXXXXXXFLKSSHEELIDTYINRTYHEVQGISVE 727
           ++       NK +E LSD+SEE+          FL++++E ++  ++     +++  S  
Sbjct: 746 IDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNN 805

Query: 728 FTENFKKLLDIYVEKNXXXXXXXXXXXXXEIVENELTQFNPEKKKWELASNEII 781
              N  K ++ +   N             +IV+ E     P K+KW + S EII
Sbjct: 806 LLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKW-VKSIEII 858

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 107/193 (55%), Gaps = 25/193 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISI----GDNEDG--TSNEVIVLDESTGRKKIYTLDA 62
           NITVAVRCR   + E  + S  ++S+    G NE    TS+EV +   +    K YT+D 
Sbjct: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGI--AAHMNSKTYTVDK 69

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121
           V+G    Q  +F E   P ++ F  GYN +I+ YG   +GK YT+ G+    +   + E 
Sbjct: 70  VFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD----EKLYDGEL 125

Query: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDXXXXXXXXXXXXXXX 181
           S++ G++PRVL +LF+  E   +D+IIKCSFVE+YN++L+DLL D               
Sbjct: 126 SDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD------------SVD 173

Query: 182 XXXKKLRIVDSAS 194
              KKLRI DS S
Sbjct: 174 NTYKKLRIFDSMS 186

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 133/227 (58%), Gaps = 19/227 (8%)

Query: 263 QSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFN 322
           Q SH    SI ++ ++EI I   +EG+ ++ +G   R++AST      N+ S RSH++F 
Sbjct: 247 QGSH----SIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKC----NDLSSRSHTVFT 298

Query: 323 IT--LYKEEEVN--EVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMI 372
           IT  + K + ++  E  +  KL+ V+ AGSE  + + ++N      G  N +L +  ++I
Sbjct: 299 ITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 358

Query: 373 NGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEI 432
           N +V++S +  + +SKLT+LLQ++  G T+T  IA ++P K  ++ T S L  AT+ K I
Sbjct: 359 NALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSI 418

Query: 433 KNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHY 479
           KN P+    +TK+S I    +E+ + + +L + ++ D GIY+ ++ Y
Sbjct: 419 KNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKD-GIYITQEKY 464

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 88/173 (50%), Gaps = 19/173 (10%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDES--------TGRKKIYTL 60
           NI V VRCR     E    S  +IS      G     ++L           T  KK YT 
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTM----GAQGRDVILSNPSSSSSGSLTNVKKTYTF 109

Query: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120
           D V+G + DQ+ +F+     +      GYN ++ +YG   +GK YT+ G+ + L +  + 
Sbjct: 110 DRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHN 169

Query: 121 E-------SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
                   SE+ G++PRVL  LFKDL++   D+ +K SF+E+YN+ L+DLL D
Sbjct: 170 HDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLAD 222

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 97/164 (59%), Gaps = 10/164 (6%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIIS-IGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           NI V VRCR   + E    S  +IS +G+N      EVI+ +  TG  K YT D V+G +
Sbjct: 54  NIKVYVRCRSRNEREIREKSSVVISTLGNN----GREVILTNPGTGSNKTYTFDRVFGVE 109

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-----S 122
            DQ+ +F++    +     +GYN ++ +YG   +GK YT+ G+ + + ++ +       S
Sbjct: 110 SDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPNFVLLS 169

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
           E+ G++PRVL  LF++L     D+ +K SF+E+YN++LRDLL+D
Sbjct: 170 EHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVD 213

 Score =  114 bits (285), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 140/249 (56%), Gaps = 18/249 (7%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNIT--LYKE 328
           SI+++ ++E+ I   +EG+ ++  G   R++A+T      N+ S RSH+IF IT  + K 
Sbjct: 250 SIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKC----NDLSSRSHTIFTITTNVTKI 305

Query: 329 EEVN--EVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNST 380
             ++  +  ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V++S 
Sbjct: 306 HPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQ 365

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGS 440
           +  + +SKLT+LLQ++  G T+T  IA I+P K  ++ T S L  AT+ K IKN P+   
Sbjct: 366 HIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQ 425

Query: 441 VITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKH---YSELTKTLESYKEKIQNSK 497
           ++ KES I     E+ + + +L +  S + GIY+ ++    Y   +  +E  + KI N +
Sbjct: 426 LMAKESCIIEYIQEIERLRKELRASHSKE-GIYITQEKFETYESNSILVEEQQAKIDNLQ 484

Query: 498 NSINELTKK 506
             +  L +K
Sbjct: 485 EQLRRLKEK 493

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  118 bits (295), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 97/164 (59%), Gaps = 10/164 (6%)

Query: 9   NITVAVRCREP-IDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           NI V VRCR   + E K   S  + ++G        E+I+ ++STG  K YT D V+G +
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQ----GREIILSNQSTGNNKTYTFDQVFGVE 111

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYS----ELQNANNA-ES 122
            DQ+ LFD+    +     +GYN ++ +YG   +GK YT+ G+ S     L++ N    S
Sbjct: 112 SDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYVLLS 171

Query: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
           E+ G++PRVL  LF+ L+    D+ +K SF+E+YN++LRDLL++
Sbjct: 172 EHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVE 215

 Score =  116 bits (291), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 153/282 (54%), Gaps = 25/282 (8%)

Query: 262 LQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIF 321
           L  S+   +SI ++ ++E+ I   +EG+ ++ +G   R++A+T      N+ S RSH+IF
Sbjct: 245 LDRSNSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRC----NDLSSRSHTIF 300

Query: 322 NIT--LYKEEEVN--EVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKM 371
            IT  + K   ++  +  ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++
Sbjct: 301 TITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRV 360

Query: 372 INGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKE 431
           IN +V++S +  + +SKLT+LLQ++  G T+T  IA ++P K  ++ T S L  AT+ K 
Sbjct: 361 INALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKS 420

Query: 432 IKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHY----------SE 481
           IKN P+   ++ KES I     E+ K + +L +  + + GIY+ E+ Y           E
Sbjct: 421 IKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKE-GIYITEEKYETYESNCILVEE 479

Query: 482 LTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINER 523
               +++ +E+I+  K    E TK   E   + +  + INER
Sbjct: 480 QQAKIDNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIKSINER 521

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  116 bits (291), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITL----- 325
           SI ++ +QEI I    EG+ ++ +G   R++A+T      N+ S RSH++F IT      
Sbjct: 240 SIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKC----NDLSSRSHTVFTITTNIIEQ 295

Query: 326 -YKEEEVNEVF-RMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVN 377
             KE   N+ F ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+
Sbjct: 296 DSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPK 437
           +S +  + +SKLT+LLQ++  G+T+T  IA ++P K  ++ T S L  AT+ K IKN P+
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQ 415

Query: 438 KGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDE 476
               ++K++ +K    E+ K ++DL + + N  GI++ +
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSR-NKQGIFITQ 453

 Score =  100 bits (250), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 89/167 (53%), Gaps = 13/167 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR-----KKIYTLDAV 63
           NI V VRCR     E    S  +IS      G   + I+L   + +     KK Y  D V
Sbjct: 52  NIHVYVRCRSRNRREIDEKSSVVISTL----GPQGKEIILSNGSHQSYSSSKKTYQFDQV 107

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-- 121
           +G + DQ+ +F  T   + +    GYN +I +YG   +GK YT+ G+ + L +  + +  
Sbjct: 108 FGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNL 167

Query: 122 --SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
              E+ G++PRVL  LFK+L S   ++ +K SF+E+YN+ L+DLL D
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSD 214

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 103/347 (29%), Positives = 184/347 (53%), Gaps = 28/347 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITL----- 325
           SI ++ +QEI I    EG+ ++ +G   R++A+T      N+ S RSH++F IT      
Sbjct: 239 SIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKC----NDLSSRSHTVFTITTNIVEQ 294

Query: 326 -YKEEEVNEVF-RMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVN 377
             K+   N+ F ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+
Sbjct: 295 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 354

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPK 437
           +S +  + +SKLT+LLQ++  G+T+T  IA I+P K  ++ T S L  AT+ K IKN P+
Sbjct: 355 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQ 414

Query: 438 KGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKH---YSELTKTLESYKEKIQ 494
               ++K++ +K    E+ K ++DL + + N  GI++ +     Y   +  ++    KI 
Sbjct: 415 VNQSLSKDTCLKDYIQEIEKLRNDLKNSR-NKQGIFITQDQLDLYESNSILIDEQNLKIH 473

Query: 495 NSKNSINELTKKGNEI-RIEKRTFEEINERQRIK-LQNLRETISNLNCALEKQSKRESEL 552
           N +  I +   KGN + +++   F +  + + I  ++N     SN N  ++K      EL
Sbjct: 474 NLRGQIKKF--KGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHHTNLEL 531

Query: 553 ENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSL 599
            N +I L   L   + S E+Y+  +  LQ K+     + L  L++SL
Sbjct: 532 MN-EITLQRDLS-QETSQEQYTTSQ-ELQTKITQQVLQTLSTLQSSL 575

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 90/167 (53%), Gaps = 13/167 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR-----KKIYTLDAV 63
           NI V VRCR     E    S  +IS      G   + I+L   + +     KK Y  D V
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTL----GPQGKEIILSNGSHQSYSSSKKTYQFDQV 106

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-- 121
           +G + DQ+ +F+ T   + +    GYN +I +YG   +GK YT+ G+ + L +  + +  
Sbjct: 107 FGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNL 166

Query: 122 --SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
              E+ G++PRVL  LFK+L S   ++ +K +F+E+YN+ L+DLL D
Sbjct: 167 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSD 213

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITL----- 325
           SI ++ +QEI I    EG+ ++ +G   R++A+T      N+ S RSH++F IT      
Sbjct: 240 SIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKC----NDLSSRSHTVFTITTNIVEQ 295

Query: 326 -YKEEEVNEVF-RMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVN 377
             K+   N+ F ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPK 437
           +S +  + +SKLT+LLQ++  G+T+T  IA ++P K  ++ T S L  AT+ K IKN P+
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 438 KGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDE 476
               ++K++ +K    E+ K K+DL + + N  GI++ +
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLKNDLKNSR-NKQGIFITQ 453

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 86/162 (53%), Gaps = 13/162 (8%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR-----KKIYTLDAV 63
           NI V VRCR     E    S  +IS      G   + I+L   + +     KK Y  D V
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTL----GPQGKEIILSNGSHQSYSSSKKTYQFDQV 107

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-- 121
           +G + DQ+ +F+ T   + +    GYN +I +YG   +GK YT+ G+ + L +  + +  
Sbjct: 108 FGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKL 167

Query: 122 --SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELR 161
              E+ G++PRVL  LFK+L +   ++ +K SF+E+YN+ L+
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLK 209

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  115 bits (287), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 128/219 (58%), Gaps = 18/219 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITL----- 325
           SI ++ +QEI I    EG+ ++ +G   R++A+T      N+ S RSH++F IT      
Sbjct: 240 SIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKC----NDLSSRSHTVFTITTNIVEQ 295

Query: 326 -YKEEEVNEVF-RMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVN 377
             K+   N+ F ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPK 437
           +S +  + +SKLT+LLQ++  G+T+T  IA I+P K  ++ T S L  AT+ K IKN P+
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 438 KGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDE 476
               ++K++ +K    E+ K ++DL + + N  GI++ +
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSR-NKQGIFITQ 453

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 86/162 (53%), Gaps = 13/162 (8%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR-----KKIYTLDAV 63
           NI V VRCR     E    S  +IS      G   + I+L   + +     KK Y  D V
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTL----GPQGKEIILSNGSHQSYSSSKKTYQFDQV 107

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-- 121
           +G + DQ+ +F+ T   + K    GYN +I +YG   +GK YT+ G+ + L +  + +  
Sbjct: 108 FGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNL 167

Query: 122 --SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELR 161
              E+ G++PRVL  LFK+L S   ++ +K SF+E+YN+ L+
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLK 209

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  113 bits (283), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 167/306 (54%), Gaps = 37/306 (12%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNIT--LYK 327
           +SI ++ ++EI I    +G+ ++  G   R++A+T      N+ S RSH++F IT  + K
Sbjct: 240 SSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKC----NDLSSRSHTVFTITTNITK 295

Query: 328 EEEVN--EVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNS 379
            + V+  +  +  KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+++
Sbjct: 296 LDPVSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHT 355

Query: 380 TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKG 439
            +  + +SKLT+LLQ++  G T+T  IA I+P K  +D T S L  AT+ K IKN P+  
Sbjct: 356 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVN 415

Query: 440 SVITKESLIKILSNELVKTKSDLLSYKSND--------------NGIYMDEKHYSELTKT 485
             ++K+S I    +E+ + + +L + +  D              NGI +DE+     TK 
Sbjct: 416 QSMSKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQK----TK- 470

Query: 486 LESYKEKIQNSKNSINELTK--KGNEIRIEKRTFEEIN-ERQRIKLQNLRETI-SNLNCA 541
           +++ +E+IQ  K+   + T+  K  E R+++   + I  + QR +L +L E   SN N  
Sbjct: 471 IQNMEEQIQRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHY 530

Query: 542 LEKQSK 547
           +E+ +K
Sbjct: 531 IERVTK 536

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 84/161 (52%), Gaps = 7/161 (4%)

Query: 10  ITVAVRCREPIDEEKHSGSPTIIS-IGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           I V VRCR   + E    S  +IS +G  +         L      K+ YT D V+G + 
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFGAES 120

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSEL-----QNANNAESE 123
           DQ+ +F++    +     +GYN ++ +YG   +GK YT+ G+ + L      N      E
Sbjct: 121 DQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVLLGE 180

Query: 124 NLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164
           + G++PRVL  LF+ L+ N   + +K SF+E+YN+ L+DLL
Sbjct: 181 HAGIIPRVLVELFRWLDGN-EGYSVKVSFLELYNERLKDLL 220

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 135/242 (55%), Gaps = 18/242 (7%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNIT--LYKEE 329
           I ++ ++E  I    EG+ ++  G   R++A+T      N+ S RSH++F IT  + + +
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKC----NDLSSRSHTVFTITTNVARTD 303

Query: 330 EVN--EVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTY 381
            V+  +  ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+NS +
Sbjct: 304 PVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQH 363

Query: 382 ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSV 441
             + +SKLT+LLQ++  G T+T  IA I+P K  +D T S L  AT+ K IKN P+    
Sbjct: 364 IPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQS 423

Query: 442 ITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKH---YSELTKTLESYKEKIQNSKN 498
           ++K S +    +E+ + + +L + +  + G+Y+ E     Y   +  +E  K +IQN ++
Sbjct: 424 MSKNSCLGEYIHEIERLRQELKASRQKE-GMYITEDQFQLYESNSILVEEQKVRIQNMED 482

Query: 499 SI 500
            I
Sbjct: 483 QI 484

 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 92/166 (55%), Gaps = 12/166 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR----KKIYTLDAVY 64
           N+ V VRCR   ++E    S  +IS      G     ++L    G     K+ YT D V+
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTL----GAKGREVILSNGAGSLSHSKRTYTFDQVF 96

Query: 65  GEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE--- 121
           G + DQ+ +FDE    +     +GYN ++ +YG   +GK YT+ G+ S L + ++ +   
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 122 -SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
             E+ G++PRVL  LFK L    N++ +K SF+E+YN++L+DLL +
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAE 202

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 146/270 (54%), Gaps = 21/270 (7%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY--KEE 329
           I ++ ++E  I    EG+ ++ KG   R++A+T      N+ S RSH+IF I  +  + +
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKC----NDLSSRSHTIFTIVTHVARTD 323

Query: 330 EVN--EVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTY 381
            V+  +  ++ KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V +S++
Sbjct: 324 PVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSH 383

Query: 382 ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSV 441
             +  SKLT+LLQ++  G T+T  IA I+P +  +D T S L  AT+ K IKN P+    
Sbjct: 384 IPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQS 443

Query: 442 ITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKT----LESYKEKIQNSK 497
           ++K+S I     E+ + + +L + +  + G+Y+ ++ Y +L ++    +E  K  IQN  
Sbjct: 444 LSKDSCIMEYIYEIERLRQELKASRQRE-GMYITQEQY-DLYESNSLLVEEQKVVIQNMG 501

Query: 498 NSINELTKKGNE-IRIEKRTFEEINERQRI 526
             I    +K  E  ++ K    +  E Q++
Sbjct: 502 EQIKRFKEKYVEQTKLSKEAHRQFQESQKV 531

 Score =  101 bits (251), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 86/166 (51%), Gaps = 12/166 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR----KKIYTLDAVY 64
           NI V VRCR     E    S  ++S      G   + ++L   +      KK Y  D V+
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTM----GRKGKSVILSNPSSPLSHPKKTYMFDEVF 99

Query: 65  GEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE--- 121
           G   DQ+ +F E    + +   +GYN ++ +YG   +GK YT+ G+ S   + ++ +   
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 122 -SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
             E+ G++PRVL  LFK L     +H +K SF+E+YN+ L+DLL D
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLAD 205

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  107 bits (267), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 121/216 (56%), Gaps = 15/216 (6%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIF----NITLY 326
           SI ++ ++EI I    EG+ ++ +G   R++AST      N+ S RSH+IF    N+T  
Sbjct: 339 SITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTK----LNDLSSRSHTIFTIITNVTKV 394

Query: 327 KEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNST 380
                    +  KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V+ S 
Sbjct: 395 DPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSH 454

