Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002806.15ON27127111991e-168
NCAS0D026606.15ON2611857022e-92
KAFR0A050606.15ON2692036991e-91
Kpol_1045.746.15ON2572046892e-90
NDAI0I022506.15ON2712056868e-90
KNAG0F028806.15ON2691786851e-89
Suva_15.1796.15ON2592026796e-89
Skud_15.1656.15ON2572026692e-87
Smik_15.1736.15ON2512026649e-87
ACR011C6.15ON2532156632e-86
KLLA0D01023g6.15ON2682036633e-86
YOR004W (UTP23)6.15ON2542026614e-86
SAKL0E01056g6.15ON2691786591e-85
KLTH0C11352g6.15ON2682036511e-84
Kwal_56.223996.15ON2742096522e-84
ZYRO0C07920g6.15ON2932086532e-84
CAGL0E02673g6.15ON2631786408e-83
TDEL0G045406.15ON2452056126e-79
TBLA0A072906.15ON2591876112e-78
Ecym_30196.15ON2661816042e-77
Kwal_55.200895.392ON1891431416e-10
KLTH0E02860g5.392ON1891431417e-10
AEL102W5.392ON1891431312e-08
Ecym_74695.392ON1891451302e-08
SAKL0G07766g5.392ON1891451293e-08
NDAI0C045505.392ON1891431267e-08
TDEL0E023305.392ON1891461251e-07
Kpol_1055.185.392ON1891431241e-07
ZYRO0A06754g5.392ON1891481232e-07
TPHA0D023105.392ON1891371223e-07
Skud_4.6065.392ON1891461195e-07
YDR339C (FCF1)5.392ON1891461195e-07
Smik_4.5995.392ON1891461196e-07
Suva_2.5095.392ON1891461196e-07
NCAS0F030905.392ON1891431196e-07
KNAG0C052705.392ON1891431187e-07
KAFR0D042805.392ON1891451187e-07
KLLA0A07018g5.392ON1891411179e-07
CAGL0M01056g5.392ON1891451171e-06
TBLA0H017505.392ON1891451161e-06
KNAG0K012303.175ON122854711.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00280
         (271 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   466   e-168
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   275   2e-92
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   273   1e-91
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   270   2e-90
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   268   8e-90
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   268   1e-89
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   266   6e-89
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   262   2e-87
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   260   9e-87
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   259   2e-86
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   259   3e-86
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   259   4e-86
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   258   1e-85
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   255   1e-84
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   255   2e-84
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   256   2e-84
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   251   8e-83
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   240   6e-79
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   239   2e-78
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   237   2e-77
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    59   6e-10
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    59   7e-10
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    55   2e-08
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    55   2e-08
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    54   3e-08
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    53   7e-08
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    53   1e-07
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    52   1e-07
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    52   2e-07
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    52   3e-07
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    50   5e-07
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    50   5e-07
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    50   6e-07
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    50   6e-07
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    50   6e-07
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    50   7e-07
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    50   7e-07
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    50   9e-07
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    50   1e-06
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    49   1e-06
KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa] ...    32   1.8  

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  466 bits (1199), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/271 (84%), Positives = 230/271 (84%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 181 PTPKEGTPDTEGTQPAATKKRKGXXXXXXXXXXXXXXXXXXXXAATTTDAAXXXXXXXXX 240
           PTPKEGTPDTEGTQPAATKKRKG                    AATTTDAA         
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVKVEIPKPAATTTDAANKKRRRKHR 240

Query: 241 XXXXXXXXXXXXDPKETGNSEEQVPESQDAN 271
                       DPKETGNSEEQVPESQDAN
Sbjct: 241 SNKNSENGNEGEDPKETGNSEEQVPESQDAN 271

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  275 bits (702), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 125/185 (67%), Positives = 157/185 (84%), Gaps = 1/185 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VYNHTF+FREPYQILVD QIV D   SNY+L + L +TLQAE +KV
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAE-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY  ++Q  I+ A+RFERRRCNH+ KDPK P+ECIES+VNI+GQNKHRYVV
Sbjct: 60  MITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A Q++ +RRKLR+VPGVP++H+SR+VMIMEP+SD+S +++++ E  KLYKGLNDPKY+  
Sbjct: 120 AAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV 179

