Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002706.13ON49649626400.0
Kpol_1032.46.13ON46746121290.0
Kpol_1045.766.13ON48546820910.0
SAKL0E00946g6.13ON49347620900.0
TDEL0G045806.13ON48446820810.0
Ecym_30166.13ON48947220750.0
KLLA0D00902g6.13ON49249520680.0
Kwal_56.223626.13ON49346120550.0
KLTH0C11462g6.13ON49248420470.0
Smik_6.4706.13ON48846120230.0
ACR013C6.13ON48846120210.0
YPL262W (FUM1)6.13ON48846320170.0
Skud_16.166.13ON48846120140.0
Suva_16.436.13ON48846120110.0
NCAS0D026206.13ON49348320110.0
CAGL0A01045g6.13ON48346019820.0
KNAG0E027506.13ON49846119730.0
ZYRO0C07964g6.13ON50548819530.0
KAFR0B065206.13ON49546619490.0
NDAI0I024706.13ON47547419260.0
TBLA0G010006.13ON46545918630.0
TBLA0A071306.13ON50046618360.0
Skud_8.701.354ON4632111322e-07
Suva_15.2011.354ON4632381251e-06
KNAG0I015601.354ON4622161214e-06
CAGL0I08987g1.354ON4612391195e-06
Kpol_1018.1251.354ON4602381187e-06
TDEL0D022201.354ON4652131188e-06
TBLA0F034801.354ON4662251171e-05
Ecym_27491.354ON4702851171e-05
SAKL0D09746g1.354ON4642101171e-05
NCAS0A090101.354ON4622111161e-05
YHR018C (ARG4)1.354ON4632561152e-05
Smik_8.831.354ON4632561152e-05
NDAI0G059401.354ON4622111142e-05
TPHA0A021901.354ON4632271125e-05
AEL019W1.354ON4692181115e-05
KLLA0A08404g1.354ON4612101108e-05
Kwal_27.127821.354ON4652231053e-04
ZYRO0G00748g1.354ON4622121044e-04
KLTH0G19338g1.354ON4652741000.001
CAGL0B02794g4.197ON4821891000.001
TPHA0B010404.197ON4821891000.001
Suva_10.4594.197ON482258980.002
Ecym_24524.197ON482197970.003
YLR359W (ADE13)4.197ON482199970.003
Smik_12.4464.197ON482199960.004
ZYRO0B07964g4.197ON482189960.004
TBLA0A083204.197ON482189950.005
KAFR0A062304.197ON482189940.007
Kwal_47.180664.197ON482188930.008
NDAI0J019504.197ON482196930.010
KNAG0B058404.197ON482194920.012
NCAS0J012004.197ON482194920.013
KLLA0B13189g4.197ON482191910.013
Kpol_1042.164.197ON482194910.015
Skud_12.4434.197ON482199900.023
SAKL0B04972g4.197ON482189890.025
KLTH0A03344g4.197ON482189850.083
TDEL0E017604.197ON482194840.096
ABL006C4.197ON482197780.50
YLR303W (MET17)4.53ON44476732.4
NCAS0I004207.76ON76985723.0
KNAG0D034804.117ON116248714.1
Suva_10.3974.53ON44476705.5
Smik_12.3834.53ON44476705.8
Skud_12.3844.53ON44476696.4
ZYRO0F09262gsingletonON575112689.3
Kpol_1050.635.94ON1058105689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00270
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...  1021   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   824   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   810   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   809   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   806   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   803   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   801   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   796   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   793   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   783   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   783   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   781   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   780   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   779   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   779   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   768   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   764   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   756   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   755   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   746   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   722   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   711   0.0  
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    55   2e-07
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    53   1e-06
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    51   4e-06
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    50   5e-06
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    50   7e-06
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    50   8e-06
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    50   1e-05
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    50   1e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    50   1e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    49   1e-05
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    49   2e-05
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    49   2e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    49   2e-05
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    48   5e-05
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    47   5e-05
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    47   8e-05
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    45   3e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    45   4e-04
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    43   0.001
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    43   0.001
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    43   0.001
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    42   0.002
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    42   0.003
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    42   0.003
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    42   0.004
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    42   0.004
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    41   0.005
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    41   0.007
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    40   0.008
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    40   0.010
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    40   0.012
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    40   0.013
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    40   0.013
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    40   0.015
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    39   0.023
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    39   0.025
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    37   0.083
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    37   0.096
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    35   0.50 
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    33   2.4  
NCAS0I00420 Chr9 complement(63997..66306) [2310 bp, 769 aa] {ON}...    32   3.0  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    32   4.1  
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    32   5.5  
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    32   5.8  
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    31   6.4  
ZYRO0F09262g Chr6 complement(751947..753674) [1728 bp, 575 aa] {...    31   9.3  
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    31   9.7  

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/496 (100%), Positives = 496/496 (100%)

Query: 1   MSSVIRNVPRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTER 60
           MSSVIRNVPRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTER
Sbjct: 1   MSSVIRNVPRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTER 60

Query: 61  SFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLN 120
           SFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLN
Sbjct: 61  SFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLN 120

Query: 121 DHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTV 180
           DHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTV
Sbjct: 121 DHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTV 180

Query: 181 MHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQ 240
           MHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQ
Sbjct: 181 MHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQ 240

Query: 241 LTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEA 300
           LTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEA
Sbjct: 241 LTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEA 300

Query: 301 LAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINP 360
           LAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINP
Sbjct: 301 LAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINP 360

Query: 361 TQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHC 420
           TQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHC
Sbjct: 361 TQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHC 420

Query: 421 VEGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTE 480
           VEGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTE
Sbjct: 421 VEGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTE 480

Query: 481 SEFDEWVVPEKMIGPK 496
           SEFDEWVVPEKMIGPK
Sbjct: 481 SEFDEWVVPEKMIGPK 496

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/461 (84%), Positives = 428/461 (92%)

Query: 35  GFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNE 94
           GFR+ETDGFGEIKVPA+KYWGAQT+RS+ENF+IGGPRERMP+PVVKAFGVLKKSAAIVNE
Sbjct: 6   GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65

Query: 95  GYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 154
            +G LD  ISK+IQ+AADEVI+GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG
Sbjct: 66  EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125

Query: 155 TLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHI 214
            +GSK++HPNNH N AQSSND+FPTVMHIAAVTEIT HLIP++  L+DAL +KSK+F HI
Sbjct: 126 IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185

Query: 215 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIG 274
           VKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIEHSLINLKFLAQGGTAVGTGLNT+IG
Sbjct: 186 VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245

Query: 275 FAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSG 334
           FAE+IAEQ+SKETG+ FKTAPNKFEALAAHDAIVE+SGA+ TVA SLFKIAQDIRYLGSG
Sbjct: 246 FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305

Query: 335 PRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVF 394
           PRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQFELNVF
Sbjct: 306 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365

Query: 395 KPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEA 454
           KPVMISNLLSSIRLLGD   SF IHCVEGI+ANE++I  L+++SLMLVTALNPKIGYD A
Sbjct: 366 KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425

Query: 455 TKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495
           TKVAKNAHKKGITLKESA++LG LTE EFDEWVVPEKM+GP
Sbjct: 426 TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/468 (81%), Positives = 426/468 (91%)

Query: 28  RCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKK 87
           R +S+  GFR+ETDGFGEIKVPANKYWGAQTERSFENF+IGG RERMP+ VV+AFGVLKK
Sbjct: 16  RYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKK 75

Query: 88  SAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 147
            AAIVN   G LDP  SK+IQ+AADEV  GKLNDHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 76  CAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 135