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGS 440
           +  + +SKLT+LLQ++  G T+T  IA ++P K  L+ T S L  AT+ K IKN P+   
Sbjct: 455 HIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQ 514

Query: 441 VITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDE 476
            ++K++ I    NE+ + +++L   ++ + GIY+ +
Sbjct: 515 SLSKDTFIHEYINEIDRLRNELKLARTKE-GIYITQ 549

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 92/231 (39%), Gaps = 72/231 (31%)

Query: 2   IESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRK------ 55
           +   K +NI V VRCR     E    S  +IS      G +   ++L  +  RK      
Sbjct: 44  LSHTKDDNIKVYVRCRSRTQREIDEKSSVVISTL----GANGNKVILSPNQSRKLYNTNA 99

Query: 56  -----------------------------KIYTLDAVYGEQDDQKKLFDETVIPFYKSFF 86
                                        + YT D V+G + DQ+ LF+     +     
Sbjct: 100 NGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEML 159

Query: 87  DGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE----SENLGVVPRVLSRLFKDLESN 142
            GYN ++ +YG   +GK YT+ G+ + L N ++ +     E+ G++PRVL  LFK+L  N
Sbjct: 160 QGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKN 219

Query: 143 -----------------------------GNDHIIKCSFVEIYNDELRDLL 164
                                          ++ +K SF+E+YN++L DLL
Sbjct: 220 DTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  104 bits (260), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 122/231 (52%), Gaps = 28/231 (12%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIF----NITLY 326
           SI ++ ++EI I    EG+ ++  G   R++AST      N+ S RSH++F    NIT  
Sbjct: 288 SIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKC----NDLSSRSHTVFTIATNITKI 343

Query: 327 KEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNST 380
                 +  +  KL+ V+ AGSE  + + ++N      G  N +L +  ++IN +V++S 
Sbjct: 344 DPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQ 403

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGS 440
           +  + +SKLT+LLQ++  G T+T  IA I+P K  ++ T S L  A + K IKN P+   
Sbjct: 404 HIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQ 463

Query: 441 VITKESLIKILSNELVKTKSDLLSYKSND--------------NGIYMDEK 477
            ++K++ I    +E+ + + +L + +  D              NGI +DE+
Sbjct: 464 SMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQ 514

 Score = 97.8 bits (242), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 13/164 (7%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIIS-IGDNEDGTSNEVIVLDESTG---RKKIYTLDAVY 64
           NI V VRCR   + E    S  +IS +G       N+VI+ + S+     KK Y+ D V+
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQ----GNQVILSNPSSPLSYPKKSYSFDRVF 163

Query: 65  GEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE--- 121
           G + DQ+ +F++    +      GYN ++ +YG   +GK YT+ G+ + L N  + +   
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 122 -SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164
             E+ G++PRVL  LFK L +  ND+ +K SF+E+YN+ L+DL 
Sbjct: 224 LGEHAGIIPRVLVNLFKML-ALENDYSVKISFLELYNERLKDLF 266

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 126/224 (56%), Gaps = 23/224 (10%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKE- 328
           +SI ++ ++EI I    EG+ ++ +G   R++AST      N+ S RSH+IF IT     
Sbjct: 252 SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKC----NDLSSRSHTIFTITTNITK 307

Query: 329 -EEVN--EVFRMSKLSFVNFAGSEYGDNNTSKNGA----------FNSNLQSFNKMINGM 375
            + V+  +  ++ KL+ V+ AGSE    N S++GA           N +L +  ++IN +
Sbjct: 308 IDPVSGEQYVKIGKLNLVDLAGSE----NISRSGAENMRAQEAGLINKSLLTLGRVINAL 363

Query: 376 VNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNE 435
           V++S +  + +SKLT+LLQ++  G T+T  IA ++P K  ++ T S L  AT+ K IKN 
Sbjct: 364 VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNT 423

Query: 436 PKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHY 479
           P+    ++K+  I     E+ + + +L + +  D G+Y+ ++ +
Sbjct: 424 PQINQSMSKDVCINEYVQEIERLRQELKASRQKD-GVYITQEQF 466

 Score = 97.8 bits (242), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 88/169 (52%), Gaps = 10/169 (5%)

Query: 3   ESAKMENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDEST---GRKKIYT 59
           ES    NI V VRCR     E    S  +IS          EV++ D S+     KK Y 
Sbjct: 53  ESELGSNIQVYVRCRSRNQREIEEKSSVVIS---TMGAQGKEVVLSDPSSVLSHTKKTYI 109

Query: 60  LDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANN 119
            D V+G + DQ+ +F+ T   +      GYN +I +YG   +GK YT+ G+ + L +  +
Sbjct: 110 FDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLES 169

Query: 120 AE----SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164
            +     E+ G++PRVL  LF+ L     ++ +K SF+E+YN+ L+DLL
Sbjct: 170 QDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL 218

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 92/168 (54%), Gaps = 17/168 (10%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V VRCR    +E    S  ++S      G +   I++  ST + K Y  D V+G + 
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTL----GQNGNQIIISNSTNKNK-YIFDNVFGVES 63

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE----SEN 124
           DQ+ +F+     + +   DGYN ++ +YG   +GK YT+ G+ + + + N+ +     E+
Sbjct: 64  DQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNILLGEH 123

Query: 125 LGVVPRVLSRLFKDLESNGND--------HIIKCSFVEIYNDELRDLL 164
            G++PRVL +LF  LE + ++        + +K SF+E+YN+ L+DLL
Sbjct: 124 AGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 97/339 (28%), Positives = 157/339 (46%), Gaps = 62/339 (18%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           SI ++ +QEI I    EG+ ++ KG   R++ ST      N+ S RSH+IF IT    + 
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTK----LNDLSSRSHTIFTITTNIIKL 262

Query: 331 VN----EVFRMSKLSFVNFAGSE----YGDNNTSKNGAFNSNLQSFNKMINGMVN--NST 380
            N    E  ++ KL+ V+ AGSE     G   + + G  N +L +  ++IN + +  N+T
Sbjct: 263 DNQTNKEYIKIGKLNLVDLAGSENITKSGLKRSQETGLINKSLLTLGRVINALSDKTNNT 322

Query: 381 YA----------------------SFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDA 418
           +                        + +SKLT+LLQ++  G+T+T  IA I+P K  LD 
Sbjct: 323 HGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDE 382

Query: 419 TCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMD-EK 477
           T S L  AT+   IKN PK        + I    N++ + K +L +      GI++  EK
Sbjct: 383 TISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIPLEK 442

Query: 478 --HYSELTKTLESYKEKIQNSKNSINELTKKGNE-IRIEKRTFEEINERQRIKLQNLRET 534
             +Y      +E    KI N  N I +  KK  E I+I K+                   
Sbjct: 443 LNYYKSNEILIEEQNAKINNMTNQIAKFKKKFVEQIQINKQ------------------- 483

Query: 535 ISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKY 573
              LN  ++K    +++L  IK+KL  ++ N ++++ +Y
Sbjct: 484 ---LNTDMKKSQWEKNQLLTIKLKLIILIVNFKQNIFQY 519

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 85/180 (47%), Gaps = 25/180 (13%)

Query: 8   ENITVAVRCREPIDEEKHSGSPTIISIGDN-----EDGTSNEVIVLDESTGRKKIYTLDA 62
           +NI VAVR R P+  E   G P I  +        +   S   ++  E   + KI+T D 
Sbjct: 3   DNIKVAVRLRSPLPREH--GQPIITQVTSPTSFVIQQHISTSSLLATEEFTQGKIFTFDH 60

Query: 63  VY----GEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNAN 118
            +        DQ+ ++D     +     DGYN  I++YG   SGK++T+ G        N
Sbjct: 61  CFKYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHN 120

Query: 119 NA-------ESENLGVVPRVLSRLFK--DLESNGNDHI-----IKCSFVEIYNDELRDLL 164
           N        E   +G++PRV   LF   ++ ++  D I     I CS++EIYN+++RDLL
Sbjct: 121 NQTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 88/182 (48%), Gaps = 25/182 (13%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           + +++ L E  + ++EE +  +K+G + R +  T    + N  S RSH+IF I++ + E 
Sbjct: 196 TTFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVT----NMNNSSSRSHAIFTISIKQSET 251

Query: 331 V---NEVFRMSKLSFVNFAGSEYGDNNTSKNGA----------FNSNLQSFNKMINGMV- 376
               +   R S +  V+ AGSE      S  GA           N +L +  ++++ +  
Sbjct: 252 TLAGDLTERRSSIKLVDLAGSE----RVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAK 307

Query: 377 -NNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNE 435
            N      + DS LT +L+ N  G ++T+ IA ++P     + T S L  AT  KE+KN 
Sbjct: 308 KNRPKLIPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNT 365

Query: 436 PK 437
            +
Sbjct: 366 AR 367

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 87/176 (49%), Gaps = 18/176 (10%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY---KE 328
           I + NL    ++ +E+ M ++ KG  NR    T SA+D NE S RSH++  + +    + 
Sbjct: 241 ITVANLSHHPLSTVEDVMDLVIKGNTNR----TTSATDANETSSRSHAVLQVHITQRNRT 296

Query: 329 EEVNEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV-----N 377
            E+ E  + + LS ++ AGSE      ++      GA  N +L +    IN +       
Sbjct: 297 AELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKR 356

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
              +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  AT+ KEIK
Sbjct: 357 GGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIK 412

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 14/115 (12%)

Query: 52  TGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEY 111
           +G +K +  D V+     Q ++++ T  P   S  DG+N ++ +YG+   GK YT+ G  
Sbjct: 120 SGEQK-FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-- 176

Query: 112 SELQNANNAESENLGVVPRVLSRLFKDLE--SNGNDHIIKCSFVEIYNDELRDLL 164
                      EN G++   +  LF  +E   +     +  S++EIYN+ +RDLL
Sbjct: 177 ---------TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL 222

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 86/177 (48%), Gaps = 18/177 (10%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY---KE 328
           I + NL    +  +E+ M ++ KG  NR    T SA+D NE S RSH++  + +    + 
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINR----TTSATDANETSSRSHAVLQVHITQKNRT 296

Query: 329 EEVNEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV-----N 377
            E+ E  + + LS ++ AGSE      ++      GA  N +L +    IN +       
Sbjct: 297 AELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRG 356

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
              +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  AT+ KEIK 
Sbjct: 357 GGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKT 413

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 14/115 (12%)

Query: 52  TGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEY 111
           +G +K +  D V+     Q+++++ T  P   S  DG+N ++ +YG+   GK YT+ G  
Sbjct: 120 SGEQK-FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-- 176

Query: 112 SELQNANNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYNDELRDLL 164
                     +EN G++   +  LF  +E   +     +  S++EIYN+ +RDLL
Sbjct: 177 ---------TAENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL 222

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 82/161 (50%), Gaps = 19/161 (11%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR--KKIYTLDAVYGE 66
           NI V  R R P+  E  + +   ++  D+E+G     IV   +TG    + +  D ++ +
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQNFKFDRIFDQ 436

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
            +  + +F+E +    +S  DGYNV I +YG   SGK YT+        N  N      G
Sbjct: 437 NETNENVFEE-IGQLVQSSLDGYNVCIFAYGQTGSGKTYTML-------NPRN------G 482

Query: 127 VVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  +S +F   ++L+  G ++ I C F+EIYN+ + DLL
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (47%), Gaps = 10/146 (6%)

Query: 297 KNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNT- 355
           K  R+ ST S S  NE S RSHS+F I L     +        L+ V+ AGSE  +++  
Sbjct: 569 KANRLRSTASTS-ANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINSSQV 627

Query: 356 -----SKNGAFNSNLQSFNKMINGMVNNST---YASFLDSKLTQLLQNNFDGITRTLFIA 407
                 +    N +L     +++ + +N     +  F +SKLT LLQ +  G ++TL   
Sbjct: 628 LGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLMFV 687

Query: 408 NIAPLKKQLDATCSVLTMATKIKEIK 433
           NI+  +  L+ T + L  A+K+   K
Sbjct: 688 NISACESHLNETLNSLRFASKVNSTK 713

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 87/178 (48%), Gaps = 17/178 (9%)

Query: 269 LNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY-- 326
           +  I + NL   T   +++ M ++ +G  NR    T S +D NE S RSH++  I +   
Sbjct: 249 IKGISVANLSHHTPQTVQDVMDLVVRGNMNR----TTSPTDANETSSRSHAVLQINVVQK 304

Query: 327 -KEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV--- 376
            +  E++E    + LS ++ AGSE      ++      GA  N +L +    IN +    
Sbjct: 305 NRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 364

Query: 377 -NNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             ++ +  + DSKLT+LL+ +  G  +T+ I  IAP     D T + L  A + KEIK
Sbjct: 365 RRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIK 422

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 14/115 (12%)

Query: 52  TGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEY 111
           +G +K +  D ++ E   Q ++++ T  P   S  DG+N ++ +YG+   GK +T+ G  
Sbjct: 131 SGEQK-FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-- 187

Query: 112 SELQNANNAESENLGVVPRVLSRLFKDLES-NGNDHI-IKCSFVEIYNDELRDLL 164
                      E  GV+   +  LF+ +E    + H  +  S++EIYN+ +RDLL
Sbjct: 188 ---------TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 87/170 (51%), Gaps = 32/170 (18%)

Query: 8   ENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI----YTLDAV 63
           +NI V+VR R+P+  E+ S    I  +       S  +I +++   R++     + L   
Sbjct: 3   DNIKVSVRLRKPL--ERESAERVIAQV------VSENLIKVEQRAKREETRNFEFDLCCT 54

Query: 64  YGE--QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE 121
           Y E  ++DQ +L+++    +     DGYN  I +YG   SGK++T+ G            
Sbjct: 55  YSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTG-----------S 103

Query: 122 SENLGVVPRVLSRLF--KDLESNGNDHI-----IKCSFVEIYNDELRDLL 164
           +E  G+VPR+   LF  +++  + +D       I+CS++EIYN+ +RDLL
Sbjct: 104 AELPGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 87/175 (49%), Gaps = 17/175 (9%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE- 329
           + +++ LQE  +  ++E +  +++G + + + +T      NE S RSH+IF I + ++E 
Sbjct: 167 TTFVEGLQEFEVNSVDEILDYLRQGSERKTVGATLV----NEQSSRSHTIFTINVEQKEN 222

Query: 330 -EVNEVF-RMSKLSFVNFAGSEYGDNNTS-----KNGA-FNSNLQSFNKMINGMV--NNS 379
             +  V  R S +  ++ AGSE  + + +     K G+  N +L +  ++I  +      
Sbjct: 223 SPLGHVLERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQP 282

Query: 380 TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
               + D+ LT +L+ +  G ++T  IA ++P     + T S L  AT  + +K 
Sbjct: 283 RLIPYRDAALTWVLKESLGGNSKTCMIACVSPCD--FEETMSTLRYATLARSVKT 335

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 79/162 (48%), Gaps = 20/162 (12%)

Query: 9   NITVAVRCREPI-DEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           NI V  R R P+ D E    S   I   DN  GT  + + + +  G  +IY  D ++ + 
Sbjct: 382 NIRVFCRMRPPLPDIEDPDISNIKIKRFDNNYGT--QSMKVTKENGESQIYKFDRIFDQA 439

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGV 127
           D   ++F E +    +S  DG+NV I +YG   SGK YT+              ++N G+
Sbjct: 440 DSNTEVFKE-IGQLVQSSLDGHNVCIFAYGQTGSGKTYTML-------------NDNDGM 485

Query: 128 VPRVLSRLFKDLES---NGNDHIIKCSFVEIYNDELRDLLID 166
           +P  +S +F   ES    G  + I C F+EIYN+ + DLL D
Sbjct: 486 IPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRD 527

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 76/153 (49%), Gaps = 15/153 (9%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEY 350
           ++KK  K R  A+T S    NE S RSHS+F I L  + E+        L+ V+ AGSE 
Sbjct: 571 VLKKATKLRATAATNS----NERSSRSHSVFMIYLKGKNEITGDSSEGILNLVDLAGSER 626

Query: 351 GDNNTSKNGA-------FNSNLQSFNKMINGMVNNST---YASFLDSKLTQLLQNNFDGI 400
             N++   GA        N +L     +I+ +  N     +  F +SKLT LLQ +  G 
Sbjct: 627 L-NSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGS 685

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           ++TL   NI+P K  L+ T + L  A+K+   K
Sbjct: 686 SKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 88/179 (49%), Gaps = 22/179 (12%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           SI + NL      ++E+ M ++ KG  NR    T SA+D NE S RSH++  I + +   
Sbjct: 243 SIRVSNLSHYNPQKVEDVMDLVIKGNMNR----TTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 331 VNEV---FRMSKLSFVNFAGSEYGDNNTSKN-------GA-FNSNLQSFNKMINGMVNN- 378
             ++      + LS ++ AGSE     T+KN       GA  N +L +    IN +  N 
Sbjct: 299 TADLKSDHTFATLSIIDLAGSERA--ATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 379 ----STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
               S +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIK 415

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 13/110 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++     QK +++ T+IP   S  DG+N ++ +YG+   GK YT+ G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISG-------- 179

Query: 118 NNAESENLGVVPRVLSRLFKDLES-NGNDHI-IKCSFVEIYNDELRDLLI 165
                EN G++ + +  LF  +E+     H  +  SF+EIYN+ +RDLL 
Sbjct: 180 ---SPENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLC 226

