Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002606.8ON51551527270.0
Kpol_1045.796.8ON50850914440.0
TDEL0G046306.8ON50351212911e-174
SAKL0E00792g6.8ON51151211711e-156
KNAG0E027706.8ON50852111031e-145
Skud_16.56.8ON51552410831e-142
YPL272C6.8ON51752510711e-141
NDAI0G00860singletonON52353410621e-139
Smik_6.4806.8ON51652510521e-138
CAGL0A01089g6.8ON53554710451e-136
Suva_16.336.8ON51852910411e-136
TPHA0M001806.8ON50351610121e-132
KAFR0B065106.8ON5085269871e-128
NCAS0D021806.8ON5155327882e-98
TBLA0A072206.8ON5095347108e-87
Ecym_30116.8ON5095156993e-85
KLTH0C11572g6.8ON5185276838e-83
Kwal_56.223416.8ON5195186384e-76
ACR018C6.8ON4784756093e-72
Kpol_1032.1singletonON2462563469e-37
Kpol_191.16.8ON1391381505e-11
Kwal_27.98985.119ON4601511251e-06
KLTH0C02178g5.119ON4641241027e-04
CAGL0K00737g5.119ON457302980.002
KLTH0E10868g8.466ON34175731.9
TDEL0E051105.119ON469121732.6
AER299C5.67ON51298713.8
KNAG0D011006.221ON59932705.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00260
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...  1055   0.0  
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   560   0.0  
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   501   e-174
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   455   e-156
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   429   e-145
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   421   e-142
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   417   e-141
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              413   e-139
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   409   e-138
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   407   e-136
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   405   e-136
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   394   e-132
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   384   e-128
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      308   2e-98
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   278   8e-87
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   273   3e-85
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   267   8e-83
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   250   4e-76
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   239   3e-72
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   137   9e-37
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    62   5e-11
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    53   1e-06
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    44   7e-04
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    42   0.002
KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} simila...    33   1.9  
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    33   2.6  
AER299C Chr5 complement(1186065..1187603) [1539 bp, 512 aa] {ON}...    32   3.8  
KNAG0D01100 Chr4 (184665..186464) [1800 bp, 599 aa] {ON} Anc_6.2...    32   5.6  

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score = 1055 bits (2727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/515 (100%), Positives = 515/515 (100%)

Query: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF 60
           MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF
Sbjct: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF 60

Query: 61  INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL 120
           INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL
Sbjct: 61  INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL 120

Query: 121 RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS 180
           RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS
Sbjct: 121 RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS 180

Query: 181 EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP 240
           EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP
Sbjct: 181 EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP 240

Query: 241 LNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSL 300
           LNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSL
Sbjct: 241 LNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSL 300

Query: 301 VCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFK 360
           VCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFK
Sbjct: 301 VCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFK 360

Query: 361 LKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIK 420
           LKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIK
Sbjct: 361 LKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIK 420

Query: 421 MMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYT 480
           MMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYT
Sbjct: 421 MMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYT 480

Query: 481 HCKSTGSNICIHFPEVYDLELFVEKFQNFIDGGDE 515
           HCKSTGSNICIHFPEVYDLELFVEKFQNFIDGGDE
Sbjct: 481 HCKSTGSNICIHFPEVYDLELFVEKFQNFIDGGDE 515

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/509 (54%), Positives = 370/509 (72%), Gaps = 9/509 (1%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFIN 62
           FR L +YE+ ++ ++   Q+NG IFSAKY     +   +D  ATLLT +E   + SR +N
Sbjct: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDD--ATLLTNSEPLLLDSRLVN 61

Query: 63  ALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRH 122
           AL  ++ ++PEL TT+N KLEFE + EIKT D+I+S+KF+S KDEFVNC  GAPPYLLRH
Sbjct: 62  ALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRH 121

Query: 123 IFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS-E 181
           IFN++KF PGSGKPLW L ++DDS+V+FHGQDVLFDI++AA+FH+ F   L         
Sbjct: 122 IFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHIT 181

Query: 182 KLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKPL 241
            L  I+R  D +KS  +  FP++IY++P L +P KTIDLV+LQT+ F KS     I KPL
Sbjct: 182 DLEYIYRY-DATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240