Query: 148 AIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESK 207
           AIEL GG LGSK++HPNNH N AQSSND+FPTVMHIAAVT+I+ HL+PE+ +LRDAL +K
Sbjct: 136 AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 195

Query: 208 SKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGT 267
           S +F HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI RIE +  NL+FLAQGGTAVGT
Sbjct: 196 SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 255

Query: 268 GLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQD 327
           GLNT+ G+AE+IA +ISKETG+AFKTAPNKFEALAAHDAIVEASGA+ TVA SLFKIAQD
Sbjct: 256 GLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQD 315

Query: 328 IRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQG 387
           IRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  + FAG  G
Sbjct: 316 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASG 375

Query: 388 QFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNP 447
           QFELNVFKPV+ISNLLSS++LLGD S+SFR+HCVEGIKANE +I++L+++SLMLVTALNP
Sbjct: 376 QFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNP 435

Query: 448 KIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495
           KIGYD ATKVAKNAHKKGITLKESA++LG LTE EFDEWVVPEKM+GP
Sbjct: 436 KIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/476 (80%), Positives = 427/476 (89%), Gaps = 5/476 (1%)

Query: 26  SMRCLSDEAG-----FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVK 80
           S+R LS  +      +RIETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMP+ VV+
Sbjct: 17  SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVR 76

Query: 81  AFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNA 140
           AFGVLKKSAAIVNE  GTLDP+ISK IQ+AADEVIQGKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 77  AFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNA 136

Query: 141 NEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANL 200
           NEVISNRAIE++GG  GSKQVHPNNH NQAQSSND+FP+VMHIAAVTEIT  L+PE+  L
Sbjct: 137 NEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTAL 196

Query: 201 RDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQ 260
           RD+ + KS +F+ IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E SL +LKFLAQ
Sbjct: 197 RDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQ 256

Query: 261 GGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATS 320
           GGTAVGTGLNT++GFAEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VE SGA+ T+A S
Sbjct: 257 GGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACS 316

Query: 321 LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTI 380
           LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I
Sbjct: 317 LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376

Query: 381 IFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLM 440
            FAG  GQFELNVFKPVMISNLLSS+RLL D S SFR+HCV+GIKANE+RI+ L+++SLM
Sbjct: 377 TFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLM 436

Query: 441 LVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           LVTALNPKIGYD A+KVAKNAHKKGITLKESA+QLG L E EFDEWV+PEKMIGPK
Sbjct: 437 LVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/468 (80%), Positives = 429/468 (91%), Gaps = 1/468 (0%)

Query: 30  LSDEAG-FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKS 88
           +S +AG FR+ETD FGEIKV A++YWGAQT+RS ENFRIGGPRERMP+P+V+AFGVLKKS
Sbjct: 16  MSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKS 75

Query: 89  AAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 148
           AA+VNE  GTLDP++++ I++AADEV QGKL  HFPLVVFQTGSGTQSNMNANEVISNRA
Sbjct: 76  AAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRA 135

Query: 149 IELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKS 208
           IEL+GG LGSKQ+HPNNH NQAQSSND+FP+VMHIAAVTEIT HL+PE+A+LRD+L++KS
Sbjct: 136 IELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKS 195

Query: 209 KDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTG 268
           K+F+ IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI R+E SL  LK+LAQGGTAVGTG
Sbjct: 196 KEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTG 255

Query: 269 LNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDI 328
           LNT+IGFAEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VEASGA+ TVA SLFKIAQDI
Sbjct: 256 LNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDI 315

Query: 329 RYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQ 388
           RYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQ
Sbjct: 316 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQ 375

Query: 389 FELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPK 448
           FELNVFKPVMISNLLSS+RLL D S SFR+HCV+GI AN +RI  LM++SLMLVTALNPK
Sbjct: 376 FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPK 435

Query: 449 IGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           IGYD A+KVAKNAHKKGITLK+SA+ LG LTESEFDEWVVPE MIGPK
Sbjct: 436 IGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/472 (79%), Positives = 425/472 (90%), Gaps = 4/472 (0%)

Query: 28  RCLSDEAG----FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFG 83
           R +S  AG    FRIETD FGEIKVPANKYWGAQT+RS ENF+IGGPRERMP+P++KAFG
Sbjct: 16  RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75

Query: 84  VLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEV 143
           +LKKSAAIVNE  GTLDP+ISK IQ+AADEVI+GKL DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 76  ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135

Query: 144 ISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDA 203
           ISNRAIEL+GG LG+KQ+HPNNH NQAQSSND+FP+VMHIAAVTEIT+ L+PE+  LRD+
Sbjct: 136 ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195

Query: 204 LESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGT 263
            + K+++F+HIVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E SL +LKFLAQGGT
Sbjct: 196 FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255

Query: 264 AVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFK 323
           AVGTGLNT++GFAEKIAEQ+SKET + FKTAPNKFEALAAHDA+VE SGA+ TVA SLFK
Sbjct: 256 AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315

Query: 324 IAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFA 383
           IA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ C Q++GNN TI FA
Sbjct: 316 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375

Query: 384 GTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVT 443
           G  GQFELNVFKPVMISNLL+SIRLL D S SFR+HCV+GIKANE++IA ++++SLMLVT
Sbjct: 376 GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435

Query: 444 ALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495
           ALNPKIGYD A KVAKNAHKK ITLKESA++LG L+E EF EWVVPEKMIGP
Sbjct: 436 ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/495 (76%), Positives = 436/495 (88%), Gaps = 6/495 (1%)

Query: 4   VIRN--VPRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERS 61
           ++RN  V RG+       K     S+R +S    +R+ETD FGEI+VP++KYWGAQT+RS
Sbjct: 1   MLRNSIVSRGLAQTRVSAKVNRLASLRMVS----YRVETDAFGEIQVPSDKYWGAQTQRS 56

Query: 62  FENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLND 121
            +NF+IGGPRERMP+P+VKAFGVLKKSAA+VNE  GTLDP+I+K I++AADEV QGKL +
Sbjct: 57  LQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLME 116

Query: 122 HFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVM 181
           HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG LGSK++HPNNH NQAQSSND+FP+VM
Sbjct: 117 HFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVM 176

Query: 182 HIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQL 241
           HIAAVTEIT HL+PE+  L+ AL+ KS +F HIVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 177 HIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQV 236

Query: 242 TNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEAL 301
            NGI R++ SL +LKFLAQGGTAVGTGLNT++GFAE IAEQ+SKETG+ FKTAPNKFEAL
Sbjct: 237 ENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEAL 296

Query: 302 AAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPT 361
           AAHDA+VEASGA+ T+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPT
Sbjct: 297 AAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 356

Query: 362 QNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCV 421
           QNEA+TQVC Q++GN+  I FAG  GQFELNVFKPVMISNLLSSIRLLGD S SFRIHCV
Sbjct: 357 QNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCV 416

Query: 422 EGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTES 481
           EGIKANE+RIA L+++SLMLVTALNPKIGYD A+KVAKNAHKKGITLKESA++L  L+  
Sbjct: 417 EGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSE 476

Query: 482 EFDEWVVPEKMIGPK 496
           EFD+WV+PEKMIGPK
Sbjct: 477 EFDQWVIPEKMIGPK 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/461 (80%), Positives = 418/461 (90%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           +R+ETD FGEIKVP +K WGAQT+RS ENF+IGG RERMP+P+VKAFG+LKKSAAIVNE 
Sbjct: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            GTLDP++SK IQ+AADEVI GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L+GG 
Sbjct: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           +GSK +HPNNH NQAQSSND+FP+VMHIAAVTE+T  L+PE+  LRDA   K+++F  IV
Sbjct: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+EHSL NLKFLAQGGTAVGTGLNT++GF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
           AEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VE SGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQFELNVFK
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           PVMISNLLSSIRLLGD   SFR+HCVEGI+ANE++IA L+++SLMLVTALNPKIGYD A+
Sbjct: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           KVAKNAHKKGITLKESA++LG L+ +EFDEWVVPE M+GPK
Sbjct: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/484 (77%), Positives = 427/484 (88%), Gaps = 2/484 (0%)

