Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002806.15ON27127111521e-160
NCAS0D026606.15ON2612146832e-89
KAFR0A050606.15ON2692036824e-89
NDAI0I022506.15ON2712056661e-86
Kpol_1045.746.15ON2572046632e-86
KNAG0F028806.15ON2692026642e-86
Suva_15.1796.15ON2592126572e-85
KLLA0D01023g6.15ON2682036503e-84
Skud_15.1656.15ON2572026475e-84
Smik_15.1736.15ON2512026422e-83
YOR004W (UTP23)6.15ON2542026414e-83
ACR011C6.15ON2532156398e-83
ZYRO0C07920g6.15ON2932036411e-82
KLTH0C11352g6.15ON2682036363e-82
SAKL0E01056g6.15ON2691786355e-82
Kwal_56.223996.15ON2742096303e-81
TDEL0G045406.15ON2452056265e-81
CAGL0E02673g6.15ON2632026251e-80
Ecym_30196.15ON2662026216e-80
TBLA0A072906.15ON2592046033e-77
Kwal_55.200895.392ON1891431391e-09
KLTH0E02860g5.392ON1891431391e-09
AEL102W5.392ON1891431293e-08
SAKL0G07766g5.392ON1891431284e-08
Ecym_74695.392ON1891431276e-08
NDAI0C045505.392ON1891431268e-08
Kpol_1055.185.392ON1891431251e-07
TPHA0D023105.392ON1891361241e-07
TDEL0E023305.392ON1891441232e-07
ZYRO0A06754g5.392ON1891441223e-07
KNAG0C052705.392ON1891431205e-07
KAFR0D042805.392ON1891431205e-07
Suva_2.5095.392ON1891431205e-07
Skud_4.6065.392ON1891431205e-07
Smik_4.5995.392ON1891431205e-07
YDR339C (FCF1)5.392ON1891431205e-07
NCAS0F030905.392ON1891431197e-07
TBLA0H017505.392ON1891431189e-07
CAGL0M01056g5.392ON1891431189e-07
KLLA0A07018g5.392ON1891411171e-06
Kwal_56.22400singletonOFF5149941e-04
Suva_5.3128.242ON1138116750.70
Skud_5.1937.264ON89957731.2
NDAI0A007501.144ON215066702.9
NDAI0F018106.111ON529157684.5
KLTH0A01342g3.61ON1614100685.1
Kwal_26.86578.640ON213101665.5
NCAS0A041602.419ON60784668.0
Kwal_26.94645.24ON28329658.6
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TPHA0J00280
         (816 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   448   e-160
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   267   2e-89
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   267   4e-89
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   261   1e-86
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   259   2e-86
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   260   2e-86
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   257   2e-85
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   254   3e-84
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   253   5e-84
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   251   2e-83
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   251   4e-83
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   250   8e-83
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   251   1e-82
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   249   3e-82
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   249   5e-82
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   247   3e-81
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   245   5e-81
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   245   1e-80
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   243   6e-80
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   236   3e-77
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    58   1e-09
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    58   1e-09
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    54   3e-08
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    54   4e-08
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    54   6e-08
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    53   8e-08
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    53   1e-07
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    52   1e-07
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    52   2e-07
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    52   3e-07
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    51   5e-07
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    51   5e-07
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    51   5e-07
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    51   5e-07
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    51   5e-07
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    51   5e-07
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    50   7e-07
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    50   9e-07
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    50   9e-07
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    50   1e-06
Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OF...    41   1e-04
Suva_5.312 Chr5 (510077..513493) [3417 bp, 1138 aa] {ON} YER176W...    33   0.70 
Skud_5.193 Chr5 complement(303675..306374) [2700 bp, 899 aa] {ON...    33   1.2  
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    32   2.9  
NDAI0F01810 Chr6 complement(442182..443771) [1590 bp, 529 aa] {O...    31   4.5  
KLTH0A01342g Chr1 complement(121198..126042) [4845 bp, 1614 aa] ...    31   5.1  
Kwal_26.8657 s26 (886675..887316) [642 bp, 213 aa] {ON} YOR220W ...    30   5.5  
NCAS0A04160 Chr1 complement(844321..846144) [1824 bp, 607 aa] {O...    30   8.0  
Kwal_26.9464 s26 (1229849..1230700) [852 bp, 283 aa] {ON} YGR275...    30   8.6  