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 77/161 (47%), Gaps = 20/161 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R  +D EK   S   I    +E+GT  + I +       K +T D  +G Q+
Sbjct: 362 NIRVFCRLRPHLDNEKEDSSSISIDGFSDENGT--QCITIKREAKYHK-FTFDRCFGAQE 418

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
             K +F E +    +S  DGYNV I +YG   SGK YT+           N E    G++
Sbjct: 419 SNKDIFHE-IGQLIQSSLDGYNVCIFAYGQTGSGKTYTML----------NPED---GII 464

Query: 129 PRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLLID 166
           P  L+ +F   + L+  G  + I   F+EIYN+ ++DL  D
Sbjct: 465 PSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 77/161 (47%), Gaps = 20/161 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R  +D EK   S   I    +E+GT  + I +       K +T D  +G Q+
Sbjct: 362 NIRVFCRLRPHLDNEKEDSSSISIDGFSDENGT--QCITIKREAKYHK-FTFDRCFGAQE 418

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
             K +F E +    +S  DGYNV I +YG   SGK YT+           N E    G++
Sbjct: 419 SNKDIFHE-IGQLIQSSLDGYNVCIFAYGQTGSGKTYTML----------NPED---GII 464

Query: 129 PRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLLID 166
           P  L+ +F   + L+  G  + I   F+EIYN+ ++DL  D
Sbjct: 465 PSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 21/161 (13%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVI-VLDESTGR-KKIYTLDAVYGE 66
           NI V  R R P+  E  + +   + + +  D   N+VI V     G   +I+  D ++ E
Sbjct: 354 NIRVFCRVRPPLPRE--NATSNHLKVREFNDDAGNQVIEVAKNGYGSGPQIFKFDRIFNE 411

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
           ++    +F E +    +S  DGYNV I +YG   SGK YT+                  G
Sbjct: 412 KETNYDVFQE-IGQLVQSSLDGYNVCIFAYGQTGSGKTYTMLNPTD-------------G 457

Query: 127 VVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  ++ +F   K+L+  G  + + C FVEIYN+ + DLL
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 77/171 (45%), Gaps = 17/171 (9%)

Query: 274 IQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNE 333
           I N+  + +T       ++K+  K R  AST      NE S RSHSIF + L  E  +  
Sbjct: 532 ITNVTTVPLTSKNTVDELLKRANKLRSTASTAC----NERSSRSHSIFIVHLSGENVLTG 587

Query: 334 VFRMSKLSFVNFAGSEYGDNNTSK--------NGAFNSNLQSFNKMINGMVNNST---YA 382
                 L+ V+ AGSE    NTS+          + N +L     +I+ + +      + 
Sbjct: 588 ERSHGILNLVDLAGSERI--NTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHI 645

Query: 383 SFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
            F +SKLT LLQ +  G ++TL   NI+      + T + L  A+K+   K
Sbjct: 646 PFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 85/178 (47%), Gaps = 18/178 (10%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N I + NL       +E+ M ++  G  NR    T SA+D NE S RSH++  I + +  
Sbjct: 243 NRISVANLSHHRPKTVEDVMDLVVLGNTNR----TTSATDANETSSRSHAVLQINIVQSS 298

Query: 330 EVNEV---FRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV---- 376
              E+      +KLS ++ AGSE   +  ++      GA  N +L +    IN +     
Sbjct: 299 RTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDG 358

Query: 377 -NNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
              + +  + DSKLT+LL+ +  G  +T+ I  ++P     D T + L  A + KEIK
Sbjct: 359 TRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIK 416

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q++++  T      +  DG+N ++ +YG+   GK YT+ G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSG-------- 180

Query: 118 NNAESENLGVVPRVLSRLFKDLE--SNGNDHIIKCSFVEIYNDELRDLL 164
                E  GV+   +  LF  +E   +     I  S++EIYN+ +RDLL
Sbjct: 181 ---TPERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 81/175 (46%), Gaps = 31/175 (17%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI----------- 57
           NI V  R R P+ +  +S   +  SI   ED    EV   D++ G + I           
Sbjct: 381 NIRVYCRVRPPLKKITNSPQTSHFSIEIPEDKNILEVQNFDQTKGTQTIKVKKLDSNNNA 440

Query: 58  ---YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSEL 114
              +  D V+ + +   ++F+E +    +S  DGYNV I +YG   SGK YT+       
Sbjct: 441 TYSFEFDHVFKQDEGNSEVFNE-IEQLIQSALDGYNVCIFAYGQTGSGKTYTML------ 493

Query: 115 QNANNAESENLGVVPRVLSRLFKDLES---NGNDHIIKCSFVEIYNDELRDLLID 166
                  + N GV+P  +  +F  ++S   NG ++ + C F+E+YN+ + DL  D
Sbjct: 494 -------NPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRD 541

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 81/182 (44%), Gaps = 24/182 (13%)

Query: 273 YIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVN 332
           Y+ N++   I  I + + +I K    R  +STG     N  S RSH IF I L       
Sbjct: 563 YVTNIKRFKIENISDTIGLINKSKIKRMTSSTGL----NSHSSRSHGIFIIYLEGYNHKT 618

Query: 333 EVFRMSKLSFVNFAGSE-------YGDNNTSKNGAFNSNLQSFNKMINGM---------- 375
               +SKL+ V+ AGSE        GD    +  + N +L     +I+ +          
Sbjct: 619 NEKCISKLNLVDLAGSERINFSKVQGDR-LKETQSINKSLSCLGDVIHALNRGNKNHLNS 677

Query: 376 --VNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             +  + +  F +SKLT LL+ +  G ++TL   N++  +  L+ T + L  ATK+   K
Sbjct: 678 NDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

Query: 434 NE 435
            E
Sbjct: 738 AE 739

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 78/161 (48%), Gaps = 17/161 (10%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R P+  E    S  +I   +   G  +  I  +E       +  D ++    
Sbjct: 366 NIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNEGRILSYNFQFDMIFEPSH 425

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
             K++F+E +    +S  DGYNV I +YG   SGK YT+        NA +      G++
Sbjct: 426 TNKEIFEE-IRQLVQSSLDGYNVCIFAYGQTGSGKTYTML-------NAGD------GMI 471

Query: 129 PRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLLID 166
           P  LS +FK   +L+  G ++ ++C ++EIYN+ + DLL D
Sbjct: 472 PMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 85/184 (46%), Gaps = 16/184 (8%)

Query: 260 YSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHS 319
           + ++  HE+    YI N+  + +T   +   I+KK  K R  A+T S    NE S RSHS
Sbjct: 528 HDIRHDHEK-QGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRS----NERSSRSHS 582

Query: 320 IFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNLQSFNKMINGMVN-- 377
           +F + +             KL+ V+ AGSE   N+++  G      Q+ NK ++ + +  
Sbjct: 583 VFMVHINGRNLHTGETSQGKLNLVDLAGSERI-NSSAVTGERLRETQNINKSLSCLGDVI 641

Query: 378 --------NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKI 429
                      Y  F +SKLT LLQ +  G ++TL   NI P    +  T + L  A+K+
Sbjct: 642 YALNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKV 701

Query: 430 KEIK 433
              K
Sbjct: 702 NSTK 705

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 93/184 (50%), Gaps = 26/184 (14%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N I + NL   +   IEE M +I +G  NR    T S++  NE S RSH++  I L ++ 
Sbjct: 224 NKISVSNLSTYSPATIEEVMDLIIQGNLNR----TTSSTHANETSSRSHAVLQIHLTQQN 279

Query: 330 EVN-------EVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV 376
           ++N       ++F  S LS ++ AGSE   +  ++      GA  N +L +    IN + 
Sbjct: 280 KLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALC 337

Query: 377 NNST-------YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKI 429
            N++       +  + DSKLT+LL+ +  G  +T+ I  ++P  K  D T + L  A + 
Sbjct: 338 INTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRA 397

Query: 430 KEIK 433
           KEIK
Sbjct: 398 KEIK 401

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D +  +   Q+ +F  T  P   S  DGYN ++ +YG+   GK YT+ G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISG-------- 161

Query: 118 NNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYNDELRDLL 164
                EN G++   L  LF  +E+  +  +  I  S++EIYN+ ++DLL
Sbjct: 162 ---TPENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLL 207

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 82/161 (50%), Gaps = 26/161 (16%)

Query: 8   ENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           + + V VR R P+ E    GS  +++    ++GT       DE+    + +  D V+G  
Sbjct: 21  DKMKVVVRLR-PLPE---GGSAAVVAA---DEGTVEFAGAADEA----RAFRFDYVFGTD 69

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGV 127
             Q+++FD         FF GYN +I++YG   SGK+YT++G              + G+
Sbjct: 70  ARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPPG-----------HRGL 118

Query: 128 VPRVLSRLFK--DLESNGND--HIIKCSFVEIYNDELRDLL 164
           +PR+  ++F+   L  N  D  +++  SF+EIY +++ DLL
Sbjct: 119 IPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLL 159

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            +Y++    +++++ +E +  I  G   R   ST    D N  S RSH+I  I L K + 
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGST----DMNLESSRSHAIVKINLLKRDN 243

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKNGA-------FNSNLQSFNKMINGMVN--NSTY 381
           +    + S L  V+ AGSE     T+  GA        N +L S   +IN +      T+
Sbjct: 244 LEGNIQKSDLFLVDLAGSEK-VAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTH 302

Query: 382 ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
             + DS+LT+LL+++  G ++T  I N A  K     T + L   ++ K IKN
Sbjct: 303 IPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKN 355

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 81/160 (50%), Gaps = 18/160 (11%)

Query: 9   NITVAVRCREPIDEEKHSGSPTI-ISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           NI V  R R P++  ++  +  I ++  D+  G  +  +   +ST +   +  D ++ +Q
Sbjct: 386 NIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEVTKIQSTTQVHEFKFDKIFDQQ 445

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGV 127
           +  + +F E V    +S  DGYNV I +YG   SGK +T+          N  +    G+
Sbjct: 446 NTNEDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTML---------NTGD----GI 491

Query: 128 VPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           +P  +S +F     L++ G D+ + C F+EIYN+ + DLL
Sbjct: 492 IPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 71/149 (47%), Gaps = 15/149 (10%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE- 349
           I+KK  K R  AST S    NE S RSHSIF I L              L+ V+ AGSE 
Sbjct: 577 ILKKANKLRSTASTAS----NEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSER 632

Query: 350 ------YGDNNTSKNGAFNSNLQSFNKMINGMVN-NST--YASFLDSKLTQLLQNNFDGI 400
                  GD    +    N +L     +I+ +   +ST  +  F +SKLT LLQ +  G 
Sbjct: 633 INISQVVGDR-LRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGD 691

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKI 429
           ++TL   NI+P    ++ T + L  A+K+
Sbjct: 692 SKTLMFVNISPSSSHINETLNSLRFASKV 720

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 14/112 (12%)

Query: 56  KIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQ 115
           +++T D V+     Q+ +++       KSFF GYN +I++YG   SGK++T++G      
Sbjct: 73  RLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG------ 126

Query: 116 NANNAESENLGVVPRVLSRLFKDLESNGNDHII---KCSFVEIYNDELRDLL 164
                  EN GV+PR+   +FK +E+   +  I     SF+E+Y +++ DLL
Sbjct: 127 -----PKENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 86/178 (48%), Gaps = 17/178 (9%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           + IY++ L    +T  +E +  IK+G   R ++ST      N  S RSHSI  I L K  
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSST----SMNLESSRSHSIVRINLEKRN 250

Query: 330 EVNEVFRMSKLSFVNFAGSE-YGDNNTS-----KNGAFNSNLQSFNKMINGMVN------ 377
            + E  + S L  V+ AGSE  G  N +     +    NS+L +   +IN +        
Sbjct: 251 ALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSK 310

Query: 378 -NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
             S +  + DSKLT+LLQ++  G ++T  I N +  +     T S L   ++ K+IKN
Sbjct: 311 RTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 74/159 (46%), Gaps = 20/159 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R P++ E    S   +S  DN +G+    I  ++   R   +  D V+    
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDRNSR---FLFDKVFSSNA 414

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
             + +F+E V    +S  DGYNV I +YG   SGK YT+  +               GV+
Sbjct: 415 SNRDVFEE-VGQLIQSSLDGYNVCIFAYGQTGSGKTYTMMNDPD-------------GVI 460

Query: 129 PRVLSRLFKD---LESNGNDHIIKCSFVEIYNDELRDLL 164
           P  L  +F     L+  G D+  +  F+EIYN+++ DLL
Sbjct: 461 PMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 73/153 (47%), Gaps = 15/153 (9%)

Query: 290 AIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE 349
            +++   K + IA+T S    NE S RSHS+F I ++    +        L+ V+ AGSE
Sbjct: 540 TVLRTANKTKSIAATNS----NERSSRSHSVFTIRIHGTNSITGEASDGVLNLVDLAGSE 595

Query: 350 YGDNNTSKNGAFNSNLQSFNKMINGMVNNSTYA---------SFLDSKLTQLLQNNFDGI 400
             D  ++  G      Q+ NK ++ +  +  YA          F +SKLT LLQ +  G 
Sbjct: 596 RIDT-SNVTGDRLRETQNINKSLSCL-GDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGD 653

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           ++TL   N++P    +  T + L  A+K+   K
Sbjct: 654 SKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 78/161 (48%), Gaps = 23/161 (14%)

Query: 9   NITVAVRCREPID--EEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGE 66
           NI V  R R P+   E+ ++    + S+ DN+ GT    I  + +T +   Y  D ++ +
Sbjct: 374 NIRVYCRLRPPLKSIEDPNTSHIKVYSL-DNDHGTQTMEITKNNNTNK---YKFDKIFDQ 429

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
            +   ++F E V    +S  DGYNV I +YG   SGK +T+                  G
Sbjct: 430 FESNSEIFKE-VGQLVQSALDGYNVCIFAYGQTGSGKTFTMLNPSD-------------G 475

Query: 127 VVPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  +  +F    +L+  G ++ I C FVEIYN+ + DLL
Sbjct: 476 IIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 81/170 (47%), Gaps = 15/170 (8%)

Query: 274 IQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNE 333
           I N+  +T+   E    ++ +  K R  AST S    NE S RSHSIF I L+ +     
Sbjct: 538 ITNVMTVTLDREETVEKVLHRATKLRSTASTKS----NEHSSRSHSIFIIHLHGKNSKTN 593

Query: 334 VFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNLQSFNKMINGM------VNNS----TYAS 383
                 L+ V+ AGSE   N++  +G      Q  NK ++ +      +N+S     +  
Sbjct: 594 EDSYGILNLVDLAGSERI-NSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIP 652

Query: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           F +SKLT LL+ +  G ++TL   NI+     ++ T + L  A+K+   K
Sbjct: 653 FRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 84/180 (46%), Gaps = 21/180 (11%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY--- 326
           N I + NL +   T ++E M ++ +G  NR    T S ++ NE S RSH++  I +    
Sbjct: 270 NKITVANLSQHFPTTVQEVMDLVIRGNFNR----TTSPTEANEVSSRSHAVLQIHIVQKN 325

Query: 327 KEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGA-------FNSNLQSFNKMINGMVNNS 379
           +  ++ E      LS ++ AGSE     T   GA        N +L +    IN +  N 
Sbjct: 326 RTPDIKEEHTFGTLSIIDLAGSERA-AATKNRGARLHEGANINRSLLALGNCINALCING 384

Query: 380 ------TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
                  +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 385 NDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 444

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 13/116 (11%)

Query: 51  STGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGE 110
           S G +  +  D ++     Q++++  T      S  DG+N ++ +YG+   GK YT+ G 
Sbjct: 149 SAGSEIKFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG- 207

Query: 111 YSELQNANNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYNDELRDLL 164
                       EN G+V + +  LF+ +E   +     I  SF+EIYN+ +RDLL
Sbjct: 208 ----------TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 88/179 (49%), Gaps = 19/179 (10%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N  ++ NL + +   +EE M ++ KG  NR    T S +D NE S RSH++  I + +  
Sbjct: 238 NRTFVSNLSKHSPENVEEVMDLVIKGNMNR----TTSPTDANETSSRSHAVLQIHVAQMN 293

Query: 330 EVNEVFR---MSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNNST 380
              ++ +    + LS ++ AGSE      ++      GA  N +L +    IN +  +ST
Sbjct: 294 RTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSST 353

Query: 381 ------YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
                 +  + DSKLT+LL+ +  G  +T+ I  ++P     D T + L  A + KEIK
Sbjct: 354 RTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++     Q+++++ T  P   S  DG+N ++ +YG+   GK +T+ G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 175

Query: 118 NNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYNDELRDLL 164
               SE  G++   +  LF  +E   +     ++ SF+EIYN+++ DLL
Sbjct: 176 ---TSEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLL 221

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 18/160 (11%)

Query: 9   NITVAVRCREPIDEEKHSGSPTI-ISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           NI V  R R  +   ++S +  I ++  D+  G  +  +   ++T +   +  D ++ +Q
Sbjct: 386 NIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQ 445

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGV 127
           D    +F E V    +S  DGYNV I +YG   SGK +T+                  G+
Sbjct: 446 DTNVDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-------------GI 491

Query: 128 VPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           +P  +S +F     L++ G D+ + C F+EIYN+ + DLL
Sbjct: 492 IPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 71/149 (47%), Gaps = 15/149 (10%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE- 349
           I+KK  K R  AST S    NE S RSHSIF I L              L+ V+ AGSE 
Sbjct: 577 ILKKANKLRSTASTAS----NEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSER 632