Query: 13  KSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRE 72
           KS++   KT +  +   +S +   R+ETD FGEI VPA+KYWGAQT+RS ENF+IGG RE
Sbjct: 11  KSLSGSPKTRLISTSSAISQKC--RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARE 68

Query: 73  RMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGS 132
           RMP+PVV+AFG+LKKSAAIVNE  GTLDP+ISK IQ+AADEVI GKL DHFPLVVFQTGS
Sbjct: 69  RMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGS 128

Query: 133 GTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDH 192
           GTQSNMNANEVISNRAIE++GG +G+K +HPNNH NQAQSSND+FP+VMHIAAVTEIT  
Sbjct: 129 GTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHS 188

Query: 193 LIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSL 252
           L+PE+  LRD+  +KSK+F  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E SL
Sbjct: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248

Query: 253 INLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASG 312
           I+LKFLAQGGTAVGTGLNT++GF EKIAEQ+SKETG+ FKTAPNKFEALAAHDAIVE SG
Sbjct: 249 IHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSG 308

Query: 313 AITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQ 372
           A+ T+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q
Sbjct: 309 ALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 368

Query: 373 IIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIA 432
           ++GNN  I FAG  GQFELNVFKPVMISNLLSS+RLLGD   SFR+HCV+GI+AN ++IA
Sbjct: 369 VMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIA 428

Query: 433 DLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKM 492
            L+++SLMLVTALNPKIGYD A+KVAKNAHKKGITLKESA++L  LT +EFD+WVVPE M
Sbjct: 429 KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENM 488

Query: 493 IGPK 496
           +GPK
Sbjct: 489 VGPK 492

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/461 (80%), Positives = 413/461 (89%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           FR ETD FGEI VPA+KYWGAQT+RSF+NF+IGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            G LDP+ISK IQEAADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG 
Sbjct: 88  LGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           +GSK+VHPNNH NQ+QSSND+FPTVMHIAA  +I + LIPE+ANL++ALE+KSK+F HIV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIV 207

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNT+ GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
             KIAEQISKETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGY EL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG+QGQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           PVMI+NLL+SIRL+ D + SFR+HCVEGIKANE RI +L+ KSLMLVTALNPKIGYD A+
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           KVAKNAHKKGITLKESA++LG LTE EFDEWVVPE M+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/461 (78%), Positives = 416/461 (90%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           FR+ETD FGEI+VPA+KYWGAQT+RS ENFRIGG RERMP+PVV+AFGVLKKSAA+VNE 
Sbjct: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            GTL+P I+K IQ+AADEV QG+L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 
Sbjct: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           LGSKQVHPNNH NQAQSSND+FP+VMHIAAVTEIT  L+PE+  LR + + K+ +FAHIV
Sbjct: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+EH+  +L+FLAQGGTAVGTGLNTR GF
Sbjct: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
           AE+IA Q+S+ETG+ F+TAPNKFEALAAHDA+VEASGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ C Q++GNN  I FAG  GQFELNVFK
Sbjct: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           PVMI+NLLSS+RLL D ++SFR+HCV+GI+ NE+RIA L+++SLMLVTALNPKIGYD A+
Sbjct: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
            VAKNAHKKGITL+ SA++LG LT++EFDEWVVPEKMIGP+
Sbjct: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/463 (79%), Positives = 413/463 (89%)

Query: 34  AGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVN 93
           + FR ETD FGEI VPA+KYWGAQT+RSF+NF+IGG RERMP P+V AFGVLKKSAAIVN
Sbjct: 26  SSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVN 85

Query: 94  EGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 153
           E  G LDP+ISK IQ+AADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LG
Sbjct: 86  ESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145

Query: 154 GTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAH 213
           G +GSKQVHPNNH NQ+QSSND+FPTVMHIAA  +I + LIPE+ NL++ALE+KSK+F H
Sbjct: 146 GKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDH 205

Query: 214 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRI 273
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNT+ 
Sbjct: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKP 265

Query: 274 GFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGS 333
           GF  KIAEQISKETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRYLGS
Sbjct: 266 GFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325

Query: 334 GPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNV 393
           GPRCGY EL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG+QGQFELNV
Sbjct: 326 GPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNV 385

Query: 394 FKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDE 453
           FKPVMI+NLL+SIRL+ D + SFR+HCVEGIKANE RI +L+ KSLMLVTALNPKIGYD 
Sbjct: 386 FKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445

Query: 454 ATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           A+KVAKNAHKKGITLKESA++LG LTE EFDEWVVPE M+GPK
Sbjct: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/461 (79%), Positives = 412/461 (89%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           FRIETD FGEI VPA+KYWGAQT+RSF+NF+IGG RERMP P+V AFGVLKKSAA+VNE 
Sbjct: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            G LDP+ISK IQ+AADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG 
Sbjct: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           +GSK+VHPNNH NQ+QSSND+FPTVMHIAA  +I + LIPE+ NL++ALE+KSK+F HIV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNT+ GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
             KIAEQIS ETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGY EL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG+QGQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           PVMI+NLL+SIRL+ D + SFR+HCVEGIKANE RI +L+ KSLMLVTALNPKIGYD A+
Sbjct: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           KVAKNAHKKGITLKESA++LG LTE EFDEWVVPE M+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/461 (79%), Positives = 410/461 (88%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           FR ETD FGEI VPA+KYWGAQT+RSF+NF+IGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            G LDP++SK IQ+AADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG 
Sbjct: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           +GSKQVHPNN  NQ+QSSND+FPTVMHIAA  +I   LIPE+ NL++ALE+KSK+F HIV
Sbjct: 148 IGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ H+L  L FLAQGGTAVGTGLNT+ GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
             KIAEQISKETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGY EL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I F G+QGQFELNVFK
Sbjct: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           PVMI+NLL+SIRL+ D S+SFRIHCVEGIKANE RI +L+ KSLMLVTALNPKIGYD A+
Sbjct: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           KVAKNAHKKGITLKESA++LG LTE EFDEWVVPE M+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/483 (75%), Positives = 426/483 (88%)

Query: 14  SVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRER 73
           ++ ++Q + M  S    + +  +RIETD FGEIKVPA+KYWGAQT+RSF+NF+IGG RER
Sbjct: 10  TILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRER 69

Query: 74  MPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSG 133
           +PDP++ AFG+LKKSAAIVNE  GTLDP+++  I++AADEV+QGKL DHFPLVVFQTGSG
Sbjct: 70  IPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSG 129

Query: 134 TQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHL 193
           TQ+NMN NEVISNRAIEL+GG LGSKQ+HPNNH NQ+QSSND+FP+VMHIAAV EIT+ L
Sbjct: 130 TQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSL 189

Query: 194 IPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLI 253
           IPE+  L+DAL+ K+K+FA IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE SL 
Sbjct: 190 IPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLY 249

Query: 254 NLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGA 313
           +LKFLAQGGTAVGTGLNT+IGF + IAE++SKETG+ FKTAPNKFEALAAHDAIV ASGA
Sbjct: 250 HLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGA 309

Query: 314 ITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQI 373
           + TVA SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGK+NPTQNEA+TQVC QI
Sbjct: 310 LNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQI 369