Query: 181 PTPKE 185
            T  E
Sbjct: 180 KTAAE 184

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  273 bits (699), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 166/203 (81%), Gaps = 1/203 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD +IV  S  SN++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T +Q  ID AK FERRRCNH  K+PK P+EC+ S+VN++G+NKHRYVV
Sbjct: 60  MITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q++++RR+LRRVPGVP++H+SRSVMIMEP+SD+S +++ + EQ KLYKGLNDPKY+  
Sbjct: 120 ASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGL 179

Query: 181 PTPKEGTPDTEGTQPAATKKRKG 203
              +E   +T+G+     KK++G
Sbjct: 180 KLDEEEATETQGSGEKTAKKKRG 202

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  270 bits (689), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 126/204 (61%), Positives = 165/204 (80%), Gaps = 6/204 (2%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQ+RAKSY+KQM+VYNHTFKFREPYQ +VD+Q+V D  +S +++ + L++TLQAE +KV
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T NQE I  AK FERRRCNH  KDPK PLECIESIV+I G NKHRYVV
Sbjct: 60  MITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q+M++RRKLR++PGVPI+H+SR+VMI+EP+SD+S++++ + E+ KLYKGLND K+   
Sbjct: 120 ASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKH--- 176

Query: 181 PTPKEGTPDTEGTQPAA-TKKRKG 203
            T     P +E ++  + +KK KG
Sbjct: 177 -TAGLDEPKSEKSEKTSESKKNKG 199

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  268 bits (686), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 163/205 (79%), Gaps = 3/205 (1%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VYNHTFKFR PYQ+LVD QIV D   SNY+L + L+ TLQ+E +KV
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSE-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY  +NQ+ I+ A+RFERRRCNH+ K+PK  +ECIES+VNI+GQNKHRYVV
Sbjct: 60  MITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS-- 178
           A+Q++  RRKLR+VPGVP++H+SR+VMIMEP+SD S +++R+ E  KLYKGLNDPK++  
Sbjct: 120 ASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGV 179

Query: 179 MAPTPKEGTPDTEGTQPAATKKRKG 203
            +   KE   + E T     K++ G
Sbjct: 180 KSAVDKETVKEKESTDQQKKKRKIG 204

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  268 bits (685), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 156/178 (87%), Gaps = 1/178 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VYNHTF+FREPYQ+++D++IV  + ES ++LY+ L++T+QAE +K+
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAE-VKL 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T+N++ ID AKR+ERRRCNH  KDPK P ECIES+V+I G+NKHRY+V
Sbjct: 60  MITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS 178
           A QN++LRRKLRRVPGVP++H+SR+VMIMEP+SD+S R++++ EQ KL+ GLND K +
Sbjct: 120 ACQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAA 177

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  266 bits (679), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 125/202 (61%), Positives = 157/202 (77%), Gaps = 6/202 (2%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN++L   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+VN++G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q+++LRRKLR VPGVP++HL+RSVMIMEP+S +S + +R  E+ KLYKGLNDP    A
Sbjct: 120 ASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKA 179

Query: 181 -----PTPKEGTPDTEGTQPAA 197
                 + KE TP      P A
Sbjct: 180 EAISKGSEKESTPKKRKAGPKA 201

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  262 bits (669), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 159/202 (78%), Gaps = 6/202 (2%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+V+++G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q++ LRRKLR VPGVP++HL+RSVMIMEP+S +S + ++K E+ KL+KGLNDP     
Sbjct: 120 ASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVE-- 177

Query: 181 PTPKEGTPDTEGTQPAATKKRK 202
              K     +E  + +A KKRK
Sbjct: 178 ---KTEKVSSESGKESAPKKRK 196

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  260 bits (664), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 158/202 (78%), Gaps = 6/202 (2%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQAD-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P +CIES+V+I+G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q++ LRRKLR VPGVP++HL+RSVM+MEP+S +S + ++  E+ KLYKGLNDP     
Sbjct: 120 ASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV 179