Query: 350 ------YGDNNTSKNGAFNSNLQSFNKMINGMVN-NST--YASFLDSKLTQLLQNNFDGI 400
                  GD    +    N +L     +I+ +   +ST  +  F +SKLT LLQ +  G 
Sbjct: 633 INVSQVVGDR-LRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGD 691

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKI 429
           ++TL   NI+P    ++ T + L  A+K+
Sbjct: 692 SKTLMFVNISPSSSHINETLNSLRFASKV 720

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 87/170 (51%), Gaps = 16/170 (9%)

Query: 273 YIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVN 332
           ++Q++    +  +EE +  +  G   R +AST      N  S RSH+IF +++ K++E +
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVAST----RMNMESSRSHAIFTLSI-KQQEPD 203

Query: 333 EVFRMSKLSFVNFAGSEYGDNNTS-------KNGA-FNSNLQSFNKMINGMVNNSTY-AS 383
              R S L  V+ AGSE  +           K GA  N +L +  + I+ +  NS +   
Sbjct: 204 GSIRESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIP 263

Query: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           + DS LT +L+ N  G ++T  IA I+P+   L+ + S L  AT  KEIK
Sbjct: 264 YRDSLLTWVLKENLGGNSKTCMIACISPI--DLEESLSTLRYATTAKEIK 311

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 12/110 (10%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++     Q  +  E    +     +GYN  I +YG   SGK YT+ G  S     
Sbjct: 37  FNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGTNS----- 91

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGND-HIIKCSFVEIYNDELRDLLID 166
                 N G++P +   LF  LE +      +  ++ EIYN++L DLL D
Sbjct: 92  ------NPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 85/169 (50%), Gaps = 29/169 (17%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISI---------GDNEDGTSNEVIVLDESTGRKKIYT 59
           N+ V VR + PID  +   +  ++++          D   G++N V    ES  R   + 
Sbjct: 34  NVKVMVRLK-PIDAPEKQYNVAVVALDESTVEFPNNDTSPGSTNGV--QGESPSRS--FH 88

Query: 60  LDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANN 119
            D V+G    Q  ++D         FF GYN +I++YG   SGK+YT++G          
Sbjct: 89  FDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPI-------- 140

Query: 120 AESENLGVVPRVLSRLFKD---LESNGN-DHIIKCSFVEIYNDELRDLL 164
              +N G++PR+   +F+    L+S+ + ++++  SF+EIY +++ DLL
Sbjct: 141 ---DNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL 186

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 86/174 (49%), Gaps = 15/174 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            +Y+Q+   I++++ +E +  I  G   R  +ST    D N  S RSH+I  I L K + 
Sbjct: 215 GVYVQSATVISVSDGDELLHCIHLGESQRCKSST----DMNFESSRSHAIVKINLLKRDN 270

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKNGA-------FNSNLQSFNKMINGMVNNS---T 380
           +    + S L  V+ AGSE   + T+  GA        N +L S   +IN +       T
Sbjct: 271 LEGSIQKSDLFLVDLAGSEKV-SKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRT 329

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
           +  + DS+LT+LL+++  G ++T  I N A  K     T + L   ++ K+I+N
Sbjct: 330 HIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIEN 383

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 78/161 (48%), Gaps = 22/161 (13%)

Query: 9   NITVAVRCREPID--EEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGE 66
           NI V  R R P+   E+ ++    +    DN    S E IV D    +K  +  D ++ +
Sbjct: 349 NIRVFCRIRPPLKSVEDINTNHIKVQPFNDNHGNQSME-IVKDHRCIQK--FQFDRIFDQ 405

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
            +  K +FDE +    +S  DGYNV I +YG   SGK +T+        N N+      G
Sbjct: 406 HEVNKDVFDE-IGQLVQSSLDGYNVCIFAYGQTGSGKTFTML-------NPND------G 451

Query: 127 VVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  +  +F     L+  G ++ + C FVEIYN+ + DLL
Sbjct: 452 MIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 76/153 (49%), Gaps = 15/153 (9%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEY 350
           +IKK  K R  A+T +    NE S RSHSIF I L     +        L+ V+ AGSE 
Sbjct: 539 LIKKATKLRATATTAA----NERSSRSHSIFIIHLRGSNNITGESSYGILNLVDLAGSER 594

Query: 351 GDNNTSKNGA-------FNSNLQSFNKMINGMVNNST---YASFLDSKLTQLLQNNFDGI 400
             N++   GA        N +L     +I+ + ++     +  F +SKLT LLQ +  G 
Sbjct: 595 L-NSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGN 653

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           ++TL   NI+P ++Q+  T + L  A+K+   K
Sbjct: 654 SKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 81/164 (49%), Gaps = 25/164 (15%)

Query: 9   NITVAVRCREPID--EEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI-YTLDAVY- 64
           NI V  R R  ++  E+  +G  T+    DN  G  +  ++   S  R  + +  D ++ 
Sbjct: 421 NIRVFCRIRPTLEHIEDPDTGHITVNPF-DNNYGVQSMEVMKQSSFSRAPVSFKFDKIFD 479

Query: 65  -GEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESE 123
            GE +D+  +F E V    +S  DGYNV I +YG   SGK YT+                
Sbjct: 480 TGESNDE--VFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTYTML-------------HP 523

Query: 124 NLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
           N GV+P  +S +F   ++L+  G ++ I C FVEIYN+ + DLL
Sbjct: 524 NDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 70/147 (47%), Gaps = 12/147 (8%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE- 349
           ++K+  K R  AST S    NE S RSHSIF I L+      +      L+ V+ AGSE 
Sbjct: 612 VLKRATKLRSTASTLS----NEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSER 667

Query: 350 -----YGDNNTSKNGAFNSNLQSFNKMINGMVNNST--YASFLDSKLTQLLQNNFDGITR 402
                       +    N +L     +I  + + +T  +  F +SKLT LLQ +  G ++
Sbjct: 668 VHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSK 727

Query: 403 TLFIANIAPLKKQLDATCSVLTMATKI 429
           TL   NI+P    ++ T + L  A+K+
Sbjct: 728 TLMFVNISPSSSHINETINSLRFASKV 754

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 87/177 (49%), Gaps = 17/177 (9%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N I + NL     T +E+ M ++ +G  NR    T S ++ NE S RSHS+  I + +  
Sbjct: 267 NHIKVANLSYHHPTTVEDVMDLVVQGNINR----TTSPTEANEVSSRSHSVLQIHIMQTN 322

Query: 330 EVNEV---FRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNN-- 378
           ++ ++      + LS ++ AGSE      ++      GA  N +L +    IN +  N  
Sbjct: 323 KLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDG 382

Query: 379 --STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             + +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 383 SRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 15/110 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q +++ ET  P   S  DG+N ++ +YG+   GK YT+ G  S+    
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQ---- 208

Query: 118 NNAESENLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
                   G++   +  LF    DL+   N   I  S++EIYN+ + DLL
Sbjct: 209 -------PGIIFLAMEELFNKISDLKDEKNFE-ISLSYLEIYNERISDLL 250

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 78/160 (48%), Gaps = 19/160 (11%)

Query: 9   NITVAVRCREPI-DEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQ 67
           NI V  R R  I DE   S S   I I   +     + I++++   +   +T D ++G Q
Sbjct: 335 NIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRIIVND-LKQLHAFTFDKIFGMQ 393

Query: 68  DDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGV 127
           DD  ++FD+ +    +S  DGYNV I +YG   SGK YT+  E               G+
Sbjct: 394 DDNYEVFDD-IKNLVQSSLDGYNVCIFTYGQTGSGKTYTMLNEKD-------------GI 439

Query: 128 VPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           + + +  +     +L   G ++ ++  F+EIYN+ +RDLL
Sbjct: 440 IMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLL 479

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 68/148 (45%), Gaps = 8/148 (5%)

Query: 290 AIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE 349
           A I++ ++N        ++  N  S RSHS+F + +     + +     +L+ V+ AGSE
Sbjct: 522 AQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGRLNLVDLAGSE 581

Query: 350 Y--------GDNNTSKNGAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGIT 401
                          +  + N +L     +I+ M +   Y  F +SKLT LL+N+    +
Sbjct: 582 RLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKS 641

Query: 402 RTLFIANIAPLKKQLDATCSVLTMATKI 429
           +TL   NI+P    +  T + L +A K+
Sbjct: 642 KTLMYVNISPNINSIRETINSLRLARKV 669

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 77/159 (48%), Gaps = 19/159 (11%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R P+  E  +     +   D+++G  ++ + ++    +   +  D ++ +Q+
Sbjct: 350 NIRVYCRIRPPLPHEDDNIEHIKVQPFDDDNG--DQGMTINRGNSQVIPFKFDKIFDQQE 407

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
              ++F E V    +S  DGYNV I +YG   SGK YT+        N  +      G+V
Sbjct: 408 TNDEIFKE-VGQLIQSSLDGYNVCIFAYGQTGSGKTYTML-------NPGD------GIV 453

Query: 129 PRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           P  ++ +F     L + G  + + C F+EIYN+ + DLL
Sbjct: 454 PATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 83/186 (44%), Gaps = 20/186 (10%)

Query: 259 DYSLQSSHE-----RLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEF 313
           D +  S HE      L + YI N+    +   +    ++K+  K R  AST +    NE 
Sbjct: 503 DRNADSKHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRANKLRSTASTAA----NEH 558

Query: 314 SKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNLQSFNK--- 370
           S RSHSIF I L  + E         L+ V+ AGSE   N++   G      QS NK   
Sbjct: 559 SSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERL-NSSMVVGERLRETQSINKSLS 617

Query: 371 -------MINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVL 423
                   +N       +  F +SKLT LLQ +  G ++TL   NI+P    L+ T + L
Sbjct: 618 CLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSL 677

Query: 424 TMATKI 429
             A+K+
Sbjct: 678 RFASKV 683

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 86/178 (48%), Gaps = 22/178 (12%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEV 331
           I + NL       +++ M +I KG  NR    T SA+D NE S RSH++  I + +    
Sbjct: 262 ISVANLSHHRPKTVQDVMDLIIKGNINR----TTSATDANETSSRSHAVLQIHISQTNRT 317

Query: 332 -----NEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNN-- 378
                + VF  + LS ++ AGSE   +  ++      GA  N +L +    IN +  N  
Sbjct: 318 VDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDG 375

Query: 379 ---STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
              S +  + DSKLT+LL+ +  G  +T+ I  ++P     D T + L  A + KEIK
Sbjct: 376 TRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIK 433

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q  ++  T      S  DG+N ++ +YG+   GK YT+ G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISG-------- 197

Query: 118 NNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYNDELRDLL 164
                E  G++   +  LF+ +E+  +  +  +  S++EIYN+ +RDLL
Sbjct: 198 ---TPEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLL 243

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 84/176 (47%), Gaps = 18/176 (10%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEV 331
           I + NL       ++E M  + +G  NR    T S +D NE S RSH++  I + + +  
Sbjct: 244 ITVSNLSHHKPQTVQEVMDFVIRGNMNR----TTSPTDANETSSRSHAVLQIHIAQTDRT 299

Query: 332 NEVFR---MSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV-----N 377
            ++      + LS ++ AGSE   +  ++      GA  N +L +    IN +       
Sbjct: 300 PDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTR 359

Query: 378 NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
            + +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + LT A + K+IK
Sbjct: 360 RTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIK 415

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E  +Q  +++ T      S  DG+N ++ +YG+   GK +T+ G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHIIK--CSFVEIYNDELRDLL 164
                E  G++   +  LFK +ES  +   I+   S++EIYN+ +RDLL
Sbjct: 180 ---TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLL 225

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNED--GTSNEVIVLDESTGRKKIYTLDAVYGE 66
           NI V  R R P  E       ++I++ + +D  G  +  +    +T +   +  D ++ +
Sbjct: 386 NIRVYCRIR-PALETLEDSDTSLINVNEFDDNCGIQSMEVTKIHNTAQVHEFKFDKIFDQ 444

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
           +D    +F E V    +S  DGYNV I +YG   SGK +T+                  G
Sbjct: 445 KDTNADVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-------------G 490

Query: 127 VVPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  +S +F     L++ G D+ + C F+EIYN+ + DLL
Sbjct: 491 IIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 71/149 (47%), Gaps = 15/149 (10%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE- 349
           I+KK  K R  AST S    NE S RSHSIF I L              L+ V+ AGSE 
Sbjct: 577 ILKKANKLRSTASTAS----NEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSER 632

Query: 350 ------YGDNNTSKNGAFNSNLQSFNKMINGMVN-NST--YASFLDSKLTQLLQNNFDGI 400
                  GD    +    N +L     +I+ +   +ST  +  F +SKLT LLQ +  G 
Sbjct: 633 INISQVVGDR-LRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGD 691

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKI 429
           ++TL   NI+P    ++ T + L  A+K+
Sbjct: 692 SKTLMFVNISPSSSHINETLNSLRFASKV 720

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 86/175 (49%), Gaps = 17/175 (9%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEV 331
           I + NL     T +E+ M ++ +G  NR    T S ++ NE S RSH++  I + +  ++
Sbjct: 269 IKVANLSYHHPTTVEDVMDLVVQGNINR----TTSPTEANEVSSRSHAVLQIHIMQTNKL 324

Query: 332 NEV---FRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNN---- 378
            ++      + LS ++ AGSE      ++      GA  N +L +    IN +  N    
Sbjct: 325 VDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 379 STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           S +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 385 SCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 15/110 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q +++ ET  P   S  DG+N ++ +YG+   GK YT+ G  S+    
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQ---- 208

Query: 118 NNAESENLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
                   G++   +  LF    DL    N   I  S++EIYN+ +RDLL
Sbjct: 209 -------PGIIFLAMEELFNKIADLRDEKNFE-ISLSYLEIYNERIRDLL 250

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 80/161 (49%), Gaps = 20/161 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNED--GTSNEVIVLDESTGRKKIYTLDAVYGE 66
           NI V  R R P+ E   +   ++I++ + +D  G  +  +   ++T +   +  D ++ +
Sbjct: 386 NIRVYCRIRPPL-ESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHEFKFDKIFDQ 444

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
           ++  + +F E V    +S  DGYNV I +YG   SGK +T+                  G
Sbjct: 445 RNTNEDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-------------G 490

Query: 127 VVPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  +S +F     L++ G D+ + C F+EIYN+ + DLL
Sbjct: 491 IIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 69/149 (46%), Gaps = 15/149 (10%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE- 349
           ++K+  K R  AST S    NE S RSHSIF I L              L+ V+ AGSE 
Sbjct: 576 VLKRANKLRSTASTAS----NEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSER 631

Query: 350 ------YGDNNTSKNGAFNSNLQSFNKMINGMVNNST---YASFLDSKLTQLLQNNFDGI 400
                  GD    +    N +L     +I+ +    +   +  F +SKLT LLQ +  G 
Sbjct: 632 INISQVVGDR-LRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGD 690

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKI 429
           ++TL   NI+P    ++ T + L  A+K+
Sbjct: 691 SKTLMFVNISPSSSHINETLNSLRFASKV 719

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 17/177 (9%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N I + NL     T +E+ M ++ +G  NR    T S ++ NE S RSH++  I + +  
Sbjct: 267 NHIKVANLSYHHPTTVEDVMNLVVQGNINR----TTSPTEANEVSSRSHAVLQIHIMQTN 322

Query: 330 EVNEV---FRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNN-- 378
           ++ ++      + LS ++ AGSE      ++      GA  N +L +    IN +  N  
Sbjct: 323 KLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDG 382

Query: 379 --STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             + +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 383 SRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 15/110 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q +++ ET  P   S  DGYN ++ +YG+   GK YT+ G  S+    
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGTPSQ---- 208

Query: 118 NNAESENLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
                   GV+   +  LF    DL+   N   I  S++EIYN+ +RDLL
Sbjct: 209 -------PGVIFLAMEELFNKIDDLKDEKNFE-ISLSYLEIYNERIRDLL 250

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ +   Q+++F++T  P   S  DG+N ++ +YG+   GK YT+          
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTI---------- 141

Query: 118 NNAESENLGVVPRVLSRLFKDLE-----SNGNDHIIKCSFVEIYNDELRDLL 164
            N  SE+ G++ R ++ LF  +E     SN +   I  S++EIYN+ +RDLL
Sbjct: 142 -NGTSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 83/164 (50%), Gaps = 21/164 (12%)

Query: 285 IEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNI----TLYKEEEVNEVFRM-SK 339
           +++ + ++ +G  NR    + S ++ NE S RSHS+  I     L   +++    ++ S 
Sbjct: 224 VQDVIDLVIRGNLNR----SSSPTEANEVSSRSHSVLQIHVKQVLKNFDDIGSTNQIDST 279

Query: 340 LSFVNFAGSEYGDNNTSKN-------GA-FNSNLQSFNKMINGMVNN--STYASFLDSKL 389
           LS ++ AGSE     T+KN       GA  N +L +    IN +  N  S +  + DSKL
Sbjct: 280 LSIIDLAGSERAI--TTKNRGIRLYEGANINKSLLALGNCINALCINKKSCHIPYRDSKL 337

Query: 390 TQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           T+LL+ +  G  +T+ I  ++P     D T + L  A + KEIK
Sbjct: 338 TRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIK 381

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 17/177 (9%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N I + NL       +E+ M ++ +G  NR    T S ++ NE S RSH++  I + +  
Sbjct: 267 NHIKVANLSYHHPNTVEDVMDLVVQGNINR----TTSPTEANEVSSRSHAVLQIHIMQTN 322