Query: 374 IGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIAD 433
           +GNNQTI  AG+QGQFELNV+KP+MI+NLL+SIRL+ D  KSFRIHC++ +KAN+++I +
Sbjct: 370 MGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINE 429

Query: 434 LMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMI 493
            +NKSLMLVTALNPKIGYD A+K+AKNAH K ITLKESA++L  LT  EFDEWVVPE MI
Sbjct: 430 NLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMI 489

Query: 494 GPK 496
           GPK
Sbjct: 490 GPK 492

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/460 (78%), Positives = 410/460 (89%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           +R+ETD FGEIKVPA+KYWGAQT+RSF+NF+IGG RERMP+P+V+AFGVLKKSAAIVNE 
Sbjct: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            GTLD +I+  IQ+AADEV +GKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG 
Sbjct: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           LGSK++HPNNH NQAQSSND+FP+VMHIAAVTEIT+ L+PE+  L+DAL  K+++F  IV
Sbjct: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE++L +LK+LAQGGTAVGTGLNT+ GF
Sbjct: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
            + IAEQISKETG+ FKTAPNKFEALAAHDAIVEASGA+ TVA SLFKIAQDIRYLGSGP
Sbjct: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGYGEL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  + FAG  GQFELNVFK
Sbjct: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           PVMISNLLSSIRLL D   SFR+HCVEGI+AN E+I   ++ SLMLVTALNPKIGYD A+
Sbjct: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495
           K+AKNA KK ITLKESA++L  LT  EFDEWV+PE M+GP
Sbjct: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/461 (77%), Positives = 412/461 (89%)

Query: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95
           FR+ETD FGEI VPA++YWGAQT+RSF+NF+IGG RE++P+PVV+AFG+LKKSAA VNE 
Sbjct: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96

Query: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155
            GTLD  I+  I+ AADEV +GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 
Sbjct: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156

Query: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215
           LGSKQVHPNNHVNQ+QSSND+FPTVMHIAA TEI + LIPE+ NL+DAL+ K ++F+ IV
Sbjct: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216

Query: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ SL +L FLAQGGTAVGTGLNT++GF
Sbjct: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276

Query: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335
            + +AE++SKETG+ F+TAPNKFEALAAHDAIVEASGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336

Query: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395
           RCGYGEL LP NEPGSSIMPGK+NPTQNEA+TQVC Q++GNN TI FAG+QGQFELNV+K
Sbjct: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396

Query: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455
           P+MISNLLSSIRLL D SKSFRIHC+  +KAN+++I + +NKSLMLVTALNPKIGYD A 
Sbjct: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAA 456

Query: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           KVAKNAH K ITLKESA++LG LTE EFDEWV+PE MI PK
Sbjct: 457 KVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/488 (73%), Positives = 411/488 (84%), Gaps = 3/488 (0%)

Query: 9   PRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIG 68
           PR        Q + +H +   L +    R+ETD FGEIKVPA+KYWGAQT+RSFENFRIG
Sbjct: 20  PRLTSKTPMSQISQLHTTTPWLQEH---RVETDAFGEIKVPADKYWGAQTQRSFENFRIG 76

Query: 69  GPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVF 128
           G RERMP+ VV AFG+LKK+ A VNE  G LDP+++  I++AADEV  GKL DHFPLVVF
Sbjct: 77  GQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVF 136

Query: 129 QTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTE 188
           QTGSGTQSNMNANEVISNRAIELLGG LGSK VHPNNH+N +QSSND+FPTVMHIAAV  
Sbjct: 137 QTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLA 196

Query: 189 ITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRI 248
           IT  L+P +  L+D+L+ KS++FA IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+
Sbjct: 197 ITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRV 256

Query: 249 EHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIV 308
           E +L +LK LAQGGTAVGTGLNT+IG+AE +A +++KETG+ F+TAPNKFEALAAHDA+V
Sbjct: 257 ESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVV 316

Query: 309 EASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQ 368
           EASGA+ T+A SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ
Sbjct: 317 EASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ 376

Query: 369 VCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANE 428
           VC Q+ GN+  I FAG  GQFELNVFKPVMISNLLSSI LL D S SFR+HCV+GI+AN 
Sbjct: 377 VCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANR 436

Query: 429 ERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVV 488
           E IA L+++SLMLVTALNPKIGYD A+KVAKNAHK GITLKESA+QL  LT  EFD WVV
Sbjct: 437 ENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVV 496

Query: 489 PEKMIGPK 496
           PE MIGPK
Sbjct: 497 PEHMIGPK 504

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/466 (76%), Positives = 413/466 (88%)

Query: 31  SDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAA 90
           S ++ FR ETD FGEI VP +KYWGAQT+RS +NF+IGG RE++P P+++AFG+LKKSAA
Sbjct: 29  SIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAA 88

Query: 91  IVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 150
           IVNE  GTLD +++K I  AADEV QGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE
Sbjct: 89  IVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 148

Query: 151 LLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKD 210
           L+GG LGSK VHPNNHVNQ+QSSND+FPTVMHIAA+ EIT  L+PE+ +L+++L+ KS +
Sbjct: 149 LMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNE 208

Query: 211 FAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLN 270
           F  IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RIE +L +LKFLAQGGTAVGTGLN
Sbjct: 209 FNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLN 268

Query: 271 TRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRY 330
           T+ GF + IAEQIS+ETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRY
Sbjct: 269 TKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRY 328

Query: 331 LGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFE 390
           LGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GN+ TI FAG+QGQFE
Sbjct: 329 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFE 388

Query: 391 LNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIG 450
           LNV+KP++ISNLLSSIRLL D S SFR+HC++G+KAN E I + +NKSLMLVTALNP IG
Sbjct: 389 LNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIG 448

Query: 451 YDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           YD A+K+AKNAH K ITLKESA++LG LTE +F EWV+PEKMIGPK
Sbjct: 449 YDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/474 (74%), Positives = 426/474 (89%)

Query: 23  MHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAF 82
           M  + +  S+E+ FR+ETD FGEIKVP+NKYWGAQT+RSF+NF+IGG RE++P P++KAF
Sbjct: 1   MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF 60

Query: 83  GVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANE 142
           G+LKKSAAIVN+  GTLDP I+  I +A+DEVIQGKLNDHFPLVVFQTGSGTQ+NMNANE
Sbjct: 61  GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE 120

Query: 143 VISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRD 202
           VISNRA EL+G  LGSK++HPNNHVNQ+QSSND+FP+VMHIAAV E+ ++LIP++  L++
Sbjct: 121 VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN 180

Query: 203 ALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGG 262
           +L++K+K++A+IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI RI+ SL +LKFLAQGG
Sbjct: 181 SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG 240

Query: 263 TAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLF 322
           TAVGTGLNT++GF + IA+++SKETG+ F+TAPNKFEALAAHDAIV AS AITTVA SLF
Sbjct: 241 TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF 300

Query: 323 KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIF 382
           KIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGK+NPTQNEA+TQV  QI+GNNQTI+ 
Sbjct: 301 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM 360

Query: 383 AGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLV 442
           AG+QGQFELNV+KP+MI+NLL+SIRL+ D   SF+IHCV+G+KAN ++I + ++KSLMLV
Sbjct: 361 AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV 420

Query: 443 TALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496
           TALNPKIGYD A+K+AKNAH K ITLKESA++LG LTE EFD+WV+PE MIGPK
Sbjct: 421 TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/459 (72%), Positives = 394/459 (85%)