Query: 181 PTPKEGTPDTEGTQPAATKKRK 202
               EG+      + + TKKRK
Sbjct: 180 QEISEGS-----GKESVTKKRK 196

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  259 bits (663), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 171/215 (79%), Gaps = 15/215 (6%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAK+YKKQM+VYNHTFKFREPYQ+LVD+QIV ++ +S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQKLY T NQ+ I + K +ERRRCNH +K+PKEP+EC++S+V ++GQN+HRY+V
Sbjct: 60  MITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIV 118

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS-- 178
           A+Q++ +RR LR+VPGVP+++++R+VM+MEP+S +S +++R+ E+ KL+KGLNDPKY+  
Sbjct: 119 ASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI 178

Query: 179 ---MAPT---PKEGTP-----DTEGTQPAATKKRK 202
               AP    P EG P       +   P + KKRK
Sbjct: 179 AENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRK 213

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  259 bits (663), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 165/203 (81%), Gaps = 2/203 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQM+VYNHTFKFR+PYQ+LVD+Q+V ++F S+++  + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T+NQ  ID  K+FERRRCNH  K+PK  LEC+ S+V+++G+NKHRYVV
Sbjct: 60  MITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           ATQ++E+RR+LR++PGVP+++++RSVM+MEP+S++S +++R+ E+ KLYKGLNDPK++  
Sbjct: 120 ATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGI 179

Query: 181 PTPKEGTPDTEGTQPAATKKRKG 203
              +      E  Q    KKRKG
Sbjct: 180 ARDENDEAGAE-NQENKPKKRKG 201

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  259 bits (661), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 157/202 (77%), Gaps = 6/202 (2%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQAD-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+Q LY T N   I+ AK+FERRRCNHS KDPK P ECIES+VNI G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q+++LRRKLR VPGVP++HL+RSVM+MEP+S +S + ++  E+ KLYKGLNDP     
Sbjct: 120 ASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL 179

Query: 181 PTPKEGTPDTEGTQPAATKKRK 202
               +G+      + + TKKRK
Sbjct: 180 QESGDGS-----GKESITKKRK 196

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  258 bits (659), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 115/178 (64%), Positives = 155/178 (87%), Gaps = 1/178 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQM+VYNHTFKFREPYQ+LVD+QIV  +++S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T +Q  I+ AK +ERRRCNH  K+ K  LECIES+VN +G+NKHRYVV
Sbjct: 60  MITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS 178
           ATQ++++RRKLRRVPGVP+++++RSVM+MEP+S++S RL++  E+ KL+KGLNDPK++
Sbjct: 120 ATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHA 177

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  255 bits (651), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 117/203 (57%), Positives = 162/203 (79%), Gaps = 2/203 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQM+VYNH FKFREPYQ+LVD+QIV D+  ++++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+Q +Y T NQ+ I+ AK FERRRCNH  K+ K P+EC++S+V+++G NKHRYVV
Sbjct: 60  MITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q+  +R+KLR+VPGVP+++++RSVM+MEP+S +S   +R  E+ KL+KGLNDPKY+  
Sbjct: 120 ASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGL 179

Query: 181 PTPKEGTPDTEGTQPAATKKRKG 203
           P  +EG     GT+  +  KRKG
Sbjct: 180 PAEEEGGKTDNGTE-VSKNKRKG 201

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  255 bits (652), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 123/209 (58%), Positives = 162/209 (77%), Gaps = 8/209 (3%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQM+VYNH FKFREPYQ+LVD+QIV D+ ++ ++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+Q +Y T++QE I+ AK FERRRCNH  K+ K PLEC++S+VN++G NKHRYVV
Sbjct: 60  MITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           ATQN E+R  LR+VPGVP++ ++RSVM+MEP+S +S  ++R  E+ KL+KGLNDPK++  
Sbjct: 120 ATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179