Query: 330 EVNEV---FRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNN-- 378
           ++ ++      + LS ++ AGSE      ++      GA  N +L +    IN +  N  
Sbjct: 323 KLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDG 382

Query: 379 --STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             S +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 383 SRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 15/110 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q +++ ET  P   S  DG+N ++ +YG+   GK YT+ G  S+    
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQ---- 208

Query: 118 NNAESENLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
                   G++   +  LF    DL+ +  D  I  S++EIYN+ +RDLL
Sbjct: 209 -------PGIIFLAMEELFNKITDLK-DEKDFEISLSYLEIYNERIRDLL 250

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 84/179 (46%), Gaps = 19/179 (10%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N I + NL       ++E + ++ KG  NR    T S ++ NE S RSH++  I + +  
Sbjct: 265 NKISVSNLSYHNPQTVQEVIDLVIKGNINR----TTSPTEANEVSSRSHAVLQIHIMQTN 320

Query: 330 EVNEV---FRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMIN------G 374
              ++      + LS ++ AGSE      ++      GA  N +L +    IN      G
Sbjct: 321 RTADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDG 380

Query: 375 MVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             N S +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 381 GTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 54/109 (49%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ +   Q+ ++  T      S  DG+N ++ +YG+   GK YT+ G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 202

Query: 118 NNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYNDELRDLL 164
                E  G++ RV+  LF+ +E   +     +  S++EIYN+ +RDLL
Sbjct: 203 ---TPEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (51%), Gaps = 19/116 (16%)

Query: 59  TLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNAN 118
             D  +G+ + Q + +  ++  F K   +GYN  I++YG   SGK YT+ GE        
Sbjct: 62  CFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGE-------- 113

Query: 119 NAESENLGVVPRVLSRLFKDLE----------SNGNDHIIKCSFVEIYNDELRDLL 164
            ++++  GV+PR    LF ++E          S  +++ + CS  EIYN+++ DLL
Sbjct: 114 -SKNDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL 168

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 90/177 (50%), Gaps = 31/177 (17%)

Query: 260 YSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHS 319
           Y ++ + +R  S+YI+N+ EI ++ I++ +  +K G +NR    T  +++ N  S RSH+
Sbjct: 179 YRVRENRDR--SMYIENITEIEVSNIDQMIKCVKMGFRNR----TTRSTNMNVNSSRSHA 232

Query: 320 IFNITLYKEE-EVN---EVFRMSKLSFVNFAGSEYG------DNNTSKNG-AFNSNLQSF 368
           I +IT+ + + ++N    +   S   FV+ AGSE         N+  K G + N +L + 
Sbjct: 233 IVSITIKRTDIDLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTL 292

Query: 369 NKMINGM--------------VNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAP 411
            +++  +                ++    F +S LT +L++N  G ++T  IA I+P
Sbjct: 293 RRVLTSLKKREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISP 349

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 73/165 (44%), Gaps = 24/165 (14%)

Query: 10  ITVAVRCREPID--EEKHSGSPTIISIGDNEDGTSNEVIVLDE-----STGRKKIYTLDA 62
           I V  R R P+   E K +    +    D+    S EV+   E     +T   + +  D 
Sbjct: 349 IRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQIPQRFKFDK 408

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122
           ++ + D    +F E V    +S  DGYNV I +YG   SGK YT+               
Sbjct: 409 IFNQTDTNADVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTYTMLRPKD---------- 457

Query: 123 ENLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
              G++P  +  +F   K+L+  G  + I C FVEIYN+ + DLL
Sbjct: 458 ---GIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 71/153 (46%), Gaps = 15/153 (9%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEY 350
           I+K+  K R  ASTGS    NE S RSHSIF I L     +        L+ V+ AGSE 
Sbjct: 548 ILKRANKLRSTASTGS----NEHSSRSHSIFIIHLRGSNSLTGEESYGILNLVDLAGSER 603

Query: 351 -------GDNNTSKNGAFNSNLQSFNKMIN---GMVNNSTYASFLDSKLTQLLQNNFDGI 400
                  GD    +    N +L     +I+   G      +  F +SKLT LLQ +  G 
Sbjct: 604 INSSQVTGDR-LRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGN 662

Query: 401 TRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           ++TL   NI+P    ++ T + L  A+K+   K
Sbjct: 663 SKTLMFVNISPSANHINETINSLRFASKVNSTK 695

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 21/161 (13%)

Query: 9   NITVAVRCREPIDE-EKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI-YTLDAVYGE 66
           N  V  R R P+   E    S  +I+  + E G+  + I ++++     I Y+ D V+ +
Sbjct: 334 NFRVYCRVRPPLKGIEPLDTSHILINAFNAELGS--QSIEVEKNCNLTPIKYSFDKVFSQ 391

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
            D  +++F E V    +S  DG+NV I +YG   SGK +T+                  G
Sbjct: 392 TDTNQEIFKE-VSELIQSSLDGFNVCIFAYGQTGSGKTFTMLNPKD-------------G 437

Query: 127 VVPRVLSRLFKDLES---NGNDHIIKCSFVEIYNDELRDLL 164
           ++P     +F  +++   NG  + + C F+EIYNDE+ DLL
Sbjct: 438 IIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLL 478

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 82/169 (48%), Gaps = 13/169 (7%)

Query: 274 IQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNE 333
           ++NL+ IT+T  E   A++K  +K R  AST S    NE S RSHSIF I ++   E   
Sbjct: 506 VENLETITLTSKESVDAVLKNAMKLRATASTSS----NERSSRSHSIFIIKIHGINEGLG 561

Query: 334 VFRMSKLSFVNFAGSE------YGDNNTSKNGAFNSNLQSFNKMINGMVN---NSTYASF 384
             R   L+ ++ AGSE             +    N +L     ++N + +    + + SF
Sbjct: 562 EERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISF 621

Query: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
            DSKLT LLQ +  G ++TL + NI+     ++ T   L  A K+   K
Sbjct: 622 RDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 20/159 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R  ++ E +S S   I    +E G  +  I  D    ++  +T D  +  Q+
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIEKFSDETGMQSITIKRD---SKQHKFTFDRCFSAQE 419

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
               +F E +    +S  DGYNV I +YG   SGK +T+        N N+      G++
Sbjct: 420 TNGDVFSE-IGQLIQSSLDGYNVCIFAYGQTGSGKTFTML-------NPND------GII 465

Query: 129 PRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
           P  L+ +F   + L+  G  + I   FVEIYN+ ++DL 
Sbjct: 466 PSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 76/172 (44%), Gaps = 13/172 (7%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           + +I N+    +T  E    ++++ LK R  A+T +    N  S RSHS+F I L     
Sbjct: 530 TTHITNITVCKLTSREMVNRMLRRALKMRSTAATVA----NSRSSRSHSVFIIKLDGYNT 585

Query: 331 VNEVFRMSKLSFVNFAGSEY------GDNNTSKNGAFNSNLQSFNKMINGMVNNST---Y 381
           ++       L+ V+ AGSE             +    N +L     +I+ + +      +
Sbjct: 586 ISGEKSTGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRH 645

Query: 382 ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
             F +SKLT LLQ +  G ++TL   N++P    +  T + L  A K+   K
Sbjct: 646 IPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 23/165 (13%)

Query: 9   NITVAVRCREPI-DEEKHSGSPTIISIGDNEDGTSNEVI--VLDESTGRKKI---YTLDA 62
           NI V  R R PI  +E ++ S   +S  D+ +GT    I   L+ ++        +  D 
Sbjct: 398 NIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNSTTLKFKFDK 457

Query: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122
           ++ + +    +F E V    +S  DGYNV I +YG   SGK YT+               
Sbjct: 458 IFNQNETNDDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTYTMLHPKD---------- 506

Query: 123 ENLGVVPRVLSRLF---KDLESNGNDHIIKCSFVEIYNDELRDLL 164
              G++P  +S +F    +L+  G  + I+C FVEIYN+ + DLL
Sbjct: 507 ---GIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 78/169 (46%), Gaps = 23/169 (13%)

Query: 291 IIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEY 350
           I+++  K R  AST S    NE S RSHSIF I L    E+        L+ V+ AGSE 
Sbjct: 603 ILRRANKLRSTASTLS----NEHSSRSHSIFIIHLKGTNEITGEKSYGILNLVDLAGSER 658

Query: 351 GDNNTSKNGA-------FNSNLQSFNKMINGMVNN--------STYASFLDSKLTQLLQN 395
             N++   G         N +L     +I+ +  +          +  F +SKLT LLQ 
Sbjct: 659 I-NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQY 717

Query: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444
           +  G ++TL   NI+P    ++ T + L  A+K+   K     G+ I+K
Sbjct: 718 SLIGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK---MGGATISK 763

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 82/169 (48%), Gaps = 30/169 (17%)

Query: 8   ENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDEST-GRKKIYTLDAVYGE 66
           +NI VAVR R P++ E          I   EDG  N + V D +     + +  D  +  
Sbjct: 3   DNIKVAVRLRRPLEREVDESI-----IARVEDG--NVIQVKDRNQKNETRSFHFDQCFAY 55

Query: 67  QD----DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122
            +    DQ +L+++    +     DGY+  + +YG   SGK++T+ G             
Sbjct: 56  SENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTG-----------SP 104

Query: 123 ENLGVVPRVLSRLF--KDLESNGNDHI-----IKCSFVEIYNDELRDLL 164
           E+ G+V R+   LF  +++  + +D +     I+CS++EIYN+ +RDLL
Sbjct: 105 ESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 90/174 (51%), Gaps = 17/174 (9%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           + +++ L+E  ++ +E+ +  +K+G + R + ST      NE+S RSH+IF I++ ++E+
Sbjct: 167 TTFVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLV----NEYSSRSHTIFTISIKQKEK 222

Query: 331 --VNEVF-RMSKLSFVNFAGSEYG-----DNNTSKNGA-FNSNLQSFNKMINGMV--NNS 379
             +  V  R S +  ++ AGSE         +  K G+  N +L +  ++I+ +      
Sbjct: 223 SALGHVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQP 282

Query: 380 TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
               + D+ LT +L+ +  G ++T  IA ++P     + T S L  AT  + +K
Sbjct: 283 KLIPYRDAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVK 334

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 21/179 (11%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           N+  + NL   T   +++ M ++ KG  NR    T S +D NE S RSH++  I + +  
Sbjct: 244 NTTTVANLSYHTPRSVQDVMDLVIKGNINR----TTSPTDANETSSRSHAVLQIHVVQSS 299

Query: 330 ---EVNEVFRMSKLSFVNFAGSEYGDNNTSKNGA--------FNSNLQSFNKMING--MV 376
              ++ E    + LS ++ AGSE    + +KN           N +L +    IN   M 
Sbjct: 300 RSVDLKEDKTYATLSIIDLAGSERA--SATKNRGERLHEGSNINKSLLALGNCINALCMT 357

Query: 377 NNSTYA--SFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
              TY    + DSKLT+LL+ +  G  +T+ I  ++P     D T + L  A + K+IK
Sbjct: 358 GRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIK 416

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 62/127 (48%), Gaps = 14/127 (11%)

Query: 40  GTSNEVIVLDESTGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSR 99
           G+  E+       G +K +  D ++  +  Q+ +F  T  P   S  DG+N ++ +YG+ 
Sbjct: 113 GSRGEIRRRMRRNGEQK-FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGAT 171

Query: 100 FSGKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYN 157
             GK +T+ G             EN G++   +  LF+ +E+  +     +  S++EIYN
Sbjct: 172 GCGKTFTISG-----------TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYN 220

Query: 158 DELRDLL 164
           + +RDLL
Sbjct: 221 EMIRDLL 227

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           Y  D V+    D  +++  T IP     F G+N ++  YG   SGK YT+ G+     N 
Sbjct: 133 YKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGD-----NE 187

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGND--HIIKCSFVEIYNDELRDLLID 166
           N       G+VP  +S LF  + ++ ND  + +  S++EIYN+++ DLL D
Sbjct: 188 NPD-----GIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDD 233

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 154/358 (43%), Gaps = 55/358 (15%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEV 331
           + I  L E      +E M  IK G  NR+ + T    + N  S RSH++  + L     +
Sbjct: 267 VKITGLNEERCDTSQELMKWIKYGDSNRKTSET----EYNLRSSRSHAVILVRLVTHNVI 322

Query: 332 NEVFRMSKLSFVNFAGSE--YGDNNTSKNGAF-NSNLQSFNKMINGM----VNNSTYAS- 383
           +     S L+  + AGSE   G     K GAF N +L +   +I+ +    ++NS + S 
Sbjct: 323 DGSKTSSTLTLCDLAGSERAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSN 382

Query: 384 -------------------FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLT 424
                              + DSKLT+LLQ    G +    I  I P  +    T + L 
Sbjct: 383 PMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLR 442

Query: 425 MATKIKEIK---NEPKKGSVIT-----KESLIKILSNELVKTK---SDLLSYKSND--NG 471
            A++ K +    N  K  S I+     K+ +IK L+  L K K   +D+    S+D  N 
Sbjct: 443 FASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLKSSHDTSNK 502

Query: 472 IYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNL 531
             +D  + S L       K+K++N +N +N+     + I ++     EI +   I++  L
Sbjct: 503 FSLDNPNISLLQTENSILKKKLENYENIMNK-----DMIELQDSQMSEIIDMLPIEIGAL 557

Query: 532 RET-ISNLNCALEKQSKRESELE----NIKIKLHSILGNMQKSVEKYSDKEIHLQNKL 584
            E     +   + +  K  +ELE    N+K +  S+L N   S++K  D+ + LQ  L
Sbjct: 558 LENKFQGMESQIRQFQKYTNELENKILNLKKQNRSLLNNSTYSLDK-DDEILELQKML 614

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 76/159 (47%), Gaps = 20/159 (12%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQD 68
           NI V  R R  +  E        I++ ++++GT +  I  D    +K  +  D ++  ++
Sbjct: 367 NIRVFCRIRPLLQGEGSESCHVHINLFNDDEGTQSMNITRD---SKKHEFKFDKIFDPEN 423

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVV 128
               +F+E +    +S  DGYNV I +YG   SGK YT+      L   N       G++
Sbjct: 424 SNDDIFEE-IRQLVQSSLDGYNVCIFAYGQTGSGKTYTM------LHPQN-------GMI 469

Query: 129 PRVLSRLFKD---LESNGNDHIIKCSFVEIYNDELRDLL 164
           P  L  +F+    L+  G ++ I   F+EIYN+ + DLL
Sbjct: 470 PSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 19/171 (11%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITL--YKE 328
           + ++ N+    +T+ +    ++K+  K R  A+TGS    NE S RSHS+F I L  Y  
Sbjct: 534 TTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGS----NERSSRSHSVFIIKLRGYNS 589

Query: 329 EEVNEVFRMSKLSFVNFAGSEY-------GDNNTSKNGAFNSNLQSFNKMINGMVNNST- 380
               E      L+ V+ AGSE        GD    +    N +L     +I+ + +    
Sbjct: 590 NTGEEC--QGTLNLVDLAGSERINASQVTGDR-LRETQNINKSLSCLGDVIHALASPDAS 646

Query: 381 --YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKI 429
             +  F +SKLT LLQ +  G ++TL   NI+P     + T + L  A+K+
Sbjct: 647 KRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKV 697

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 24/120 (20%)

Query: 58  YTLDAVYGEQD----DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSE 113
           +  D  +G  D    DQ  +++  V  +     +GYN  I++YG   SGK +T+ GE   
Sbjct: 52  FRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGEKG- 110

Query: 114 LQNANNAESENLGVVPRVLSRLFK--------DLESN-GNDHIIKCSFVEIYNDELRDLL 164
                     N G+VPR    LF+        D ES+   D  +KCSF EIYN+++ DLL
Sbjct: 111 ----------NEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 81/158 (51%), Gaps = 22/158 (13%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           +S +++ L+EI +  +EE ++ I KG +NR + ST    + N+ S RSH+IF+I++ ++E
Sbjct: 176 HSTFVEGLEEIAVHNVEELISCIHKGNENRTVRST----NMNQESSRSHAIFHISVNQKE 231

Query: 330 ------EVNEVFRMSKLSFVNFAGSE-----YGDNNTSKNG-AFNSNLQSFNKMIN---- 373
                  V E     KL  V+ AGSE       D    + G + N +L    ++I+    
Sbjct: 232 THKKTGTVVECHSTCKL--VDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAE 289

Query: 374 GMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAP 411
           G    S    + +S LT +L+ N  G + T  +A ++P
Sbjct: 290 GDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSP 327

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 71/161 (44%), Gaps = 21/161 (13%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTL--DAVYGE 66
           NI V  R R P+  E    S   I   +   G   + + +    GR   Y    D ++  
Sbjct: 368 NIRVYCRIRPPLLAESQDTSHFHIEKFNESKGF--QALTIKRENGRCFSYNFHFDKIFEP 425

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
            +    +F E +    +   DGYNV I +YG   SGK YT+        N  +      G
Sbjct: 426 HNTNADVFQE-ICQLVQCSLDGYNVCIFAYGQTGSGKTYTML-------NPGD------G 471

Query: 127 VVPRVLSRLFK---DLESNGNDHIIKCSFVEIYNDELRDLL 164
           ++P  LS +F+   DL  +G  + + C ++EIYN+ + DLL
Sbjct: 472 MIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 84/170 (49%), Gaps = 15/170 (8%)