Query: 37  RIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGY 96
           RIE DGFGE++VPANKYWGAQT+R+  NF IGG RERMP+P++ A+G+LKKS AIVNE  
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 97  GTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 156
           GTLDP+ISK IQEAADEV +G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 157 GSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVK 216
           GSK VHPNNHVNQ+QS+NDSFPT MHI+AV E+   L+PE+  LRDAL+ KS +F  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 217 IGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFA 276
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+++SL NLKF+AQGGTAVGTG+NT+  F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 277 EKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPR 336
             +A+QIS ETG+ FKTAPNKFEALA+HDAIVE SGA+ T+A SLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 337 CGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKP 396
           CGYGELSLPENEPGSSIMPGK+NPTQNEA+ Q C Q++GNN  I FAG  GQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 397 VMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEATK 456
           +MISNLL+SIRLL D   SFRIHC+ GI+ANE++I  L+N+SLMLVTALNPKIGYD AT 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 457 VAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495
           +AK+AHK G+TLKE+A++   LT  +FDEW+VPE M+ P
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/466 (70%), Positives = 395/466 (84%)

Query: 30  LSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSA 89
           ++D  G R ETD FGEI+VPANKYWGAQT+RSF NF+IGG RERMP+P+++AFG  KK+A
Sbjct: 34  IADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAA 93

Query: 90  AIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 149
           AIVN   GTLD  +   I +AA+EV QG LN+HFPLVVFQTGSGTQSNMNANEVISNRAI
Sbjct: 94  AIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAI 153

Query: 150 ELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSK 209
           ELLGGTLGSKQVHPNNHVNQ+QSSND+FPTVMHIAA+TEIT+ L+P +  LR+ L+SK+K
Sbjct: 154 ELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAK 213

Query: 210 DFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGL 269
           +F  I+KIGRTHLQDATPLTLGQEFSGY QQLTN I RIE +L  L+++AQGGTAVGTGL
Sbjct: 214 EFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGL 273

Query: 270 NTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIR 329
           NT+IGFAE+ A Q+S +T ++F T+PNKFE+LAAHDAIV    ++ T+A SLFKI+QDIR
Sbjct: 274 NTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIR 333

Query: 330 YLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQF 389
           YL SGPRCGYGELS+PENEPGSSIMPGK+NPTQNEA+ Q C Q++GNN TI FAG  GQF
Sbjct: 334 YLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQF 393

Query: 390 ELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKI 449
           ELN +KP+MI+NLLSS RLL D   SF +HC  GI+AN+++I  L+++SLMLVT+LNPKI
Sbjct: 394 ELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKI 453

Query: 450 GYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495
           GYD A+KVAKNAH KGITLK+SA++L  L+  +FDEWV PE M+GP
Sbjct: 454 GYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 86/211 (40%), Gaps = 11/211 (5%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T + I     + D+L P +  L D L  ++K   +I+  G THLQ A 
Sbjct: 108 VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEINILMPGYTHLQRAQ 167

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKE 286
           P+      S Y    T    R++  L  L     G  A+        G    I  +   E
Sbjct: 168 PIRWSHWLSSYATYFTEDYKRLDQILHRLNQSPLGAGALA-------GHPYGIDREFLAE 220

Query: 287 TGVAFKTA-PNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP 345
            G+ F +   N   A++  D IVE     T     + + A+D+  +      G+ +LS  
Sbjct: 221 -GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-D 277

Query: 346 ENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
               GSS+MP K N    E +     ++ G+
Sbjct: 278 AYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 93/238 (39%), Gaps = 21/238 (8%)

Query: 140 ANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVAN 199
           ANE    R  EL+G  +  K       V+  +S ND   T + I     + D L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 200 LRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLA 259
           L D L  +++    I+  G THLQ A P+      S Y    T    R+   L  L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 260 QGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTA-PNKFEALAAHDAIVEASGAITTVA 318
            G  A+        G    I  +   E G+ F +   N   A++  D IVE     T   
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 319 TSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
             + + A+D+  +      G+ +LS      GSS+MP K N    E +     ++ G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 87/216 (40%), Gaps = 11/216 (5%)

Query: 162 HPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTH 221
           H    V+  +S ND   T M I     + + L+P +A+L   L  ++++    +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 222 LQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAE 281
           LQ A P+      S Y    T    R++  L  L     G  A+        G    I  
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA-------GHPYGIDR 215

Query: 282 QISKETGVAF-KTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYG 340
           +   E G+ F     N   A++  D +VE     T     + + A+D+  + S    G+ 
Sbjct: 216 EFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFV 273

Query: 341 ELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
           +LS      GSS+MP K N    E +     ++ G+
Sbjct: 274 KLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 96/239 (40%), Gaps = 25/239 (10%)

Query: 140 ANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVAN 199
           ANE    R  EL+G  +  K       V+  +S ND   T M I     + + + P + +
Sbjct: 92  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKS 141

Query: 200 LRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH--SLINLKF 257
           L + L ++++    I+  G THLQ A P+      S Y    T  + R+E     +N   
Sbjct: 142 LINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSP 201

Query: 258 LAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFK-TAPNKFEALAAHDAIVEASGAITT 316
           L  G  A         G    I  Q   E G+ F     N   A++  D +VE     T 
Sbjct: 202 LGSGALA---------GHPYGIDRQFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATL 251

Query: 317 VATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIG 375
               + + ++D+  + S    G+ +LS      GSS+MP K N    E +     ++ G
Sbjct: 252 FMNHVSRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 140 ANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVAN 199
           ANE    R  EL+G  +  K       V+  +S ND   T + I     I D L+P + +
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 200 LRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLA 259
           L   L  + +    I+  G THLQ A P+      S Y    T    R++  L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 260 QGGTAVGTGLNTRIGFAEKIAEQISKETGVAFK-TAPNKFEALAAHDAIVEASGAITTVA 318
            G  A+        G    I  +     G+ F     N   A++  D +VE     T   
Sbjct: 199 LGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 319 TSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
             + + A+D+  + S    G+  LS      GSS+MP K N    E +     ++ GN
Sbjct: 251 NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 84/213 (39%), Gaps = 15/213 (7%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T + I     + D L P++  L D +  + K+   ++  G THLQ A 
Sbjct: 108 VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGYTHLQRAQ 167

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSL--INLKFLAQGGTAVGTGLNTRIGFAEKIAEQIS 284
           P+      S Y    T    R+   +  IN   L  G  A         G    I  +  
Sbjct: 168 PIRWSHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALA---------GHPYGIDREFL 218

Query: 285 KETGVAFK-TAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELS 343
              G+ F     N   A++  D IVE     T     + + A+D+  + S    G+ +L+
Sbjct: 219 A-AGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN 276

Query: 344 LPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
                 GSS+MP K N    E +     ++ G+
Sbjct: 277 -DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 91/225 (40%), Gaps = 14/225 (6%)

Query: 152 LGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDF 211
           LG  +G+   H    V+  +S ND   T + I     + + L+P + +L   +  ++++ 
Sbjct: 96  LGEIIGT---HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENE 152

Query: 212 AHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNT 271
             I+  G THLQ A P+      S Y    T    R++  L  L     G  A+      
Sbjct: 153 IDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA----- 207

Query: 272 RIGFAEKIAEQ-ISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRY 330
             G    I  Q +S E G       N   A++  D IV+     T     + + ++D+  
Sbjct: 208 --GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-I 263

Query: 331 LGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIG 375
           + S    G+ +LS      GSS+MP K N    E +     ++ G
Sbjct: 264 IYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 111/285 (38%), Gaps = 36/285 (12%)

Query: 97  GTLDPQ----ISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 152
           G LD +    I K + E   E   GK  +H            +    ANE    R  EL+
Sbjct: 53  GLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGELI 100

Query: 153 GGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFA 212
           G  +  K       V+  +S ND   T M I     + + ++P V++    L +++++  
Sbjct: 101 GTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREEV 153