Query: 181 P------TPKEGTPDTEGTQPAATKKRKG 203
           P      T    T D EG   A  KKRKG
Sbjct: 180 PLTEQPATATAATVDKEGAG-APAKKRKG 207

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  256 bits (653), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 126/208 (60%), Positives = 161/208 (77%), Gaps = 11/208 (5%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSYKKQM+VYN+ F+FREPYQ+L+D+Q+V D  +S+Y+L   L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T NQ+ I+  K FERRRCNH  K+ K P ECI+S+VN++G NKHRYVV
Sbjct: 60  MITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q++ LRRKLR+VPGVP++H+SRSVM+MEP+S++S R+N   E+ KL KGLNDPK +  
Sbjct: 120 ASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179

Query: 181 PTPKEGTPDTEG-----TQPAATKKRKG 203
            T    TP  E      +QP A KKRKG
Sbjct: 180 KT----TPSVENELESESQPPA-KKRKG 202

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  251 bits (640), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (82%), Gaps = 1/178 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAKSY+KQ++VYNHTFKFREPYQ+L+D+QIV DS  S Y+L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T N+  ID  K FERRRC H   +   P ECI ++V++ G+NKHRYVV
Sbjct: 60  MITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS 178
           A Q++E+RR LR+VPGVP+LH+SRSVMIMEP+SD+S +++R  E+SKL++GLNDPKY+
Sbjct: 120 ACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYA 177

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  240 bits (612), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 157/205 (76%), Gaps = 4/205 (1%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAK+Y+KQM+VYNHTFKFREPYQ+LVD QIV D   SN++L + L++TLQAE +KV
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAE-VKV 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCCMQ LY T+ Q  I+ AK FERRRCNH  K+PK P+EC+ESIV ++G NKHRYVV
Sbjct: 60  MITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVV 119

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           A+Q+++ RR LRR PGVP++H  RSVM+MEP+SD+S +++   E  KL+KGLNDP+ +  
Sbjct: 120 ASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGI 179

Query: 181 PTPKEGTPDTEGTQ---PAATKKRK 202
            T    T   + T+   P + KKRK
Sbjct: 180 KTENPQTSIKKRTKQPNPLSVKKRK 204

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  239 bits (611), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 142/187 (75%), Gaps = 1/187 (0%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAEN-IK 59
           MRQKRAKSYKKQ++VYNHTFKFREPYQ+++D+ +VQ++  + YNL + L   L + N IK
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 60  VMITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYV 119
            MITQCC+  LY + +QE I   K FERRRCNHS+K+P  P EC+ SIV+++G+NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 120 VATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSM 179
           VATQ++ELRRKLR++PGVP++H  RSVM+MEP+SD+S   N + E  KL  GLN  K S+
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180

Query: 180 APTPKEG 186
               + G
Sbjct: 181 EGGQENG 187

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  237 bits (604), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 155/181 (85%), Gaps = 2/181 (1%)

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60
           MRQKRAK+YKKQM+VYNHTFKFR+PYQ+LVD+Q+V ++ +S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAE-VKP 59

Query: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120
           MITQCC+QKLY + NQ  I +AK +ERRRCNH  K+PKEP ECI S+V+I+G+N HRYVV
Sbjct: 60  MITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVV 118

Query: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180
           ATQ++E+RR LRRVPGVP+++++RSVM+MEP+S +S +++++ E  KL KGLNDPKY+  
Sbjct: 119 ATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGT 178

Query: 181 P 181
           P
Sbjct: 179 P 179

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   +L R +  TL A+ I  +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIP-LITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIQRLSCSH------KGTYADDCLVNRVLQHKC-YIVATNDAALKQRI 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHAYVIEKLPD 187

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +  TL A+ I  MIT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIP-MITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIQRLTCSH------KGTYADDCLVNRVLQHKC-YIVATNDAGLKQRI 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHAYVIEKLPD 187