Query: 274 IQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNE 333
           I N+ ++ +T  E+  +++K+  + R  A T S    NE S RSHS+F + +    +   
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRS----NERSSRSHSVFMVHINGHNDQTG 598

Query: 334 VFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNLQSFNKMINGMVN-----NSTYAS----- 383
                KL+ ++ AGSE   N++   G      Q+ NK ++ + +     NS  A+     
Sbjct: 599 EVSHGKLNLIDLAGSERI-NSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIP 657

Query: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           F +SKLT LLQ +  G ++TL   NI   +K  + T + L  A+K+   K
Sbjct: 658 FRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 89/175 (50%), Gaps = 18/175 (10%)

Query: 273 YIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVN 332
           YI+ L +  +   EE +  I++G   R +A T      NE S RSH+I  I + ++ E++
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAV----NENSSRSHAICTINI-QQTEID 227

Query: 333 E----VFRMSKLSFVNFAGSEYGDNNTSKNGAF------NSNLQSFNKMINGMVNNS-TY 381
                V R+S +  V+ AGSE    + +K+  F      N +L +  +++  + NN  T 
Sbjct: 228 SFGDTVERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTG 287

Query: 382 ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEP 436
             + +S LT++L++N DG + T  +A I+P     + + S L  A+  K ++ E 
Sbjct: 288 VPYRESLLTRVLRDNLDGNSITCILACISPCD--YEESISTLRYASTAKHVRTEA 340

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 82/170 (48%), Gaps = 32/170 (18%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGR-----KKIYTLDAV 63
           NI VA+R R+ I  E  +  P++I     +  TSNE+ +  ++T       +  +  D V
Sbjct: 4   NIKVAIRIRDKISRE--TSRPSVI-----KRKTSNEITLQKDNTANVITTVEHTFYFDQV 56

Query: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESE 123
           + E  +QK+++ E    +     +GY+  +++YG   +GK YT+ G   E          
Sbjct: 57  FDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQE---------- 106

Query: 124 NLGVVPRVLSRLFKDL---ESNGND-----HI-IKCSFVEIYNDELRDLL 164
             G++P V   LFK +   +  G D     H  +  S+ +IYN+++ D+L
Sbjct: 107 -PGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 18/124 (14%)

Query: 48  LDESTGRKK-IYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYT 106
           L  +TG     +  D V+     QK + D  V P  K    GYN +I++YG  FSGK+Y+
Sbjct: 64  LHNATGSPHSTFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYS 123

Query: 107 LYG-EYSELQNANNAESENLGVVPRVLSRLFKDLESN----GNDHIIKCSFVEIYNDELR 161
           L G +Y+E            GV+P +   LF+ LE N    G +  +     EIY ++  
Sbjct: 124 LLGSQYNE------------GVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSY 171

Query: 162 DLLI 165
           DLL+
Sbjct: 172 DLLV 175

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 82/173 (47%), Gaps = 17/173 (9%)

Query: 274 IQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE---E 330
           + NL   T   +E+ M ++ +G  NR    T S +D NE S RSH++  + + +     +
Sbjct: 246 VANLSYHTPETVEDVMDLVIRGNVNR----TTSPTDANETSSRSHAVLQVHVVQSSRTVD 301

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNNS----T 380
           + E    + LS ++ AGSE      ++      G+  N +L +    IN +         
Sbjct: 302 LKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVC 361

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
           +  + DSKLT+LL+ +  G  +T+ I  ++P     D T + L  A + K+IK
Sbjct: 362 HVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIK 414

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 14/127 (11%)

Query: 40  GTSNEVIVLDESTGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSR 99
           G+  EV       G +K +  D ++     Q+ +F  T +P   S  DG+N ++ +YG+ 
Sbjct: 111 GSRGEVRRRMRRNGEQK-FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGAT 169

Query: 100 FSGKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDLES--NGNDHIIKCSFVEIYN 157
             GK +T+ G             ++ G++   +  LF+ + +  +     +  S++EIYN
Sbjct: 170 GCGKTFTISG-----------TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYN 218

Query: 158 DELRDLL 164
           + +RDLL
Sbjct: 219 ETIRDLL 225

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 18/177 (10%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE-- 329
           I + NL   +   +++ + ++ +G  NR    T S ++ N  S RSH++  I + +    
Sbjct: 259 ISVSNLSYHSPRSVQDVLDLVIRGNDNR----TTSPTEANSVSSRSHAVLQIHIMQRNKL 314

Query: 330 -EVNEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMVNNST-- 380
            ++ E      LS ++ AGSE      ++      GA  N +L +    IN + +N    
Sbjct: 315 VDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSH 374

Query: 381 ---YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
              +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK 
Sbjct: 375 RNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKT 431

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++     Q+ ++  T      S  DG+N ++ +YG+   GK YT+ G        
Sbjct: 143 FVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 194

Query: 118 NNAESENLGVVPRVLSRLF--KDLESNGNDHIIKCSFVEIYNDELRDLL 164
                EN G++ R +  LF   D  +   D  +  SF+EIYN+ + DLL
Sbjct: 195 ---TRENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 30/158 (18%)

Query: 10  ITVAVRCREP---IDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGE 66
           ITVAVR +     +D + H+  P  I+  D  D                  +  D V+G 
Sbjct: 94  ITVAVRIKPTAPNVDPQWHALGPRCIAHWDQGD------------------FQFDHVFGP 135

Query: 67  QDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLG 126
               + LF E      +  FDG N ++++YG+  SGK YT+ G        N+   +  G
Sbjct: 136 TATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH-------NDGIVKMCG 188

Query: 127 VVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164
               V +R+    +       +  S++EIYN+++ DLL
Sbjct: 189 DC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLL 224

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 74/181 (40%), Gaps = 24/181 (13%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + +  + E      EE M  +  G   R+   T    D N  S RSH+I  + L     
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKT----DYNMRSSRSHAIIQVKLITTNL 297

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNN--TSKNGAF-NSNLQSFNKMIN-------------- 373
           +N     + LS  + AGSE         K G+F N +L +   +I+              
Sbjct: 298 LNGTTHFNTLSLCDLAGSEKASEQLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRP 357

Query: 374 --GMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKE 431
             G +NNS +  + DSKLT+LLQ      +    I  I P K+ +  T + L  A++ K 
Sbjct: 358 SSGSLNNS-HIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKN 416

Query: 432 I 432
           +
Sbjct: 417 V 417

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%), Gaps = 14/110 (12%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           ++ D V+   +D   +++ET  P  +  F G+N +I +YG   SGK +T+ G  +E    
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGTSNE---- 202

Query: 118 NNAESENLGVVPRVLSRLFKDLES---NGNDHIIKCSFVEIYNDELRDLL 164
                   G++P  ++ +F ++ S   N     +K S++EIYN+++ DLL
Sbjct: 203 -------PGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLL 245

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 65/148 (43%), Gaps = 18/148 (12%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + +  L E  +   E+ M  I  G  NR+   T    D N  S RSH+I  I L   + 
Sbjct: 272 GVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGET----DFNSRSSRSHAIVLIRLTCTDL 327

Query: 331 VNEVFRMSKLSFVNFAGSE--YGDNNTSKNGAF-NSNLQSFNKMINGMVNNST------- 380
            + +   S LS  + AGSE         K GAF N +L +   +I+ +   ST       
Sbjct: 328 KSGLETTSTLSLCDLAGSERATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGG 387

Query: 381 --YASFLDSKLTQLLQNNF--DGITRTL 404
             +  + DSKLT++LQ     DGI  T+
Sbjct: 388 GHHIPYRDSKLTRILQPALSGDGIVTTI 415

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 96/425 (22%), Positives = 146/425 (34%), Gaps = 124/425 (29%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D V+       ++++ T  P       G+N +I +YG   SGK +T+ G   EL   
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL--- 219

Query: 118 NNAESENLGVVPRVLSRLFKDL---ESNGN---DHIIKCSFVEIYNDELRDLLIDXXXXX 171
                   G++P  +S LF ++     +G+   D II  S++EIYN+             
Sbjct: 220 --------GLIPLSVSYLFSNIMEQSMDGDKKFDVII--SYLEIYNE------------- 256

Query: 172 XXXXXXXXXXXXXKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKR 231
                           RI D   +GL  +GS                 P    R  MGK 
Sbjct: 257 ----------------RIYDLLESGLEESGSR----------------PGTPSRSYMGK- 283

Query: 232 SLPPXXXXXXXXXXXXXXXXXXXXXXXDYSLQSSHERLNSIYIQNLQEITITEIEEGMAI 291
                                         L+   +    + +  L E      EE +  
Sbjct: 284 ---------------------SNSNAMGVELKIRDDSKYGVKVIGLTERRCESTEELLRW 322

Query: 292 IKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSE-- 349
           I  G K+R+I  T    D N  S RSH+I  I L   +  N   R S LS  + AGSE  
Sbjct: 323 IGIGDKSRKIGET----DYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSERA 378

Query: 350 YGDNNTSKNGAF-NSNLQSFNKMINGMVNNST---------------------------- 380
            G     K G+F N +L +   +I+ +  + T                            
Sbjct: 379 TGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGI 438

Query: 381 ---YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPK 437
              +  + DSKLT+LLQ    G +    I  +         T + L  A++ K +     
Sbjct: 439 PSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVS 498

Query: 438 KGSVI 442
           K S+I
Sbjct: 499 KKSII 503

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 73/165 (44%), Gaps = 28/165 (16%)

Query: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLD---ESTGRKKIYTLDAVYG 65
           NI V  R R P D++       II +   +  T  + + LD     T     +  D ++ 
Sbjct: 362 NIRVFCRVR-PTDDD-----TNIIKVHGFDSDTGTQSLTLDIKRPMTNGSVNFQFDKIFN 415

Query: 66  EQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENL 125
             +  +++F E V    +S  DG+NV I +YG   SGK YT+  E               
Sbjct: 416 YDESNRQVFGE-VKELVQSALDGHNVCIFTYGQTGSGKTYTMLNEED------------- 461

Query: 126 GVVPRVLSRLFKDLESN----GNDHIIKCSFVEIYNDELRDLLID 166
           G++P  L  +  D  S+    G  + +K  FVEIYND + DLL D
Sbjct: 462 GIIPSTLDHII-DWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLND 505

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 68/142 (47%), Gaps = 13/142 (9%)

Query: 297 KNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNN-- 354
           K RR A T      N  S RSHS+F + +    + +E      L+ V+ AGSE  + +  
Sbjct: 557 KVRRTAKTAM----NNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLAGSERMNRSGL 612

Query: 355 -----TSKNGAFNSNLQSFNKMINGMV--NNSTYASFLDSKLTQLLQNNFDGITRTLFIA 407
                  +    N +L S   +I+ +   + S +  F ++KLT LL+++  G ++TL + 
Sbjct: 613 VDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTLMLV 672

Query: 408 NIAPLKKQLDATCSVLTMATKI 429
            ++P     + T + L  ATK+
Sbjct: 673 TVSPSNSSRNETMNSLRFATKV 694

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 57/121 (47%), Gaps = 16/121 (13%)

Query: 50  ESTGRK-KIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLY 108
           E+TG     +  D V+     Q+ + D  V P       GYN +I++YG  FSGK+Y+L 
Sbjct: 66  ETTGDTYSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLL 125

Query: 109 GEYSELQNANNAESENLGVVPRVLSRLFKDLESN----GNDHIIKCSFVEIYNDELRDLL 164
           G             E  G++P +   LF+ LE N    GN+  +     EI+ ++  DLL
Sbjct: 126 G-----------SQEGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

Query: 165 I 165
           +
Sbjct: 175 V 175

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 64/141 (45%), Gaps = 30/141 (21%)

Query: 316 RSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNLQSFNKMINGM 375
           +SH +F + + +     ++ R S L  ++  G+E  D  T    + ++ L+  N+ I  +
Sbjct: 234 KSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDA-LKKLNQSIEAL 292

Query: 376 VN----------NSTY-------ASFLDSKLTQLLQNNFDG-----ITRTLFIANIAPLK 413
            N          +S Y       +++ +S+LT++L+++  G     +  T F++N++   
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVS--- 349

Query: 414 KQLDATCSVLTMATKIKEIKN 434
                T S L     I++I N
Sbjct: 350 ----TTLSTLEFGECIRQITN 366

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++ E   Q +++  T      S  DG+N ++ +YG+   GK YT+ G        
Sbjct: 191 FVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 242

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHI--IKCSFVEIYNDELRDLL 164
                EN G++ RV+  LF+ +E   ++    +  S++EIYN+ + DLL
Sbjct: 243 ---TQENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 84/180 (46%), Gaps = 22/180 (12%)

Query: 272 IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE-- 329
           I + NL       +++ + ++ +G  NR  +ST    + NE S RSH++  I + +    
Sbjct: 307 ISVSNLSYHYPKSVQDVIDLVIRGNINRSTSST----EANEVSSRSHAVLQIHIMQTNTK 362

Query: 330 -EVNEVFRMSKLSFVNFAGSEYGDNNTSKN-----GA-FNSNLQSFNKMINGMV---NNS 379
            ++      + LS ++ AGSE      ++      GA  N +L +    IN +    NN+
Sbjct: 363 IDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNNT 422

Query: 380 T------YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIK 433
                  +  + DSKLT+LL+ +  G  +T+ I  I+P     D T + L  A + KEIK
Sbjct: 423 RRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 482

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 78/179 (43%), Gaps = 21/179 (11%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + +  L+E      EE M  I++G  +R+ A T    D N  S RSH+I  I L     
Sbjct: 278 GVRVMGLREQRCESSEELMKWIRRGDSHRKTAET----DYNARSSRSHAIVLIRLTNTNV 333

Query: 331 VNEVFRMSKLSFVNFAGSE--YGDNNTSKNGAF-NSNLQSFNKMINGMVNNSTYAS---- 383
           ++     S LS  + AGSE   G     K GAF N +L +   +I+ +   ST AS    
Sbjct: 334 IDGTSISSTLSLCDLAGSERATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNS 393

Query: 384 ----------FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEI 432
                     + DSKLT++LQ    G +    I  I   K+    T + L  A++ K +
Sbjct: 394 PNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 68/159 (42%), Gaps = 25/159 (15%)

Query: 10  ITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQDD 69
           ITVA+R + P      S S  +         T  E IV D+  G    +  D VY     
Sbjct: 101 ITVAIRPK-PTPPTHFSNSWLV---------TDPETIVHDD-MGE---FKFDHVYSPHVS 146

Query: 70  QKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVVP 129
             ++++    P     F G+N ++ +YG   SGK YT       +  +     ++ G++P
Sbjct: 147 NLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYT-------MMGSGGDGGDDDGLIP 199

Query: 130 RVLSRLFKDLESNG----NDHIIKCSFVEIYNDELRDLL 164
             +S LF  +   G        +  S++EIYN+ + DLL
Sbjct: 200 LSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLL 238

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D V+     QK + D  + P       GYN +I++YG  FSGK+Y+L G        
Sbjct: 76  FQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIG-------- 127

Query: 118 NNAESENLGVVPRVLSRLFKDLESN----GNDHIIKCSFVEIYNDELRDLLI 165
                +  G++P +   LF  LE      GN+  +     EIY ++  DLL+
Sbjct: 128 ---PQDGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLLV 176

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 63/141 (44%), Gaps = 30/141 (21%)

Query: 316 RSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNLQSFNKMINGM 375
           RSH +F + + +    +++ + S L  ++  G+E  D    +N     +L+  N+ I  +
Sbjct: 235 RSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRI-ENTLSQDSLKKLNQSIEAL 293

Query: 376 VN----------NSTYAS-------FLDSKLTQLLQNNFDG-----ITRTLFIANIAPLK 413
            N          +S Y++       + +S+LT++L+++  G     +  T F++N+    
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVP--- 350

Query: 414 KQLDATCSVLTMATKIKEIKN 434
                T S L     I++I N
Sbjct: 351 ----TTLSTLKFGDSIRQINN 367

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 52/109 (47%), Gaps = 13/109 (11%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D V+  + +  ++++   +P     F+G+N +I +YG   SGK YT+ G  S     
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSKS----- 160

Query: 118 NNAESENLGVVPRVLSRLFKDLESN--GNDHIIKCSFVEIYNDELRDLL 164
                   G++P  +  +F  +          ++ S++EIYN+ + DLL
Sbjct: 161 ------GPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLL 203

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 89/198 (44%), Gaps = 17/198 (8%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + +  L E  ++  +E M  I  G  NR+   T    D N  S RSH++  I ++  +E
Sbjct: 235 GVKVVGLVERNVSSNKELMKCISIGDHNRKTGET----DFNTRSSRSHAVVLIRVFCTDE 290

Query: 331 VNEVFRMSKLSFVNFAGSE--YGDNNTSKNGAF-NSNLQSFNKMI-------NGMVNNST 380
           +     MS LS  + AGSE   G     K GA+ N +L +   +I       +G+  N  
Sbjct: 291 ITGEQVMSTLSLCDLAGSERATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVG 350

Query: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKG- 439
           +  + DSKLT++LQ    G +    I  +    +    + + +  A++ K I    K+  
Sbjct: 351 HIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISLAVKRNE 410

Query: 440 --SVITKESLIKILSNEL 455
             S ++K  LI+ L  ++
Sbjct: 411 ADSNVSKSQLIQTLRKQV 428

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 55/110 (50%), Gaps = 19/110 (17%)