Query: 213 HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTR 272
            ++  G THLQ A P+      S Y    T    R+      ++ L Q     G      
Sbjct: 154 DVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQV---VERLNQSPLGAGALAGHP 210

Query: 273 IGFAEK-IAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYL 331
            G   K +AEQ+     +      N   A++  D ++E     +     + + A+D+   
Sbjct: 211 YGIDRKYLAEQLGFNGIIG-----NSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLIIY 265

Query: 332 GSGPRCGYGELSLPE-NEPGSSIMPGKINPTQNEAVTQVCAQIIG 375
            +     +G ++L +    GSS+MP K NP   E +     ++ G
Sbjct: 266 STAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 85/210 (40%), Gaps = 11/210 (5%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T M I     + + L+P +      L +++K+   ++  G THLQ A 
Sbjct: 109 VHTGRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEIDVLMPGYTHLQRAQ 168

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKE 286
           P+      S Y    T    R++  +  L     G  A+        G    I  +    
Sbjct: 169 PIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA-------GHPYGIDREFLAR 221

Query: 287 TGVAFK-TAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP 345
            G+ F+    N   A++  D +VE     T     + + ++D+  + S    G+ +LS  
Sbjct: 222 -GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-IIYSTAEFGFIKLS-D 278

Query: 346 ENEPGSSIMPGKINPTQNEAVTQVCAQIIG 375
               GSS+MP K NP   E +     ++ G
Sbjct: 279 AYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 85/211 (40%), Gaps = 11/211 (5%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T + I     + + L P + +L   L  + ++   I+  G THLQ A 
Sbjct: 108 VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEIDILMPGYTHLQRAQ 167

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKE 286
           P+      S Y    T  + R++  L+       G  A+        G    I  +   E
Sbjct: 168 PIRWSHWLSSYATYFTEDLNRLKQILVRFNKSPLGAGALA-------GHPYGIDREFLAE 220

Query: 287 TGVAFK-TAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP 345
            G+ F     N   A++  D +VE     T     + + A+D+  + S    G+ +L+  
Sbjct: 221 -GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-IIYSTAEFGFIKLN-D 277

Query: 346 ENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
               GSS+MP K N    E +     ++ G+
Sbjct: 278 AYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 97/256 (37%), Gaps = 57/256 (22%)

Query: 140 ANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVAN 199
           ANE    R  EL+G  +  K       V+  +S ND   T + I     + D L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 200 LRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG---IGRIEHSL---- 252
           L + L  +++    ++  G THLQ A P+      S Y    T     +G+I H L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 253 ------------INLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEA 300
                       I+ +FLA+     G G N+ IG                     N   A
Sbjct: 201 LGAGALAGHPYGIDREFLAE-----GLGFNSVIG---------------------NSLVA 234

Query: 301 LAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINP 360
           ++  D IVE     T     + + A+D+  +      G+ +LS      GSS+MP K N 
Sbjct: 235 VSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNA 292

Query: 361 TQNEAVTQVCAQIIGN 376
              E +     ++ G+
Sbjct: 293 DSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 96/256 (37%), Gaps = 57/256 (22%)

Query: 140 ANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVAN 199
           ANE    R  EL+G  +  K       V+  +S ND   T + I     +   L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 200 LRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG---IGRIEHSL---- 252
           L D L  +++    I+  G THLQ A P+      S Y    T     +G+I H L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 253 ------------INLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEA 300
                       I+ +FLA+     G G N+ IG                     N   A
Sbjct: 201 LGAGALAGHPYGIDREFLAE-----GLGFNSVIG---------------------NSLVA 234

Query: 301 LAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINP 360
           ++  D IVE     T     + + A+D+  +      G+ +LS      GSS+MP K N 
Sbjct: 235 VSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNA 292

Query: 361 TQNEAVTQVCAQIIGN 376
              E +     ++ G+
Sbjct: 293 DSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 86/211 (40%), Gaps = 11/211 (5%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T + I     + + L P + +L + L  ++++   I+  G THLQ A 
Sbjct: 108 VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMTSLIEVLIKRAEEEIDILMPGYTHLQRAQ 167

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKE 286
           P+      S Y    T  + R++  L        G  A+        G    I  +   E
Sbjct: 168 PIRWSHWLSSYATYFTEDLKRLKQILERFNKSPLGAGALA-------GHPYGIDREFLAE 220

Query: 287 TGVAFK-TAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP 345
            G+ F     N   A++  D +VE     T     + + A+D+  + S    G+ +LS  
Sbjct: 221 -GLGFDGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-VIYSTAEFGFIKLS-D 277

Query: 346 ENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
               GSS+MP K N    E +     ++ G+
Sbjct: 278 AYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 95/227 (41%), Gaps = 16/227 (7%)

Query: 152 LGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDF 211
           LG  +G+K    +  V+  +S ND   T + I     ++D L+  +  L + L +++++ 
Sbjct: 96  LGEIIGTK---ISGKVHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLINRAEEE 152

Query: 212 AHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLK-FLAQGGTAVGTGLN 270
              +  G THLQ A P+      S Y         R    L+ LK  L +     G    
Sbjct: 153 IEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKR----LVQLKERLNKSPLGAGALAG 208

Query: 271 TRIGF-AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIR 329
              G   E +AE++  ++ +      N   A++  D +VE     T     + + A+D+ 
Sbjct: 209 HPYGIDREYLAEKLGFDSVIG-----NSLVAVSDRDFVVEILFWSTLFMNHISRFAEDL- 262

Query: 330 YLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
            + S    G+ +LS      GSS+MP K N    E +     ++ GN
Sbjct: 263 IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 87/218 (39%), Gaps = 15/218 (6%)

Query: 162 HPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTH 221
           H +  V+  +S ND   T M +     + D + P +  L   L  ++++   ++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 222 LQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVG---TGLNTRIGFAEK 278
           LQ A P+      S Y         R++  +  L     G  A+     G++        
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDR------- 215

Query: 279 IAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCG 338
             E ++ E G       N   A++  D +VE     +     + ++A+D+  + S    G
Sbjct: 216 --EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFG 271

Query: 339 YGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
           + +L+      GSS+MP K NP   E +     ++ G 
Sbjct: 272 FVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 85/210 (40%), Gaps = 11/210 (5%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T M I     +   ++P +++L   +  ++++   ++  G THLQ A 
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQ 166

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKE 286
           P+      S Y    T    R++  +  L     G  A+        G    I  +    
Sbjct: 167 PIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA-------GHPYGIDREFLA- 218

Query: 287 TGVAFK-TAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP 345
            G+ F     N   A+A  D +VE     +     + + A+D+  + S    G+ +LS  
Sbjct: 219 AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-D 276

Query: 346 ENEPGSSIMPGKINPTQNEAVTQVCAQIIG 375
               GSS+MP K NP   E +     ++ G
Sbjct: 277 AYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 89/223 (39%), Gaps = 26/223 (11%)

Query: 162 HPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTH 221
           H    V+  +S ND   T M I    E  D+L   + +L  A+  +S+     +  G TH
Sbjct: 105 HIAGKVHTGRSRNDQVATDMRIYC-REALDNLAKILEDLIGAILQRSEQEIDALMPGYTH 163

Query: 222 LQDATPLTLGQEFSGYVQQLTNGIGRIEH--SLINLKFLAQGGTA---VGTG---LNTRI 273
           LQ A P+      + Y    T    R++     +N+  L  G  A    G     L  R+
Sbjct: 164 LQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDREFLAERL 223

Query: 274 GFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGS 333
           GF++ I                N  +A++  D +VE     +     + + ++D+  + S
Sbjct: 224 GFSDVIG---------------NSLQAVSDRDFVVEIMFWCSLFMNHISRFSEDL-IIYS 267