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   +L R +   L A+ +  +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVP-LITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLNCSH------KGTYADDCLVNRVLQHKC-YIVATNDAGLKQRI 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 71/145 (48%), Gaps = 18/145 (12%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+ +  +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVP-LITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRR 129
           +  I        R +R  C+H  +  D        + +VN   Q+K  Y+VAT +  L++
Sbjct: 112 KYRIALKLARDPRIKRLTCSHRGTYAD--------DCLVNRVLQHKC-YIVATNDAGLKQ 162

Query: 130 KLRRVPGVPILHLSRSVMIMEPISD 154
           ++R+VPG+P+L +     ++E + D
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPD 187

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 71/145 (48%), Gaps = 18/145 (12%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+ +  +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVP-LITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRR 129
           +  I        R +R  C+H  +  D        + +VN   Q+K  Y+VAT +  L++
Sbjct: 112 KYRIALRLARDPRIKRLNCSHKGTYAD--------DCLVNRVLQHKC-YIVATNDAALKQ 162

Query: 130 KLRRVPGVPILHLSRSVMIMEPISD 154
           ++R+VPG+P++ +     ++E + D
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPD 187

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   +L R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + IVN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKLPD 187

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%), Gaps = 18/146 (12%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   +L R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRR 129
           +  I        R +R  C H  +  D        + IVN   Q+K  Y+VAT +  L++
Sbjct: 112 KFRIALKLARDPRIKRLSCTHKGTYAD--------DCIVNRVLQHKC-YIVATNDAGLKQ 162

Query: 130 KLRRVPGVPILHLSRSVMIMEPISDS 155
           ++R++PG+P++ +      +E + D+
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ + +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + IVN   Q+K  Y+VAT ++ L++++
Sbjct: 112 KYRIALRLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDVGLKQRI 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 71/148 (47%), Gaps = 16/148 (10%)

Query: 14  VVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTT 73
           + + +    R PYQ+L+D   +  S +   ++ + +   L A+    +IT C M +L   
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK-CNPLITDCVMAELEKL 109

Query: 74  SNQELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMEL 127
             +  I        R +R  C H  +  D        + +VN   Q+K  Y+VAT +  L
Sbjct: 110 GPKYRIALKLARDPRIKRLSCTHKGTYAD--------DCLVNRVMQHKC-YIVATNDAPL 160

Query: 128 RRKLRRVPGVPILHLSRSVMIMEPISDS 155
           ++++R++PG+P++ +     ++E + D+
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 12/137 (8%)

Query: 22  FREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSNQELID- 80
            R PYQ+L+D   +  S +   ++ + +   L A+    +IT C M +L     +  I  
Sbjct: 59  IRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAK-CNPLITDCVMAELEKLGPKYRIAL 117

Query: 81  ---EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKLRRVPGV 137
                 R +R  C+H      +     + IVN   Q+K  Y+VAT +  L++++R++PG+
Sbjct: 118 RLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDQGLKQRVRKIPGI 170

Query: 138 PILHLSRSVMIMEPISD 154
           P++ +     ++E + D
Sbjct: 171 PLMSVGGHAYVIEKLPD 187

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 20/146 (13%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELIDEAKRFERRRCNHSIKDPK-EPLECIESIVNIDGQNKHR------YVVATQNMELR 128
           +  I  A +  R        DP+ + L C       D    HR      Y+VAT +  L+
Sbjct: 112 KYRI--ALKLAR--------DPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLK 161

Query: 129 RKLRRVPGVPILHLSRSVMIMEPISD 154
           +++R++PG+P++ +     ++E + D
Sbjct: 162 QRIRKIPGIPLMSVGGHAYVIEKLPD 187

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 20/146 (13%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELIDEAKRFERRRCNHSIKDPK-EPLECIESIVNIDGQNKHR------YVVATQNMELR 128
           +  I  A +  R        DP+ + L C       D    HR      Y+VAT +  L+
Sbjct: 112 KYRI--ALKLAR--------DPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLK 161

Query: 129 RKLRRVPGVPILHLSRSVMIMEPISD 154
           +++R++PG+P++ +     ++E + D
Sbjct: 162 QRIRKIPGIPLMSVGGHAYVIEKLPD 187