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  448 bits (1152), Expect = e-160
 Identities = 230/271 (84%), Positives = 230/271 (84%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 541 PTPKEGTPDTEGTQPAATKKRKGXXXXXXXXXXXXXXXXXXXXAATTTDAAXXXXXXXXX 720
           PTPKEGTPDTEGTQPAATKKRKG                    AATTTDAA         
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVKVEIPKPAATTTDAANKKRRRKHR 240

Query: 721 XXXXXXXXXXXXDPKETGNSEEQVPESQDAN 813
                       DPKETGNSEEQVPESQDAN
Sbjct: 241 SNKNSENGNEGEDPKETGNSEEQVPESQDAN 271

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  267 bits (683), Expect = 2e-89
 Identities = 130/214 (60%), Positives = 166/214 (77%), Gaps = 12/214 (5%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VYNHTF+FREPYQILVD QIV D   SNY+L + L +TLQAE +KV
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAE-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY  ++Q  I+ A+RFERRRCNH+ KDPK P+ECIES+VNI+GQNKHRYVV
Sbjct: 60  MITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A Q++ +RRKLR+VPGVP++H+SR+VMIMEP+SD+S +++++ E  KLYKGLNDPKY+  
Sbjct: 120 AAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV 179

Query: 541 ------------PTPKEGTPDTEGTQPAATKKRK 606
                       P PK+     +   P + KK+K
Sbjct: 180 KTAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKK 213

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  267 bits (682), Expect = 4e-89
 Identities = 124/203 (61%), Positives = 166/203 (81%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD +IV  S  SN++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T +Q  ID AK FERRRCNH  K+PK P+EC+ S+VN++G+NKHRYVV
Sbjct: 60  MITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q++++RR+LRRVPGVP++H+SRSVMIMEP+SD+S +++ + EQ KLYKGLNDPKY+  
Sbjct: 120 ASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGL 179

Query: 541 PTPKEGTPDTEGTQPAATKKRKG 609
              +E   +T+G+     KK++G
Sbjct: 180 KLDEEEATETQGSGEKTAKKKRG 202

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  261 bits (666), Expect = 1e-86
 Identities = 126/205 (61%), Positives = 163/205 (79%), Gaps = 2/205 (0%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VYNHTFKFR PYQ+LVD QIV D   SNY+L + L+ TLQ+E +KV
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSE-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY  +NQ+ I+ A+RFERRRCNH+ K+PK  +ECIES+VNI+GQNKHRYVV
Sbjct: 60  MITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS-- 534
           A+Q++  RRKLR+VPGVP++H+SR+VMIMEP+SD S +++R+ E  KLYKGLNDPK++  
Sbjct: 120 ASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGV 179

Query: 535 MAPTPKEGTPDTEGTQPAATKKRKG 609
            +   KE   + E T     K++ G
Sbjct: 180 KSAVDKETVKEKESTDQQKKKRKIG 204

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  259 bits (663), Expect = 2e-86
 Identities = 126/204 (61%), Positives = 165/204 (80%), Gaps = 1/204 (0%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQ+RAKSY+KQM+VYNHTFKFREPYQ +VD+Q+V D  +S +++ + L++TLQAE +KV
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T NQE I  AK FERRRCNH  KDPK PLECIESIV+I G NKHRYVV
Sbjct: 60  MITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q+M++RRKLR++PGVPI+H+SR+VMI+EP+SD+S++++ + E+ KLYKGLND K+   
Sbjct: 120 ASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKH--- 176

Query: 541 PTPKEGTPDTEGTQPAA-TKKRKG 609
            T     P +E ++  + +KK KG
Sbjct: 177 -TAGLDEPKSEKSEKTSESKKNKG 199

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  260 bits (664), Expect = 2e-86
 Identities = 119/202 (58%), Positives = 164/202 (81%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VYNHTF+FREPYQ+++D++IV  + ES ++LY+ L++T+QAE +K+
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAE-VKL 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T+N++ ID AKR+ERRRCNH  KDPK P ECIES+V+I G+NKHRY+V
Sbjct: 60  MITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A QN++LRRKLRRVPGVP++H+SR+VMIMEP+SD+S R++++ EQ KL+ GLND K +  
Sbjct: 120 ACQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGI 179