Query: 334 GPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
                + +LS      GSS+MP K NP   E +     ++ G+
Sbjct: 268 TAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 84/212 (39%), Gaps = 13/212 (6%)

Query: 167 VNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDAT 226
           V+  +S ND   T M I     + + L+P +  L   +  +++     +  G THLQ A 
Sbjct: 108 VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHLQRAQ 167

Query: 227 PLTLGQEFSGYVQQLTNGIGRIEHSL--INLKFLAQGGTAVGTGLNTRIGFAEKIAEQIS 284
           P+      S Y    T  + R+   L   N   L  G  A       R   AE++  Q  
Sbjct: 168 PIRWSHWLSSYATYFTEDLKRLRQLLERFNQSPLGAGALAGHPYGIDREFLAEELGFQ-- 225

Query: 285 KETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSL 344
              GV      N   A++  D +VE     T     + + A+D+  + S    G+ +L+ 
Sbjct: 226 ---GV----IGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN- 276

Query: 345 PENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
                GSS+MP K N    E +     ++ G+
Sbjct: 277 DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 112/274 (40%), Gaps = 24/274 (8%)

Query: 106 VIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNN 165
           + QE  DE+ +G       ++  +  S +    + +E I       LG  +G    H   
Sbjct: 57  LTQEELDEIHRG-----LEIIRGEWASNSFVEKDGDEDIHTANERRLGEIIGR---HIAG 108

Query: 166 HVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDA 225
            V+  +S ND   T M I    E  D++   + +L  A+  +++     +  G THLQ A
Sbjct: 109 KVHTGRSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRA 167

Query: 226 TPLTLGQEFSGYVQQLTNGIGRIEH--SLINLKFLAQGGTAVG-TGLNTRIGFAEKIAEQ 282
            P+      + Y    T    R++     +N+  L  G  A    G++      E IAE+
Sbjct: 168 QPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDR-----EHIAER 222

Query: 283 ISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGEL 342
           +  +  +      N  +A++  D +VE     +     + + ++D+  + S     + +L
Sbjct: 223 LGFDGVIG-----NSLQAVSDRDFVVEILFWCSLFMNHISRFSEDL-IIYSTAEFNFVKL 276

Query: 343 SLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGN 376
           S      GSS+MP K NP   E +     ++ G+
Sbjct: 277 S-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 84/189 (44%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +   E 
Sbjct: 126 DIVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       E++ E++++  G  F T         + 
Sbjct: 186 ARNDIGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++    +++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHL 308

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ D L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  +L      GT  GT  +    F       E++ E++++  G  F T         + 
Sbjct: 186 ARNDLGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++    + + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHL 308

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 112/258 (43%), Gaps = 30/258 (11%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +   E 
Sbjct: 126 DIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFER 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQI--SKETGVAFKTAPNKFE 299
           +  ++      GT        A+  G + ++    E++ E +   K   V  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID 245

Query: 300 ALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKIN 359
                   ++    +++ A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 360 PTQNEAVTQVCAQIIGN--NQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFR 417
           P + E V  + A+ +G+  N T+  A  Q  FE  +    +    L S  L  D+  S  
Sbjct: 295 PMRCERVCSL-ARHLGSLFNDTVQTASVQW-FERTLDDSAIRRISLPSAFLTADILLSTL 352

Query: 418 IHCVEGI----KANEERI 431
           ++   G+    K  E RI
Sbjct: 353 LNISSGLVVYPKVIERRI 370

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D LIP++ N+ + L + +  +  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DILIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETG------VAFKTAPNKF 298
           +  ++ F    GT  GT  +    F       E + +++++ +G      V  +T   K 
Sbjct: 186 ARNDIGFRGVKGTT-GTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 299 EALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 356
           +        ++  G +++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 357 KINPTQNEAVTQVCAQI 373
           K NP + E V  +   +
Sbjct: 292 KRNPMRCERVCSLARHL 308

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 87/199 (43%), Gaps = 22/199 (11%)

Query: 186 VTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 245
           + +  D +IP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 246 GRIEHSLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQI--SKETGVAFKTA 294
              E +  ++      GT        A+  G + ++    E++ E +   K   V  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTY 240

Query: 295 PNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIM 354
             K +        ++    +++ A +  K+A DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 355 PGKINPTQNEAVTQVCAQI 373
             K NP + E V  +   +
Sbjct: 290 AYKRNPMRCERVCSLARHL 308

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 186 VTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 245
           + +  D +IP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 246 GRIEHSLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQI--SKETGVAFKTA 294
              E +  ++      GT        A+  G + ++    E++ E +   K   V  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTY 240

Query: 295 PNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIM 354
             K +        ++    +++ A +  K+A DIR L +       E    + + GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAM 289

Query: 355 PGKINPTQNEAVTQVCAQI 373
             K NP + E V  +   +
Sbjct: 290 AYKRNPMRCERVCSLARHL 308

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 82/189 (43%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ D L   + ++  +  +G TH Q A   TLG+  + ++Q L   +   + 
Sbjct: 126 DVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDR 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       E++ +++++  G  F+T         + 
Sbjct: 186 ARNDIGLRGVKGTT-GTQASFLALFHGNHDKVEELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++    + + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHM 308

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 83/189 (43%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ + L + + ++  +  +G TH Q A   TLG+  + ++Q+L   +   E 
Sbjct: 126 DLVIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       E++ E++ +  G  F T         + 
Sbjct: 186 ARNDIGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVVELLG--FDTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++    + + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHL 308

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D LIP++ N+ + L   +     +  +G TH Q A   TLG+  + ++Q+L   +   E 
Sbjct: 126 DILIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       EK+ E++ +  G  F T         + 
Sbjct: 186 ARNDIGLRGVKGT-TGTQASFLALFHGDHNKVEKLDERVVELLG--FDTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++A   +++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHL 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 81/188 (43%), Gaps = 10/188 (5%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D LIP++ N+ D L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DILIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGTAVGTG-----LNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHD 305
           +  ++      GT    G      ++     E + +++++  G  F T         +  
Sbjct: 186 ARNDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRK 243

Query: 306 AIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEA 365
             ++    +++ A +  K+A DIR L +       E    +++ GSS M  K NP + E 
Sbjct: 244 IDIDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCER 300

Query: 366 VTQVCAQI 373
           V  +   +
Sbjct: 301 VCSLARHL 308

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 87/196 (44%), Gaps = 26/196 (13%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ D L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DLVIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQISKET--GVAFKTAPNKFE 299
           +  ++      GT        A+  G + ++    +++ E +  +T   V  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 300 ALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGK 357
                   ++    +++ A +  K+A DIR L +       EL  P  +++ GSS M  K
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYK 292

Query: 358 INPTQNEAVTQVCAQI 373
            NP + E V  +   +
Sbjct: 293 RNPMRCERVCSLARHL 308

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 84/194 (43%), Gaps = 22/194 (11%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ D L   +  +  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DLVIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQISKET--GVAFKTAPNKFE 299
           +  ++      GT        A+  G + ++    +++ E +  +T   V  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 300 ALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKIN 359
                   ++    +++ A S  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 360 PTQNEAVTQVCAQI 373
           P + E V  +   +
Sbjct: 295 PMRCERVCSLARHL 308

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 84/194 (43%), Gaps = 22/194 (11%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ D L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DIIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQISKET--GVAFKTAPNKFE 299
           +  ++      GT        A+  G + ++    +++ E +  +T   V  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 300 ALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKIN 359
                   ++    + + A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRN 294