Query: 60  LDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANN 119
            DA   ++D QK L    V P      +GYN ++++YG  FSGK+Y+L G         +
Sbjct: 81  FDANATQEDVQKFL----VHPIINDVLNGYNGTVITYGPSFSGKSYSLIG---------S 127

Query: 120 AESENLGVVPRVLSRLFKDLESN----GNDHIIKCSFVEIYNDELRDLLI 165
            ESE  G++P +   LF  LE N    G+   +     EIY ++  DLL+
Sbjct: 128 KESE--GILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLV 175

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 69/151 (45%), Gaps = 31/151 (20%)

Query: 306 SASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNGAFNSNL 365
           +  DK E S RSH +F + + +    +++ + S L  V+  G+E  D  T    + ++ L
Sbjct: 225 ACGDKTERS-RSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA-L 282

Query: 366 QSFNKMINGMVN----------NSTY-------ASFLDSKLTQLLQNNFDG-----ITRT 403
           +  N+ I  + N          +S Y       +++ +S+LT++L+++  G     +  T
Sbjct: 283 KKLNQSIEALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILT 342

Query: 404 LFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
            F++N+         T S L     I++I N
Sbjct: 343 CFLSNVP-------TTLSTLEFGDSIRQINN 366

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 22/178 (12%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           + + +  L E  +   E+ +  I  G  NRR   T    D N  S RSH+I  + L   +
Sbjct: 276 HGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGET----DYNTRSSRSHAIVTLNLACTD 331

Query: 330 EVNEVFRMSKLSFVNFAGSE--YGDNNTSKNGAF-NSNLQSFNKMINGMVNNSTYAS--- 383
            V+     S LS  + AGSE   G +   K GAF N +L +   +I+ +  +S + +   
Sbjct: 332 LVSGAETTSTLSLCDLAGSERAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSF 391

Query: 384 ------FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDA---TCSVLTMATKIKEI 432
                 + DSKLT++LQ    G +    +  I  +  +LDA   T + +  A++ K +
Sbjct: 392 GNSHIPYRDSKLTRILQPALSGES---IVTTICTIDTRLDAMSETVNTIRFASRAKNV 446

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 14/110 (12%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D V+  Q +  +++ +   P     F GYN  I +YG   SGK +T+ G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSG-------- 190

Query: 118 NNAESENLGVVPRVLSRLFKDL--ESNGNDHI-IKCSFVEIYNDELRDLL 164
                E  G++   +  +F  +  ES  N    +  S++EIYN+++ DLL
Sbjct: 191 ---TPEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLL 237

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  + VY     Q+++ ++ +         G+NVSIM++GS  SGK YT++G        
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFG-------- 119

Query: 118 NNAESENLGVVPRVLSRLFKDL----ESNGNDHIIKCSFVEIYNDELRDLL 164
           N+ E    G+V R+   +F  L    E +GN+  I  +F E++ + + DLL
Sbjct: 120 NDHEE---GIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 89/187 (47%), Gaps = 20/187 (10%)

Query: 264 SSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNI 323
           SS  + +++ ++ L+ +++  + E +A I +G   R        SD +    RS +  NI
Sbjct: 179 SSDTKTHTLSVKGLRTVSVNSVYELLAYINEGHLRR------CHSDSHYRKSRSSAFLNI 232

Query: 324 TLYKEEEVNEVFRMSKLSFVNFAGSEYGDNN------TSKNGAFNSNLQSFNKMINGMV- 376
           T+ +  +  E  + S L  ++ A S+  D N      T +  + NS++Q+ ++++ G+  
Sbjct: 233 TVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSE 292

Query: 377 -------NNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKI 429
                  N+S+  +   S+L + LQ    G ++T  +   +  K   + T   L++ +++
Sbjct: 293 LESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRL 352

Query: 430 KEIKNEP 436
           + I N P
Sbjct: 353 RSIHNFP 359

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 56/111 (50%), Gaps = 15/111 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D V+ +    ++++    +P     F+GYN +I +YG   SGK +T+ G   E    
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQE---- 201

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGND----HIIKCSFVEIYNDELRDLL 164
                   G++P+ +  +F  + S  +     + +K S++EIYN+++ DLL
Sbjct: 202 -------PGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLL 245

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 64/144 (44%), Gaps = 19/144 (13%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + + +L E  ++  E+ M  I  G +NR+   T    D N  S RSH+I  + L + + 
Sbjct: 274 GVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGET----DFNTRSSRSHAIVLLRLTRYDL 329

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNT--SKNGAF-NSNLQSFNKMI----------NGMVN 377
                  S LS  + AGSE         K GAF N +L +   +I          NG+  
Sbjct: 330 KTGSEATSTLSLCDLAGSERAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQP 389

Query: 378 N--STYASFLDSKLTQLLQNNFDG 399
           +  + +  + DSKLT++LQ    G
Sbjct: 390 SPAAGHIPYRDSKLTRILQPALTG 413

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 22/129 (17%)

Query: 42  SNEVIVLDESTGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFS 101
           +N+  ++ E  G    +  D V+       ++++ T  P       G+N +I +YG   S
Sbjct: 150 TNDKTIIHEEIGE---FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGS 206

Query: 102 GKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFK---DLESNGN---DHIIKCSFVEI 155
           GK +T+ G   E           LG++P  +S LF    +L  NG+   D II  S++EI
Sbjct: 207 GKTFTMSGNEQE-----------LGLIPLSVSYLFSNVMELSMNGDKKFDVII--SYLEI 253

Query: 156 YNDELRDLL 164
           YN+ + DLL
Sbjct: 254 YNERIYDLL 262

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 91/230 (39%), Gaps = 48/230 (20%)

Query: 286 EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345
           EE +  I  G K+R+I  T    D N  S RSH+I  I L   +  +   R S LS  + 
Sbjct: 317 EELLKWIAIGDKSRKIGET----DYNARSSRSHAIVLIRLTSTDLESGTSRSSTLSLCDL 372

Query: 346 AGSE--YGDNNTSKNGAF-NSNLQSFNKMINGM----VNNS------------------- 379
           AGSE   G     K G+F N +L +   +I+ +    +N +                   
Sbjct: 373 AGSERATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGSNIHTTPTNTGSSSSGTV 432

Query: 380 --------TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKE 431
                    +  + DSKLT+LLQ    G +    I  +         T + L  A++ K 
Sbjct: 433 TSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETINTLRFASRAKN 492

Query: 432 IKNEPKKGSVIT-------KESLIKILSNELVKTK---SDLLSYKSNDNG 471
           +     K S+I+       K+  I++L  +L   +   SDL    S D G
Sbjct: 493 VALHVSKKSIISNGNNDGDKDRTIEMLRRQLEDQRRLISDLKGRPSPDEG 542

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 22/129 (17%)

Query: 42  SNEVIVLDESTGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFS 101
           +N+  ++ E  G    +  D V+       ++++ T  P       G+N +I +YG   S
Sbjct: 150 TNDKTIVHEEIGE---FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGS 206

Query: 102 GKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDL---ESNGN---DHIIKCSFVEI 155
           GK +T+ G   E           LG++P  +S LF ++     NG+   D II  S++EI
Sbjct: 207 GKTFTMSGNEQE-----------LGLIPLSVSYLFTNIMEQSMNGDKKFDVII--SYLEI 253

Query: 156 YNDELRDLL 164
           YN+ + DLL
Sbjct: 254 YNERIYDLL 262

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 83/211 (39%), Gaps = 45/211 (21%)

Query: 286 EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345
           EE +  I  G K+R+I  T    D N  S RSH+I  I L      N   R S LS  + 
Sbjct: 317 EELLRWIAVGDKSRKIGET----DYNARSSRSHAIVLIRLTSTNVKNGTSRSSTLSLCDL 372

Query: 346 AGSE--YGDNNTSKNGAF-NSNLQSFNKMINGM--------------------------- 375
           AGSE   G     K G+F N +L +   +I+ +                           
Sbjct: 373 AGSERATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNA 432

Query: 376 VNNSTYAS----FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKE 431
            NN T  S    + DSKLT+LLQ    G +    I  +         T + L  A++ K 
Sbjct: 433 TNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKN 492

Query: 432 IKNEPKKGSVIT-------KESLIKILSNEL 455
           +     K S+I+       K+  I++L  +L
Sbjct: 493 VALHVSKKSIISNGNNDGDKDRTIELLRRQL 523

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 76/160 (47%), Gaps = 32/160 (20%)

Query: 10  ITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGEQDD 69
           ++VA+R +           P+  ++ D+  GTSN+++  +        +  D V+ ++  
Sbjct: 113 VSVAIRIK-----------PSDSALKDSWYGTSNKLMHTEFGE-----FQFDHVFTKEVT 156

Query: 70  QKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVVP 129
             +++     P     F GYN +I +YG   SGK +T+ G             ++ G++P
Sbjct: 157 NSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSG-----------TKQDPGLIP 205

Query: 130 RVLSRLFKDL-----ESNGNDHIIKCSFVEIYNDELRDLL 164
             +  +F  +     +S  + + +K S++EIYN+++ DLL
Sbjct: 206 LCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 92/222 (41%), Gaps = 26/222 (11%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + + +L E  +    E +  I  G KNR+   T    D N  S RSH+I  + L + E 
Sbjct: 275 GVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGET----DFNSRSSRSHAIVLLRLTRCEL 330

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNT--SKNGAF-NSNLQSFNKMINGMVNN--------- 378
                  S LS  + AGSE         K GAF N +L +   +I  +  N         
Sbjct: 331 KTGTEVTSTLSLCDLAGSERAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGSN 390

Query: 379 -------STYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKE 431
                    +  + DSKLT++LQ    G +    I  I    +    T + +  A++ K 
Sbjct: 391 GQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKN 450

Query: 432 IKNEPKKGSVIT---KESLIKILSNELVKTKSDLLSYKSNDN 470
           I    +K  + T   K+S+I+ L  +L +  + + + + N++
Sbjct: 451 ISLNVRKNEMDTSNEKDSIIQNLRKQLDEQHATIAALRRNNS 492

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 15/111 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +T D V+        ++ +T  P      +GYN +I +YG   SGK +T+ G        
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSG-------- 184

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGNDH----IIKCSFVEIYNDELRDLL 164
                E  G++P  +S LF  L    N       +  S++EIYN+++ DLL
Sbjct: 185 ---TEEEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLL 232

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 73/175 (41%), Gaps = 32/175 (18%)

Query: 286 EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345
           EE +  I KG KNR+ + T    + N  S RSH+I  I L  ++       +  LS  + 
Sbjct: 283 EEVLDWINKGNKNRKTSET----EFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLSLCDL 338

Query: 346 AGSE--YGDNNTSKNGAF-NSNLQSFNKMIN------------GMVNNST---------- 380
           AGSE   G N   K GAF N +L +   +I+            G   NS           
Sbjct: 339 AGSERGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSS 398

Query: 381 ---YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEI 432
              +  + DSKLT+LLQ    G +  + +  I    +    T + L  A++ K +
Sbjct: 399 SGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNV 453

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 19/113 (16%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           YT D V+        ++  T  P     FDG+N ++ +YG   SGK YT+ G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 118 NNAESENLGVVPRVLSRLFKDL------ESNGNDHIIKCSFVEIYNDELRDLL 164
                 N G++P  ++ ++  +      E+   D ++  S++EIYN+++ DLL
Sbjct: 156 ---VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLV--SYLEIYNEKIYDLL 203

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 78/162 (48%), Gaps = 22/162 (13%)

Query: 286 EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345
           EE +  IK G K+R+ +ST    D N  S RSH+I  I L   +  +     S LS  + 
Sbjct: 245 EELLNWIKLGDKHRKTSST----DFNTRSSRSHAIILIRLISSDLSSGEVVTSTLSLCDL 300

Query: 346 AGSE--YGDNNTSKNGAF-NSNLQSFNKMINGM---VNNST------YASFLDSKLTQLL 393
           AGSE     +   + G+F N +L +   +I+ +   VNNST      +  + DSKLT++L
Sbjct: 301 AGSERVTAQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRIL 360

Query: 394 QNNFDGITRTLFIANIAPLKKQLDAT---CSVLTMATKIKEI 432
           Q    G +    +  I  +   +DAT    + L  A++ K +
Sbjct: 361 QPALSGNS---IVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 14/112 (12%)

Query: 56  KIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQ 115
           K++ +D ++      K      +       F+GYNV+IM+YG   SGK  T++G      
Sbjct: 69  KLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFG------ 122

Query: 116 NANNAESENLGVVPRVLSRLFKDLES---NGNDHIIKCSFVEIYNDELRDLL 164
             N  +    GV+  V  ++F  +E+   N  D+ I  S +E+  + +RDLL
Sbjct: 123 -YNKGD----GVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 77/182 (42%), Gaps = 32/182 (17%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           SI I+NL+ + +T + E ++  +KG   R +AS+           RS  I  IT+ + + 
Sbjct: 188 SISIKNLRCVYVTSLLEALSYCEKG---RSLASS-----------RSSVIIRITVEQRDN 233

Query: 331 VNEVFRMSKLSFVNFAGSEYGDN---------NTSKNGAFNSNLQSFNKMINGM---VNN 378
           V EVF+      V+   S+  D          NT K       L++  + + G    V N
Sbjct: 234 VKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKN 293

Query: 379 ST------YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEI 432
                   Y  + +S LTQLLQ    G  +T  +   +  K+  + T + L     +K +
Sbjct: 294 GRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLV 353

Query: 433 KN 434
           KN
Sbjct: 354 KN 355

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 8/107 (7%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D V+  Q +   +++E   P     F GYN +I +YG   SGK +T+ G   E    
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTRDE---- 195

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164
                  L  V ++ S++ K+   N   + ++ S++EIYN+++ DLL
Sbjct: 196 ---AGLILLSVEQIFSQIMKE-SVNNKSYEVRVSYLEIYNEKIYDLL 238

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 77/182 (42%), Gaps = 23/182 (12%)

Query: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329
           + + +  L E  +   E+ +  I+ G  NRR   T    D N  S RSH+I  I +   E
Sbjct: 273 HGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGET----DYNTRSSRSHAIVTIKVTCTE 328

Query: 330 EVNEVFRMSKLSFVNFAGSE--YGDNNTSKNGAF-NSNLQSFNKMINGMVNNS------- 379
            ++     S LS  + AGSE   G +   K GAF N +L +   +I+ +   S       
Sbjct: 329 LLSGTDTTSTLSLCDLAGSERAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGA 388

Query: 380 ---------TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIK 430
                    ++  + DSKLT++LQ    G +    I  I      +  T + +  A++ K
Sbjct: 389 ATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAK 448

Query: 431 EI 432
            +
Sbjct: 449 NV 450

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 18/127 (14%)

Query: 42  SNEVIVLDESTGRKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFS 101
           +N+  ++ E  G    +  D V+       +++++T  P       G+N +I +YG   S
Sbjct: 150 TNDRTIVHEEIGE---FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGS 206

Query: 102 GKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDL---ESNGNDHI-IKCSFVEIYN 157
           GK +T+ G   E           LG++P  +S LF ++     NG+    +  S++EIYN
Sbjct: 207 GKTFTMSGNEQE-----------LGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYN 255

Query: 158 DELRDLL 164
           + + DLL
Sbjct: 256 ERIYDLL 262

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 74/197 (37%), Gaps = 44/197 (22%)

Query: 286 EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345
           E+ +  I  G K+R+I  T    D N  S RSH+I  I L   +  +   R S LS  + 
Sbjct: 317 EDLLRWIAVGDKSRKIGET----DYNARSSRSHAIVLIRLTSTDVRDGTSRSSTLSLCDL 372

Query: 346 AGSE--YGDNNTSKNGAF-NSNLQSFNKMINGMVNNST---------------------- 380
           AGSE   G     K G+F N +L +   +I+ +  + T                      
Sbjct: 373 AGSERATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIPTTPTSSGNSSSSSS 432

Query: 381 ---------------YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTM 425
                          +  + DSKLT+LLQ    G +    I  +         T + L  
Sbjct: 433 SSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRF 492

Query: 426 ATKIKEIKNEPKKGSVI 442
           A++ K +     K S+I
Sbjct: 493 ASRAKNVSLHVSKKSII 509

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 19/113 (16%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           Y  D V+   D   +   E +    +S   GYN SI++YG   +GK++ LYGE  +    
Sbjct: 73  YKFDKVFASNDTGVE-HQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQD---- 127

Query: 118 NNAESENLGVVPRVLSRLFKDL-ESNGND-----HIIKCSFVEIYNDELRDLL 164
                   G++ ++L++LF  + E  GN+     + +K SF+E+Y +++ DL+
Sbjct: 128 --------GLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLM 172

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 80/188 (42%), Gaps = 26/188 (13%)

Query: 269 LNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKE 328
           +N   ++NL+   +  +EE   +I   L N++          N   +RSH+I  +++ K 
Sbjct: 190 MNGFQVENLRTTQVLTLEELKILINICLLNQK-------ERHNNLIQRSHTIMEVSIEKR 242

Query: 329 EEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMV------ 376
            +++E   MS L  V+ AGS+    N+S           N  ++S N +ING+V      
Sbjct: 243 NKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREG 302

Query: 377 ----NNSTY---ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKI 429
               + ST      +  S LT+LL +   G  +T F+   +  K   + T S L      
Sbjct: 303 GIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNC 362