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 20/146 (13%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELIDEAKRFERRRCNHSIKDPK-EPLECIESIVNIDGQNKHR------YVVATQNMELR 128
           +  I  A +  R        DP+ + L C       D    HR      Y+VAT +  L+
Sbjct: 112 KYRI--ALKLAR--------DPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLK 161

Query: 129 RKLRRVPGVPILHLSRSVMIMEPISD 154
           +++R++PG+P++ +     ++E + D
Sbjct: 162 QRIRKIPGIPLMSVGGHAYVIEKLPD 187

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 20/146 (13%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELIDEAKRFERRRCNHSIKDPK-EPLECIESIVNIDGQNKHR------YVVATQNMELR 128
           +  I  A +  R        DP+ + L C       D    HR      Y+VAT +  L+
Sbjct: 112 KYRI--ALKLAR--------DPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLK 161

Query: 129 RKLRRVPGVPILHLSRSVMIMEPISD 154
           +++R++PG+P++ +     ++E + D
Sbjct: 162 QRIRKIPGIPLMSVGGHAYVIEKLPD 187

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   +L + +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + IVN   Q+K  ++VAT +  L++++
Sbjct: 112 KYRIALRLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-FIVATNDAGLKQRV 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKLPD 187

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 14/143 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK-CNPLITDCVIAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCLVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 132 RRVPGVPILHLSRSVMIMEPISD 154
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 70/145 (48%), Gaps = 18/145 (12%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK-CNPLITDCVIAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRR 129
           +  I        R +R  C+H  +  D        + IVN   Q+K  Y+VAT +  L++
Sbjct: 112 KYRIALKLARDPRIKRLSCSHKGTYAD--------DCIVNRVLQHKC-YIVATNDAGLKQ 162

Query: 130 KLRRVPGVPILHLSRSVMIMEPISD 154
           ++R++PG+P++ +     ++E + D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPD 187

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 69/141 (48%), Gaps = 14/141 (9%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ + +   L A+   ++IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK-CNILITDCVMAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 131
           +  I        R +R  C+H      +     + IV+   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCIVHRVLQHKC-YIVATNDAGLKQRV 164

Query: 132 RRVPGVPILHLSRSVMIMEPI 152
           R+VPG+P++ +     ++E +
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 69/145 (47%), Gaps = 18/145 (12%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ + +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK-CNPLITDCVIAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRR 129
           +  I        R +R  C H  +  D        + IVN   Q+K  Y+VAT +  L++
Sbjct: 112 KYRIALKLARDPRIKRLTCTHKGTYAD--------DCIVNRVLQHKC-YIVATNDAGLKQ 162

Query: 130 KLRRVPGVPILHLSRSVMIMEPISD 154
           ++R++PG+P++ +     ++E + D
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPD 187

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 70/145 (48%), Gaps = 18/145 (12%)

Query: 16  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 75
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK-CNPLITDCVVAELEKLGP 111

Query: 76  QELID----EAKRFERRRCNH--SIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRR 129
           +  I        R +R  C+H  +  D        + IVN   Q+K  Y+VAT +  L++
Sbjct: 112 KFRIALKLARDPRIKRLSCSHRGTYAD--------DCIVNRVLQHKC-YIVATNDAGLKQ 162

Query: 130 KLRRVPGVPILHLSRSVMIMEPISD 154
           ++R++PG+P++ +     ++E + D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPD 187

>KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa]
           {ON} Anc_3.175 YAR042W
          Length = 1228

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 8   SYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVM 61
           S+K  M+  + T  F E  ++L DE + + +  SN +++  + KTL   N   M
Sbjct: 576 SHKVHMIKRSITIDFTELIELLSDESLAKQNLSSNRDIWNTVGKTLTDMNTNFM 629

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,371,015
Number of extensions: 922654
Number of successful extensions: 2241
Number of sequences better than 10.0: 49
Number of HSP's gapped: 2271
Number of HSP's successfully gapped: 49
Length of query: 271
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 163
Effective length of database: 41,097,471
Effective search space: 6698887773
Effective search space used: 6698887773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)