Query: 360 PTQNEAVTQVCAQI 373
           P + E V  +   +
Sbjct: 295 PMRCERVCSLARHL 308

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 84/191 (43%), Gaps = 16/191 (8%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D LIP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       E + +++++  G  F T         + 
Sbjct: 186 ARNDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLG--FSTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKINPTQ 362
              ++    +++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP +
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMR 297

Query: 363 NEAVTQVCAQI 373
            E V  +   +
Sbjct: 298 CERVCSLARHL 308

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 85/194 (43%), Gaps = 22/194 (11%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ D L   + ++  +  +G TH Q A   T+G+  + ++Q+L   +     
Sbjct: 126 DIIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQISKET--GVAFKTAPNKFE 299
           +  ++      GT        A+  G + ++    +++ E +  +T   V  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID 245

Query: 300 ALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKIN 359
                   ++    +++ A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 360 PTQNEAVTQVCAQI 373
           P + E V  +   +
Sbjct: 295 PMRCERVCSLARHL 308

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 186 VTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 245
           + +  D +IP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 246 GRIEHSLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQI--SKETGVAFKTA 294
              E +  ++      GT        A+  G + ++     ++ E +   K   V  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTY 240

Query: 295 PNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIM 354
             K +        ++    +++ A +  K+A DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 355 PGKINPTQNEAVTQVCAQI 373
             K NP + E V  +   +
Sbjct: 290 AYKRNPMRCERVCSLARHL 308

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 82/189 (43%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D LIP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DILIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       E + +++++  G  F T         + 
Sbjct: 186 ARNDIGLRGVKGTT-GTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++    +++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHL 308

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 80/189 (42%), Gaps = 12/189 (6%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D LIP++ N+ + L   +  +  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGTAVGTGLNTRIGF------AEKIAEQISKETGVAFKTAPNKFEALAAH 304
           +  ++      GT  GT  +    F       E + +++++  G  F T         + 
Sbjct: 186 ARNDIGLRGVKGTT-GTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSR 242

Query: 305 DAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNE 364
              ++    + + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 365 AVTQVCAQI 373
            V  +   +
Sbjct: 300 RVCSLARHL 308

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 84/194 (43%), Gaps = 22/194 (11%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ + L   +  +  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DLIIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRI-GFAEKIAEQISKET--GVAFKTAPNKFE 299
           +  ++      GT        A+  G + ++    +++ E +  +T   V  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 300 ALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKIN 359
                   ++    +++ A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRN 294

Query: 360 PTQNEAVTQVCAQI 373
           P + E V  +   +
Sbjct: 295 PMRCERVCSLARHL 308

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 85/197 (43%), Gaps = 28/197 (14%)

Query: 191 DHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEH 250
           D +IP++ N+ + L   + ++  +  +G TH Q A   TLG+  + ++Q+L   +     
Sbjct: 126 DIIIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVR 185

Query: 251 SLINLKFLAQGGT--------AVGTGLNTRIGFAEKIAEQISKETG------VAFKTAPN 296
           +  ++      GT        A+  G + R+   E + +++++  G      V  +T   
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDRV---EALDKRVTELLGFDIVYPVTGQTYSR 242

Query: 297 KFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPG 356
           K +        ++  G+ ++   +  K+A DIR L +       E    + + GSS M  
Sbjct: 243 KID--------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAY 291

Query: 357 KINPTQNEAVTQVCAQI 373
           K NP + E V  +   +
Sbjct: 292 KRNPMRCERVCSLARHL 308

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 401 NLLSSIRLLGDVSKSFRI---------HCVEGIKANE-ERIADLMNKSLMLVTALNPKIG 450
           N++S+  L G     F+I           VEG    E E++ D   K++ L T  NPK  
Sbjct: 103 NIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYN 162

Query: 451 YDEATKVAKNAHKKGI 466
             +  K+   AHK GI
Sbjct: 163 VPDFEKIVAIAHKHGI 178

>NCAS0I00420 Chr9 complement(63997..66306) [2310 bp, 769 aa] {ON}
           Anc_7.76
          Length = 769

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 16/85 (18%)

Query: 43  FGEIKVPANKYWGAQTERSFENFRIGGPRERM---------PDPVVKAFGVLKKSAAIVN 93
           F  I++P N+ W  +TE   E  R+G     +          D +V    V K    +  
Sbjct: 399 FDRIRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAP--VSKNDWEVAG 456

Query: 94  EGYG-----TLDPQISKVIQEAADE 113
            GYG      +D  I +VI++A DE
Sbjct: 457 FGYGFEVGDDMDNWIIEVIEQAGDE 481

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa]
          {ON} Anc_4.117 YGL006W
          Length = 1162

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 38 IETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVL 85
          ++TD    IKVP N+  G Q  RS + +R  G   R+P+ + K+FG L
Sbjct: 52 LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGDN-RIPERLPKSFGKL 98

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 401 NLLSSIRLLGDVSKSFRI---------HCVEGIKANE-ERIADLMNKSLMLVTALNPKIG 450
           N++S+  L G     F+I           VEG    + E++ D   K++ L T  NPK  
Sbjct: 103 NIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYN 162

Query: 451 YDEATKVAKNAHKKGI 466
             +  K+   AHK GI
Sbjct: 163 VPDFEKIVAIAHKHGI 178

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 401 NLLSSIRLLGDVSKSFRI---------HCVEGIKANE-ERIADLMNKSLMLVTALNPKIG 450
           N++S+  L G     F+I           VEG    + E++ D   K++ L T  NPK  
Sbjct: 103 NIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYN 162

Query: 451 YDEATKVAKNAHKKGI 466
             +  K+   AHK GI
Sbjct: 163 VPDFEKIVAIAHKHGI 178

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 401 NLLSSIRLLGDVSKSFRI---------HCVEGIKANE-ERIADLMNKSLMLVTALNPKIG 450
           N++S+  L G     F+I           VEG    + E++ D   K++ L T  NPK  
Sbjct: 103 NIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYN 162

Query: 451 YDEATKVAKNAHKKGI 466
             +  K+   AHK GI
Sbjct: 163 VPDFEKIVAIAHKHGI 178

>ZYRO0F09262g Chr6 complement(751947..753674) [1728 bp, 575 aa] {ON}
           conserved hypothetical protein
          Length = 575

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 44/112 (39%), Gaps = 9/112 (8%)

Query: 349 PGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNL---LSS 405
           P ++ MP  I P      T   A I  N  T++  GT       V++   I+      + 
Sbjct: 64  PNATAMPSPIAPNATVITTITSAAIQPNGTTVLPGGTTSLSNHTVYQNYTITEAPKPTTY 123

Query: 406 IRLLGDVSKSFRI------HCVEGIKANEERIADLMNKSLMLVTALNPKIGY 451
             ++G V+K+  I       C++G+      + D  N ++    A N  + Y
Sbjct: 124 TAVIGGVTKTTTIGTVVETTCIDGVTIETCPVCDAQNSTVTATPANNQTLTY 175

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 14/105 (13%)

Query: 130 TGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEI 189
           T  G+Q+  N+N+VI    IE+    L       NN +N+ +        V +++  TEI
Sbjct: 483 TELGSQTEENSNDVIHEEIIEIYNDEL-------NNTINKTEEPEKD--EVKYVSLDTEI 533

Query: 190 TDHLIPEVANLRDALESK-----SKDFAHIVKIGRTHLQDATPLT 229
               +      RD L+S      SKD     K+G    +DA  +T
Sbjct: 534 DIQTVQSPTKSRDDLKSDEQIKHSKDIVKQGKMGEVSAKDAIYIT 578

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,155,183
Number of extensions: 1981674
Number of successful extensions: 5714
Number of sequences better than 10.0: 77
Number of HSP's gapped: 5845
Number of HSP's successfully gapped: 77
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)