Query: 430 KEIKNEPK 437
           K     P+
Sbjct: 363 KSANTNPR 370

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 19  PIDEEKHSGS-PTIISIGDNEDGTSNEVIVLDESTGRKKIYT---LDAVYGEQDDQKKLF 74
           P  +E +SG    +I +  N     +   V DE T +   Y     D V+    +  +++
Sbjct: 79  PRKQEPYSGIISVVIRLKPNGGRELDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVY 138

Query: 75  DETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVVPRVLSR 134
            +T  P     F+G N ++ +YG   SGK +T+ G             E LG++P  ++ 
Sbjct: 139 AQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAG-----------TEETLGLIPLSVAY 187

Query: 135 LFKDL--ES-NGNDHI-IKCSFVEIYNDELRDLL 164
           L+  +  ES  G+    I  S++EIYN+++ DLL
Sbjct: 188 LYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLL 221

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 75/181 (41%), Gaps = 26/181 (14%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + I  L E      +E +  I+ G K+R+   T      N  S RSH+I  I L K + 
Sbjct: 261 GVKIVGLTERRCESSDELLKWIRIGDKSRKTGET----TYNTRSSRSHAIVMIRLTKTDL 316

Query: 331 VNEVFRMSKLSFVNFAGSEYG--DNNTSKNGAF-NSNLQSFNKMINGMVNNST------- 380
                  S LS  + AGSE     N   K GAF N +L +   +I+ +   ST       
Sbjct: 317 KEGTSVSSTLSLCDLAGSEKAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGS 376

Query: 381 ------YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDA---TCSVLTMATKIKE 431
                 +  + DSKLT++LQ    G      +  I  +  + DA   T + L  A++ K 
Sbjct: 377 SSPVTGHIPYRDSKLTRILQPALSG---NGVVTTICTIDTRPDASSETLNTLRFASRAKN 433

Query: 432 I 432
           +
Sbjct: 434 V 434

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 11/110 (10%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           Y  D+++     + + +D            GYN +IM+YG   SGK++ L+G+       
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGD------- 138

Query: 118 NNAESENLGVVPRVLSR-LFKDLESNGNDHIIKCSFVEIYNDELRDLLID 166
              +S N G++  +  R LF   E N    +   S  E+Y D++ DLL++
Sbjct: 139 --PDSTNDGLINHIADRLLFPQCEDNLKT-LCSISMWELYIDKVYDLLLN 185

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 15/85 (17%)

Query: 86  FDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDLESNGND 145
            +GYN ++++YG ++SGK Y+LYG         N   ++ G+   +   LF  +  +  D
Sbjct: 112 MEGYNTALVTYGPKYSGKTYSLYG---------NDVDDSFGLGQIIFKDLFSRINKSVTD 162

Query: 146 ------HIIKCSFVEIYNDELRDLL 164
                  I+K SF+E++ D++ DLL
Sbjct: 163 SNAKYTFIVKISFLEVWLDKVVDLL 187

 Score = 38.5 bits (88), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 85/182 (46%), Gaps = 25/182 (13%)

Query: 274 IQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNE 333
           + NL+++ +   +E +    + +      S  ++   N F  R+++IFNI + K ++++E
Sbjct: 211 VDNLRQVHVASFKETLYYFNQAM------SVLNSKHDNSF-PRTNTIFNINIEKLDKLDE 263

Query: 334 VFRMSKLSFVNFAGSEYGD--NNTSKNG----AFNSNLQSFNKMINGM--VNNSTY---- 381
               S +  V+ AGS+  D  N++  N       NS+++S   +I  +  ++ S Y    
Sbjct: 264 STTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYE 323

Query: 382 ------ASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNE 435
                   +  SKL +LL+    G  +T F+  I+   +Q D     L + T +++ K  
Sbjct: 324 FSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTV 383

Query: 436 PK 437
           P+
Sbjct: 384 PQ 385

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 21/142 (14%)

Query: 271 SIYIQNLQEITIT------EIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNIT 324
           +  +  L+E TIT       +   + ++ +G +NRR+ ST      N  S RSH++  + 
Sbjct: 217 ACRLHGLKETTITLDDSEQSVSRVLELVAQGNRNRRVRST----QHNTGSSRSHAVLRLR 272

Query: 325 LYKEEEVNEVFRMSKLSFVNFAGSEYGDNN----TSKNGAFNSNLQSFN---KMINGMVN 377
           +   + +    R+  L+  + AGSE    +     ++ GA N +L +     +++N    
Sbjct: 273 I--TDSMGSKARV--LTLCDLAGSERASVHDRGLRAEGGAINKSLMALGTVVRLLNETGP 328

Query: 378 NSTYASFLDSKLTQLLQNNFDG 399
           +ST+  + DSKLT+LL+ +  G
Sbjct: 329 SSTHVPYRDSKLTRLLKPSLSG 350

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 14/86 (16%)

Query: 81  FYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDLE 140
            ++   D  + +I++YG+  SGK YT++G  +E            G+V   +  L   L 
Sbjct: 131 VHRVATDCISGTIIAYGATGSGKTYTMHGTKAE-----------GGIVQLSIRDLLTQLS 179

Query: 141 SNGNDHIIKCSFVEIYNDELRDLLID 166
            N     I  S++EIYN+ L DLL D
Sbjct: 180 KNCQ---ITISYLEIYNERLHDLLCD 202

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 7   MENITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDAVYGE 66
           M  + V ++   P +E   S         DN+  T   +I   E+TG  + + +D V+  
Sbjct: 1   MVQVVVRIKPEPPSEEIAFSQYSIRDKTRDNDGATGTRIIFTSETTGNTE-FQVDKVFDR 59

Query: 67  QDDQKKLFDETVIPFYKS-FFDGYNVSIMSYGSRFSGKNYTLYG 109
              Q  L    ++    S  FDG+N SI+++G   +GK++T++G
Sbjct: 60  FTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFG 103

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 25/158 (15%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
           S+ I+NL+++ +   EE  + + +G  NR +            + RS+ +  I L +   
Sbjct: 236 SLEIENLRQVYVESFEELNSYLIEGRSNRNMK---------HLTSRSNIVIKINLEQVFL 286

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNTS------KNGAFNSNLQSFNKMINGMVNNST--YA 382
            +++ + S L  ++ A S+Y D N S      +    N  ++SF   IN +    T  Y 
Sbjct: 287 EDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTSPYD 346

Query: 383 SFLDSK--------LTQLLQNNFDGITRTLFIANIAPL 412
             ++ K        L  ++     G  +TLFI+ I+PL
Sbjct: 347 QQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPL 384

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 15/111 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           + LD ++       +++ E   P       GYN ++ +YG   SGK +T+ G        
Sbjct: 109 FRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSG-------- 160

Query: 118 NNAESENLGVVPRVLSRLFKDLES----NGNDHIIKCSFVEIYNDELRDLL 164
                E+ G++P  +S LF  +          + +  S++EIYN++L DLL
Sbjct: 161 ---TQEDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLL 208

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 82/187 (43%), Gaps = 32/187 (17%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            I +  L E   +  ++ M  ++ G KN++I+ T    + N  S RSHSI  + L   + 
Sbjct: 248 GIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISET----EYNSRSSRSHSILLVRLIATDL 303

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNNT--SKNGAF-NSNLQSFNKMINGM------------ 375
              +   S LS  + AGSE   +     K GAF N +L +   +I  +            
Sbjct: 304 ETGIVTTSTLSLCDLAGSEKATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNADN 363

Query: 376 VN-------NSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDA---TCSVLTM 425
           VN       N+++  + DSKLT++LQ    G +    I  I  +  + DA   T + L  
Sbjct: 364 VNHQETSNPNNSHIPYRDSKLTRILQPALSGNS---IITTICTVDIRSDASSETLNTLRF 420

Query: 426 ATKIKEI 432
           A++ K +
Sbjct: 421 ASRAKNV 427

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 12/91 (13%)

Query: 80  PFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDL 139
           P     F G+N +I +YG   SGK YT+ G     Q          G++P  +S LF  +
Sbjct: 159 PMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCPEREQKD--------GLIPLSVSYLFTKI 210

Query: 140 ES---NGNDHI-IKCSFVEIYNDELRDLLID 166
                +G+    I  S++EIYN+++ DLL D
Sbjct: 211 MEETLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 69/177 (38%), Gaps = 34/177 (19%)

Query: 286 EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345
           EE M  I KG K R+ A T    D N  S RSH+I  I L   +  +     S LS  + 
Sbjct: 295 EELMNWIIKGDKIRKTAET----DFNARSSRSHAIVLIRLTTSDMKDGTSISSTLSLCDL 350

Query: 346 AGSE--YGDNNTSKNGAF-NSNLQSFNKMINGMVNNS----------------------- 379
           AGSE   G     K GAF N +L +   +I+ +   S                       
Sbjct: 351 AGSERATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLPSPPLSSSSSSTSIN 410

Query: 380 ----TYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEI 432
                +  + DSKLT+LLQ    G +    I  I    +    T + L  A++ K I
Sbjct: 411 SSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLNTLRFASRAKNI 467

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +T D V+        +++ +  P       G+N ++ +YG   SGK +T+ G   E    
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTEDE---- 167

Query: 118 NNAESENLGVVPRVLSRLF-KDLE---SNGNDHIIKCSFVEIYNDELRDLL 164
                   G++P  ++ LF K LE      + + +  S++EIYN+++ DLL
Sbjct: 168 -------AGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLL 211

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 61/150 (40%), Gaps = 25/150 (16%)

Query: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330
            + I  L E      EE    I+ G KNR+ + T      N  S RSH+I  + L   + 
Sbjct: 250 GVRITGLTEKRCESSEELSRWIQIGDKNRKTSET----IYNTRSSRSHAIVLVRLNNTDL 305

Query: 331 VNEVFRMSKLSFVNFAGSEYGDNN--TSKNGAF-NSNLQSFNKMI----------NGM-- 375
            +     S LS  + AGSE   +     K GAF N +L +   +I          NG   
Sbjct: 306 RSGETVSSTLSLCDLAGSEKAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPPT 365

Query: 376 ------VNNSTYASFLDSKLTQLLQNNFDG 399
                    +T+  + DSKLT++LQ    G
Sbjct: 366 FTSTNPTEPNTHIPYRDSKLTRILQPALSG 395

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           Y  D+V+   +   +L++        + F+GY+  +++YGS  +GK+   YG  S  +  
Sbjct: 63  YQFDSVH---EKSTELYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 118 NNAESENLGVVPRVLSRLFKDLESNGND--HIIKCSFVEIYNDELRDLLID 166
                   GVV   +  L+  ++S GND    +  S +EI+ +++ DLL++
Sbjct: 119 --------GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLLVN 161

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%), Gaps = 3/41 (7%)

Query: 69  DQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYG 109
           D  K   E+V+   K  +DGY+VSI+SYG   SGK++TL+G
Sbjct: 101 DIHKSLSESVL---KDIYDGYDVSIISYGEAGSGKSFTLFG 138

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 61/156 (39%), Gaps = 28/156 (17%)

Query: 307 ASDKNEFSKRS--HSIFNITLYKEEEVNEVFRMSKLSFVNFAGS---------EYGDNNT 355
           AS+K   SKRS  H +   ++ + + V+     S + F +  GS         + G  N 
Sbjct: 235 ASEKKMDSKRSTSHVVIRCSVEQLDRVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENI 294

Query: 356 SKNGAFNSNLQSF-NKMINGMVNNSTY----------------ASFLDSKLTQLLQNNFD 398
            K     SNL+S  N ++     N  Y                  + DS+LT L+Q    
Sbjct: 295 KKLNLSISNLESVVNSVLQNQQKNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALG 354

Query: 399 GITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKN 434
           G +RT  + N    K   + T + L    +++ I N
Sbjct: 355 GNSRTRVVLNCFDDKSHHEETIATLRFGVQLQNILN 390

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 54/112 (48%), Gaps = 11/112 (9%)

Query: 54  RKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSE 113
            ++ ++LD V+     Q  +    + P   +   G NV + S G   +GK +T+ G+   
Sbjct: 40  HERTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV 99

Query: 114 LQNANNAESENLGVVPRVLSRLFKDL-ESNGNDHIIKCSFVEIYNDELRDLL 164
            Q          G++ R+L+++F+ + E+ G       S VE+ ND++ DLL
Sbjct: 100 SQ----------GLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLL 141

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 40  GTSNEVIVLDESTGR--KKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYG 97
           G SN V  ++++  +  ++ ++   V  +Q  + + F E           G N  + +YG
Sbjct: 70  GNSNHVQTVNDTVVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYG 129

Query: 98  SRFSGKNYTLYGEYSELQNANNAESENLGVVPRVLSRLFKDLESNG-NDHIIKCSFVEIY 156
           S  +  +  ++G  S         S   G++ +    +F  ++S+  +++ +  S  E+Y
Sbjct: 130 SGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVY 189

Query: 157 NDELRDLLI 165
            D++ DLL+
Sbjct: 190 VDKVFDLLV 198

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 73/187 (39%), Gaps = 49/187 (26%)

Query: 24  KHSGSPTIISIGDNEDGTSNEVIVLDEST-----GRKKIYTLDAVYGEQDDQKKLFDETV 78
           + S SP    +   ++GT   +I L+ S      G    Y  D ++  +    ++     
Sbjct: 22  RQSSSPIPYELNTIDNGT---IITLNSSVNQGSLGGSNQYRFDKIFEPEKPDDEINSTLS 78

Query: 79  IPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEY-----SELQNAN--------------- 118
                  F GYN + +SYG   +GK YTLYG       ++L + N               
Sbjct: 79  FACINDLFKGYNSTYISYGQTGTGKTYTLYGTAFNDTPTDLDSKNINTNKNVKNDSNISS 138

Query: 119 ----------------NAESENLGVVPRVLSRLFKDLES-----NGNDHIIKCSFVEIYN 157
                             + +N G++ +V + LF+ ++       G   ++  SFVE+Y 
Sbjct: 139 NSNIQTSASSNKSANSILQKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYK 198

Query: 158 DELRDLL 164
           +E+ DLL
Sbjct: 199 EEVYDLL 205

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 16/84 (19%)

Query: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117
           +  D ++    +Q ++   + I   K  FDGYN S ++YG   SGK+ TL+ E       
Sbjct: 69  FKFDNIFPTNSEQNEMLTVSTI---KDLFDGYNQSFITYGKSNSGKSDTLFNEKD----- 120

Query: 118 NNAESENLGVVPRVLSRLFKDLES 141
                   G++  +  +LFK ++S
Sbjct: 121 --------GLIRLLFEQLFKKVQS 136

>KLTH0G18480g Chr7 (1593284..1595611) [2328 bp, 775 aa] {ON} weakly
           similar to uniprot|Q7LGY1 Saccharomyces cerevisiae
           YLR057W Hypothetical ORF
          Length = 775

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 17/137 (12%)

Query: 346 AGSEYGDNNTSKNGAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLF 405
           AG+ Y  +  S++  F SN+  F +++NG    S      D K T+LL N+FD I   + 
Sbjct: 414 AGNFYSAD--SRSLPFYSNMAKFYQLLNGFDPTS------DLKFTRLLVNSFDRIKELMI 465

Query: 406 IANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSY 465
                P    L +   V +++T+             +T E +IKI+ +  +   S  L  
Sbjct: 466 FTPALP-NPDLKSLAFVNSLSTE--------SHYDALTNEKVIKIMPDFTMHQSSCALGS 516

Query: 466 KSNDNGIYMDEKHYSEL 482
                G   DE+ Y EL
Sbjct: 517 SFALMGKLFDEEKYIEL 533

>Kpol_534.3 s534 (8057..9091) [1035 bp, 344 aa] {ON} (8057..9091)
           [1035 nt, 345 aa]
          Length = 344

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 53/111 (47%), Gaps = 16/111 (14%)

Query: 471 GIYMDEKHYSELTKTLESYKEKIQNSKNSIN-ELTKKG---NEIRIEKRTFEEINERQRI 526
           G+Y   K Y  L   L   K K++  K  I  +L K     N I  E   F+   E    
Sbjct: 107 GVYEVTKRYV-LPNVLPESKTKLEQDKEEIKLQLEKVDSLLNAIEQEHNAFKSKEEE--- 162

Query: 527 KLQNLRETISNLNCALEKQSKR----ESELENIKIKLHSILGNMQKSVEKY 573
           K+  L  T+S L  AL++ SK     E ELENIK    S +G++Q +V+K+
Sbjct: 163 KMNELDHTMSQLQTALDETSKTRAKMEYELENIK----SQVGSLQSAVDKF 209

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
           similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 11/135 (8%)

Query: 435 EPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQ 494
           EP    +  K S IK+  +E++  K   L            E+  S+L K +ESYK++I+
Sbjct: 511 EPWTTKLEAKNSQIKLAESEILIIKESKLKL----------EQEISQLRKDIESYKDRIE 560

Query: 495 NSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELEN 554
           N K  IN+L K+   I     T +   +  + KL ++++ ++N    +       S +EN
Sbjct: 561 NHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVEN 620

Query: 555 IKIKLHSILGNMQKS 569
            K K+   L  +QKS
Sbjct: 621 -KNKVLGALCRLQKS 634

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,235,260
Number of extensions: 4313495
Number of successful extensions: 24115
Number of sequences better than 10.0: 1125
Number of HSP's gapped: 24157
Number of HSP's successfully gapped: 1763
Length of query: 982
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 863
Effective length of database: 39,836,145
Effective search space: 34378593135
Effective search space used: 34378593135
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)