Query: 541 PTPKEGTPDTEGTQPAATKKRK 606
              +    + +G +    K +K
Sbjct: 180 KAAETEKVEDKGKEAPEAKPKK 201

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  257 bits (657), Expect = 2e-85
 Identities = 126/212 (59%), Positives = 161/212 (75%), Gaps = 10/212 (4%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN++L   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+VN++G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q+++LRRKLR VPGVP++HL+RSVMIMEP+S +S + +R  E+ KLYKGLNDP    A
Sbjct: 120 ASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKA 179

Query: 541 ----------PTPKEGTPDTEGTQPAATKKRK 606
                      TPK+     +   P + KK+K
Sbjct: 180 EAISKGSEKESTPKKRKAGPKAPNPLSMKKKK 211

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  254 bits (650), Expect = 3e-84
 Identities = 118/203 (58%), Positives = 165/203 (81%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQM+VYNHTFKFR+PYQ+LVD+Q+V ++F S+++  + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T+NQ  ID  K+FERRRCNH  K+PK  LEC+ S+V+++G+NKHRYVV
Sbjct: 60  MITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           ATQ++E+RR+LR++PGVP+++++RSVM+MEP+S++S +++R+ E+ KLYKGLNDPK++  
Sbjct: 120 ATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGI 179

Query: 541 PTPKEGTPDTEGTQPAATKKRKG 609
              +      E  Q    KKRKG
Sbjct: 180 ARDENDEAGAE-NQENKPKKRKG 201

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  253 bits (647), Expect = 5e-84
 Identities = 124/202 (61%), Positives = 159/202 (78%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+V+++G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q++ LRRKLR VPGVP++HL+RSVMIMEP+S +S + ++K E+ KL+KGLNDP     
Sbjct: 120 ASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPN---- 175

Query: 541 PTPKEGTPDTEGTQPAATKKRK 606
              K     +E  + +A KKRK
Sbjct: 176 -VEKTEKVSSESGKESAPKKRK 196

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  251 bits (642), Expect = 2e-83
 Identities = 123/202 (60%), Positives = 158/202 (78%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQAD-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P +CIES+V+I+G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q++ LRRKLR VPGVP++HL+RSVM+MEP+S +S + ++  E+ KLYKGLNDP     
Sbjct: 120 ASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV 179

Query: 541 PTPKEGTPDTEGTQPAATKKRK 606
               EG+      + + TKKRK
Sbjct: 180 QEISEGS-----GKESVTKKRK 196

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  251 bits (641), Expect = 4e-83
 Identities = 123/202 (60%), Positives = 157/202 (77%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQAD-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+Q LY T N   I+ AK+FERRRCNHS KDPK P ECIES+VNI G NKHRYVV
Sbjct: 60  MITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q+++LRRKLR VPGVP++HL+RSVM+MEP+S +S + ++  E+ KLYKGLNDP     
Sbjct: 120 ASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL 179

Query: 541 PTPKEGTPDTEGTQPAATKKRK 606
               +G+      + + TKKRK
Sbjct: 180 QESGDGS-----GKESITKKRK 196

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  250 bits (639), Expect = 8e-83
 Identities = 121/215 (56%), Positives = 171/215 (79%), Gaps = 13/215 (6%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAK+YKKQM+VYNHTFKFREPYQ+LVD+QIV ++ +S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQKLY T NQ+ I + K +ERRRCNH +K+PKEP+EC++S+V ++GQN+HRY+V
Sbjct: 60  MITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIV 118

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKY--- 531
           A+Q++ +RR LR+VPGVP+++++R+VM+MEP+S +S +++R+ E+ KL+KGLNDPKY   
Sbjct: 119 ASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI 178

Query: 532 --SMAPT---PKEGTP-----DTEGTQPAATKKRK 606
             + AP    P EG P       +   P + KKRK
Sbjct: 179 AENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRK 213

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  251 bits (641), Expect = 1e-82
 Identities = 121/203 (59%), Positives = 156/203 (76%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSYKKQM+VYN+ F+FREPYQ+L+D+Q+V D  +S+Y+L   L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T NQ+ I+  K FERRRCNH  K+ K P ECI+S+VN++G NKHRYVV
Sbjct: 60  MITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q++ LRRKLR+VPGVP++H+SRSVM+MEP+S++S R+N   E+ KL KGLNDPK +  
Sbjct: 120 ASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179

Query: 541 PTPKEGTPDTEGTQPAATKKRKG 609
            T      + E       KKRKG
Sbjct: 180 KTTPSVENELESESQPPAKKRKG 202

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  249 bits (636), Expect = 3e-82
 Identities = 117/203 (57%), Positives = 162/203 (79%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQM+VYNH FKFREPYQ+LVD+QIV D+  ++++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+Q +Y T NQ+ I+ AK FERRRCNH  K+ K P+EC++S+V+++G NKHRYVV
Sbjct: 60  MITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q+  +R+KLR+VPGVP+++++RSVM+MEP+S +S   +R  E+ KL+KGLNDPKY+  
Sbjct: 120 ASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGL 179

Query: 541 PTPKEGTPDTEGTQPAATKKRKG 609
           P  +EG     GT+  +  KRKG
Sbjct: 180 PAEEEGGKTDNGTE-VSKNKRKG 201

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  249 bits (635), Expect = 5e-82
 Identities = 115/178 (64%), Positives = 155/178 (87%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQM+VYNHTFKFREPYQ+LVD+QIV  +++S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T +Q  I+ AK +ERRRCNH  K+ K  LECIES+VN +G+NKHRYVV
Sbjct: 60  MITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS 534
           ATQ++++RRKLRRVPGVP+++++RSVM+MEP+S++S RL++  E+ KL+KGLNDPK++
Sbjct: 120 ATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHA 177

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  247 bits (630), Expect = 3e-81
 Identities = 123/209 (58%), Positives = 162/209 (77%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQM+VYNH FKFREPYQ+LVD+QIV D+ ++ ++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+Q +Y T++QE I+ AK FERRRCNH  K+ K PLEC++S+VN++G NKHRYVV
Sbjct: 60  MITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           ATQN E+R  LR+VPGVP++ ++RSVM+MEP+S +S  ++R  E+ KL+KGLNDPK++  
Sbjct: 120 ATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179

Query: 541 P------TPKEGTPDTEGTQPAATKKRKG 609
           P      T    T D EG   A  KKRKG
Sbjct: 180 PLTEQPATATAATVDKEGA-GAPAKKRKG 207

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  245 bits (626), Expect = 5e-81
 Identities = 122/205 (59%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAK+Y+KQM+VYNHTFKFREPYQ+LVD QIV D   SN++L + L++TLQAE +KV
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAE-VKV 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T+ Q  I+ AK FERRRCNH  K+PK P+EC+ESIV ++G NKHRYVV
Sbjct: 60  MITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A+Q+++ RR LRR PGVP++H  RSVM+MEP+SD+S +++   E  KL+KGLNDP+ +  
Sbjct: 120 ASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGI 179

Query: 541 PTPKEGT---PDTEGTQPAATKKRK 606
            T    T     T+   P + KKRK
Sbjct: 180 KTENPQTSIKKRTKQPNPLSVKKRK 204

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  245 bits (625), Expect = 1e-80
 Identities = 120/202 (59%), Positives = 155/202 (76%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAKSY+KQ++VYNHTFKFREPYQ+L+D+QIV DS  S Y+L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCCMQ LY T N+  ID  K FERRRC H   +   P ECI ++V++ G+NKHRYVV
Sbjct: 60  MITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVV 119

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           A Q++E+RR LR+VPGVP+LH+SRSVMIMEP+SD+S +++R  E+SKL++GLNDPKY  A
Sbjct: 120 ACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKY--A 177

Query: 541 PTPKEGTPDTEGTQPAATKKRK 606
               E   + +  +    KKRK
Sbjct: 178 GLKGEHEEEEQSKEQTVAKKRK 199

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  243 bits (621), Expect = 6e-80
 Identities = 118/202 (58%), Positives = 161/202 (79%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
           MRQKRAK+YKKQM+VYNHTFKFR+PYQ+LVD+Q+V ++ +S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAE-VKP 59

Query: 181 MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 360
           MITQCC+QKLY + NQ  I +AK +ERRRCNH  K+PKEP ECI S+V+I+G+N HRYVV
Sbjct: 60  MITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVV 118

Query: 361 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 540
           ATQ++E+RR LRRVPGVP+++++RSVM+MEP+S +S +++++ E  KL KGLNDPKY+  
Sbjct: 119 ATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGT 178

Query: 541 PTPKEGTPDTEGTQPAATKKRK 606
           P   E       +  A   KRK
Sbjct: 179 PNNTEDASVDPKSPDANQLKRK 200

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  236 bits (603), Expect = 3e-77
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 3/204 (1%)
 Frame = +1

Query: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAEN-IK 177
           MRQKRAKSYKKQ++VYNHTFKFREPYQ+++D+ +VQ++  + YNL + L   L + N IK
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 178 VMITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYV 357
            MITQCC+  LY + +QE I   K FERRRCNHS+K+P  P EC+ SIV+++G+NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 358 VATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSM 537
           VATQ++ELRRKLR++PGVP++H  RSVM+MEP+SD+S   N + E  KL  GLN  K S+
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180

Query: 538 APTPKEG--TPDTEGTQPAATKKR 603
               + G      +G  P + KK+
Sbjct: 181 EGGQENGIKKKKVKGVNPLSMKKK 204

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   +L R +  TL A+ I  +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIP-LITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIQRLSCSH------KGTYADDCLVNRVLQHKC-YIVATNDAALKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHAYVIEKLPD 187

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +  TL A+ I  MIT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIP-MITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIQRLTCSH------KGTYADDCLVNRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHAYVIEKLPD 187

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   +L R +   L A+ +  +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVP-LITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLNCSH------KGTYADDCLVNRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 53.9 bits (128), Expect = 4e-08
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+ +  +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVP-LITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALRLARDPRIKRLNCSH------KGTYADDCLVNRVLQHKC-YIVATNDAALKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 53.5 bits (127), Expect = 6e-08
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+ +  +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVP-LITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H            + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLTCSH------RGTYADDCLVNRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R+VPG+P+L +     ++E + D
Sbjct: 165 RKVPGIPLLSVGGHSYVIEKLPD 187

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 53.1 bits (126), Expect = 8e-08
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   +L R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + IVN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKLPD 187

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 52.8 bits (125), Expect = 1e-07
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ + +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + IVN   Q+K  Y+VAT ++ L++++
Sbjct: 112 KYRIALRLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDVGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R+VPG+P++ +     ++E + D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 52.4 bits (124), Expect = 1e-07
 Identities = 35/136 (25%), Positives = 67/136 (49%), Gaps = 4/136 (2%)
 Frame = +1

Query: 67  REPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSNQELID-- 240
           R PYQ+L+D   +  S +   ++ + +   L A+    +IT C M +L     +  I   
Sbjct: 60  RPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAK-CNPLITDCVMAELEKLGPKYRIALR 118

Query: 241 --EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKLRRVPGVP 414
                R +R  C+H      +     + IVN   Q+K  Y+VAT +  L++++R++PG+P
Sbjct: 119 LARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDQGLKQRVRKIPGIP 171

Query: 415 ILHLSRSVMIMEPISD 462
           ++ +     ++E + D
Sbjct: 172 LMSVGGHAYVIEKLPD 187

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.0 bits (123), Expect = 2e-07
 Identities = 39/144 (27%), Positives = 68/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   +L R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C H      +     + IVN   Q+K  Y+VAT +  L++++
Sbjct: 112 KFRIALKLARDPRIKRLSCTH------KGTYADDCIVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISDS 465
           R++PG+P++ +      +E + D+
Sbjct: 165 RKIPGIPLMSVGGHAYAIEKLPDA 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 51.6 bits (122), Expect = 3e-07
 Identities = 34/144 (23%), Positives = 69/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           + +    R PYQ+L+D   +  S +   ++ + +   L A+    +IT C M +L     
Sbjct: 53  FQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCTH------KGTYADDCLVNRVMQHKC-YIVATNDAPLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISDS 465
           R++PG+P++ +     ++E + D+
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKLPDA 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK-CNPLITDCVIAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +VN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCLVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK-CNPLITDCVIAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + IVN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKLPD 187

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +V+   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCLVHRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +V+   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCLVHRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +V+   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCLVHRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 50.8 bits (120), Expect = 5e-07
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C M +L     
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + +V+   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCLVHRVLQHKC-YIVATNDAGLKQRI 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 50.4 bits (119), Expect = 7e-07
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   +L + +   L A+    +IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAK-CNPLITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + IVN   Q+K  ++VAT +  L++++
Sbjct: 112 KYRIALRLARDPRIKRLSCSH------KGTYADDCIVNRVLQHKC-FIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKLPD 187

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.1 bits (118), Expect = 9e-07
 Identities = 37/143 (25%), Positives = 68/143 (47%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ R +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK-CNPLITDCVVAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H            + IVN   Q+K  Y+VAT +  L++++
Sbjct: 112 KFRIALKLARDPRIKRLSCSH------RGTYADDCIVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHSYVVEKLPD 187

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 50.1 bits (118), Expect = 9e-07
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 4/143 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ + +   L A+    +IT C + +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK-CNPLITDCVIAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C H      +     + IVN   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLTCTH------KGTYADDCIVNRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPISD 462
           R++PG+P++ +     ++E + D
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKLPD 187

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 49.7 bits (117), Expect = 1e-06
 Identities = 36/141 (25%), Positives = 69/141 (48%), Gaps = 4/141 (2%)
 Frame = +1

Query: 46  YNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSN 225
           YN   K   PYQ+L+D   +  S +   ++ + +   L A+   ++IT C M +L     
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK-CNILITDCVMAELEKLGP 111

Query: 226 QELID----EAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKL 393
           +  I        R +R  C+H      +     + IV+   Q+K  Y+VAT +  L++++
Sbjct: 112 KYRIALKLARDPRIKRLSCSH------KGTYADDCIVHRVLQHKC-YIVATNDAGLKQRV 164

Query: 394 RRVPGVPILHLSRSVMIMEPI 456
           R+VPG+P++ +     ++E +
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OFF}
           [contig 185] FULL
          Length = 51

 Score = 40.8 bits (94), Expect = 1e-04
 Identities = 27/49 (55%), Positives = 30/49 (61%)
 Frame = -2

Query: 200 MQHCVIITLIFSACSVFRKFL*RL*FDSNES*TICSSTRIWYGSLNLKV 54
           MQHCVI+ L  SAC V  +   R       S TI SSTR WYGSLNLK+
Sbjct: 4   MQHCVIMGLT-SACRVRLRPFTRSNAALCVSHTIWSSTRTWYGSLNLKL 51

>Suva_5.312 Chr5 (510077..513493) [3417 bp, 1138 aa] {ON} YER176W
           (REAL)
          Length = 1138

 Score = 33.5 bits (75), Expect = 0.70
 Identities = 27/116 (23%), Positives = 44/116 (37%)
 Frame = +1

Query: 67  REPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQKLYTTSNQELIDEA 246
           R  YQ+  +  I+Q S  S+   ++  +      NI +        K  T  N       
Sbjct: 196 RIAYQVKKENSIIQSSSNSSLRNFKGFKAVESDPNIAISFNPTKANKSETKKNSSGSSNG 255

Query: 247 KRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNMELRRKLRRVPGVP 414
           K+ +  R N + K  KE        VN   +NK R      N E+ R + ++  +P
Sbjct: 256 KKVKENRTNMNKKSEKE--------VNKGKENKSRNKKNNVN-EVNRDIYQIKAIP 302

>Skud_5.193 Chr5 complement(303675..306374) [2700 bp, 899 aa] {ON}
           YER075C (REAL)
          Length = 899

 Score = 32.7 bits (73), Expect = 1.2
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +1

Query: 136 YRNLRKTLQAENIKVMITQCCMQKLYTTSNQELIDEAKR---FERRRCNHSIKDPKE 297
           Y NLRKT   E+I  +I +   Q L T    EL+ + ++    E+RR NHS+   K+
Sbjct: 396 YENLRKTYGQEDIDSVIPE-WFQHLMTIPKIELVSQFQKLDFLEKRRLNHSVSFRKK 451

>NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {ON}
            Anc_1.144 YCR032W
          Length = 2150

 Score = 31.6 bits (70), Expect = 2.9
 Identities = 16/66 (24%), Positives = 28/66 (42%)
 Frame = +1

Query: 1    MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 180
            + +K +   K Q    + +F     Y +L+D  +    F+ N +  RN+ K L   +   
Sbjct: 1307 VEKKASSDLKNQTTRTSRSFSDAGSYDLLLDMDLTDPEFQDNMDENRNILKLLNETDSIK 1366

Query: 181  MITQCC 198
             I  CC
Sbjct: 1367 QIWNCC 1372

>NDAI0F01810 Chr6 complement(442182..443771) [1590 bp, 529 aa] {ON}
           Anc_6.111 YBR215W
          Length = 529

 Score = 30.8 bits (68), Expect = 4.5
 Identities = 36/157 (22%), Positives = 53/157 (33%), Gaps = 22/157 (14%)
 Frame = +1

Query: 199 MQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVVATQNME 378
           M K   T  +EL    K  +R+  N    +PK   +   ++   D  N  R     Q + 
Sbjct: 13  MAKSVYTKREELATTGKTLKRKAINTENSNPKREKKASATLTTGD-INARRIPNIAQELA 71

Query: 379 LRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSK------------------- 501
             R            +  S   + P SDS++     F  S                    
Sbjct: 72  KNRNF----------VKTSSPSLSPSSDSNITTASSFSTSAQTILSNIVPKNEDQGQESN 121

Query: 502 ---LYKGLNDPKYSMAPTPKEGTPDTEGTQPAATKKR 603
                K  + PK  + P PKEG P TE ++P  T K+
Sbjct: 122 VKPTVKQRSKPK--VKPKPKEGQPSTETSKPKTTIKK 156

>KLTH0A01342g Chr1 complement(121198..126042) [4845 bp, 1614 aa] {ON}
            similar to uniprot|P48563 Saccharomyces cerevisiae
            YNL297C MON2 Peripheral membrane protein with a role in
            endocytosis and vacuole integrity interacts with Arl1p
            and localizes to the endosome member of the Sec7p family
            of proteins
          Length = 1614

 Score = 30.8 bits (68), Expect = 5.1
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 7/100 (7%)
 Frame = +1

Query: 46   YNHTFKFREPYQILV---DEQIVQDSFESNYNLYRNLRKTLQA----ENIKVMITQCCMQ 204
            ++HT  F E + +LV    + ++  SFE ++ +  NLR+ LQA    ++    IT    Q
Sbjct: 1082 FSHTSDFTEAWSLLVCYMADLVILPSFEISFIVLSNLRELLQAVLKIQDFPARITSEIYQ 1141

Query: 205  KLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIV 324
            + +   N    D AK  E +R        K   +C+E ++
Sbjct: 1142 R-WCGYNVIYADPAKSSELKR--------KTNYDCVEELL 1172

>Kwal_26.8657 s26 (886675..887316) [642 bp, 213 aa] {ON} YOR220W -
           Hypothetical ORF [contig 67] FULL
          Length = 213

 Score = 30.0 bits (66), Expect = 5.5
 Identities = 25/101 (24%), Positives = 43/101 (42%)
 Frame = +1

Query: 25  YKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKVMITQCCMQ 204
           ++++   +    ++  P   L    I+ D   +   ++  L KTL ++ +KV +T    +
Sbjct: 33  FEREFPQFKKNCEYYTPLAFLHRIVIIFDQEAATLQVHNYLAKTLASKPVKVYLT----E 88

Query: 205 KLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVN 327
            L T S     DEA  F       +   PK  L+  ES VN
Sbjct: 89  SLITKSRARSFDEAD-FNADVAGATHTKPKLSLDTCESTVN 128

>NCAS0A04160 Chr1 complement(844321..846144) [1824 bp, 607 aa] {ON}
           Anc_2.419 YMR119W
          Length = 607

 Score = 30.0 bits (66), Expect = 8.0
 Identities = 23/84 (27%), Positives = 38/84 (45%)
 Frame = -1

Query: 354 IPMLVLTVNIHN*LYALQWLLRILNRVVTTTSFEPLGLVDQLLVAGGVQLLHATLCDHNL 175
           IP+L     +     A+ W   I   + TTT+  PL   D  L    +Q  + TL +   
Sbjct: 114 IPILSSKSFLRRFFIAISWSRCIQTFLSTTTNTMPLSDNDYNLFELSIQFHYMTLFEDKN 173

Query: 174 NILSLQRLPQVPIKVVIRLK*VLN 103
            I SL  + ++  ++VI +  +LN
Sbjct: 174 KIYSLDIMMELASRIVIHILELLN 197

>Kwal_26.9464 s26 (1229849..1230700) [852 bp, 283 aa] {ON} YGR275W
           (RTT102) - regulator of Ty1 transposition [contig 73]
           FULL
          Length = 283

 Score = 29.6 bits (65), Expect = 8.6
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = -3

Query: 358 PHTYACSDRQYSQLTLCTPMAP*DP*SSG 272
           PHT+A S ++Y +L  CTP+ P    +SG
Sbjct: 35  PHTFANSSQRYWKLDWCTPVKPKPTQNSG 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,758,108
Number of extensions: 1338782
Number of successful extensions: 4326
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4300
Number of HSP's successfully gapped: 49
Length of query: 272
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 164
Effective length of database: 41,097,471
Effective search space: 6739985244
Effective search space used: 6739985244
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 33 (17.3 bits)