Query: 242 NIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSLV 301
           +II FN EPMK +   + +D + + S+LCGTTVFG+I+ +RF+YL SIA  ENVC +S +
Sbjct: 241 DIITFNSEPMK-YIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFI 299

Query: 302 CGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFKL 361
           CGI +LCLK +IKDF+ +ITFSI +NLR+SIE  ++FGLFYK + +E PLS IDD V+  
Sbjct: 300 CGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNN 359

Query: 362 KTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIKM 421
              YNGYD SN  + ET+P +EE+ + YQF QI+  +S  +K+RMRAWRRNGFNDDDIK 
Sbjct: 360 INVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKK 419

Query: 422 MKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYTH 481
           MKF S DK ++ KIIQIND+S+        + + + VS+K+L+FTHS+    FMSLSYT+
Sbjct: 420 MKFTSDDKASNTKIIQINDVSEFK----INSSKSSKVSIKELNFTHSISNSDFMSLSYTY 475

Query: 482 CKSTGSNICIHFPEVYDLELFVEKFQNFI 510
           CK TGSNICIH+P+ YD+E FVE+FQ+F+
Sbjct: 476 CKETGSNICIHYPDAYDMEKFVERFQSFV 504

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  501 bits (1291), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 250/512 (48%), Positives = 349/512 (68%), Gaps = 12/512 (2%)

Query: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF 60
           M FR L  +E+ +L +S E   NG +F A Y+   T    +DDA TLLT  +     S  
Sbjct: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYS--TTPEEWSDDA-TLLTYKDSRLNLSLL 57

Query: 61  INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL 120
              LA +I+++ EL+TTIN KLEF P+ EIK ++VI+++ F S KDEFVNC+ GAPPYLL
Sbjct: 58  SRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLL 117

Query: 121 RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS 180
           RHIFN+  F PGSG  LW +Y+VD+++V+FHG DVLFDI+SAA+FH+ F   L   + + 
Sbjct: 118 RHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSG 177

Query: 181 EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP 240
            KL+TIF+L    + A+  PFPKSIYD+  L LPAK  DL +LQT+ F KS+    + KP
Sbjct: 178 SKLSTIFKL----EKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKP 233

Query: 241 LNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSL 300
           L+ I  N         +   DIL   ++LCGTT+FG I  +R + L  I +++N+C KS 
Sbjct: 234 LDYINSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSF 293

Query: 301 VCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFK 360
           VCGITMLCLKP++K+++ +ITF + ++LR S+E S+EFG+FYK++R+E PLS IDD  F 
Sbjct: 294 VCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFN 353

Query: 361 LKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIK 420
             T YNGYD+S   + E +P Y+EQL+ YQF Q+   +   L+QRM+AW + GFNDDDIK
Sbjct: 354 SLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413

Query: 421 MMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNS-VSLKDLSFTHSLVPDQFMSLSY 479
            MKFGS D  T+ K+IQIND+SD+   P++ + +++    +++L+ T SL P Q MSLSY
Sbjct: 414 RMKFGSDDTATNTKLIQINDVSDI---PVDAHEDISGKFHMRELNMTQSLKPGQLMSLSY 470

Query: 480 THCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           TH +  G +ICIH+P+ Y++E FVE FQ+FI+
Sbjct: 471 THSEK-GLDICIHYPDGYNMESFVECFQSFIE 501

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  455 bits (1171), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 239/512 (46%), Positives = 330/512 (64%), Gaps = 15/512 (2%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLT---QNEENNMFSR 59
           FR L+S E+ +  ++  N+ NG +F+A Y+          D ATLLT   Q   N++ SR
Sbjct: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVSR 66

Query: 60  FINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYL 119
              AL  VI  N ELYTTIN  LEF+P+  I  DDV+  ++F+S KDE VNC +G PPYL
Sbjct: 67  ---ALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYL 123

Query: 120 LRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPT 179
           LRHIF+K+KF     KPLW + IVD+++VIFHG DVLFDI++AA+FH+ F  AL      
Sbjct: 124 LRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKD 183

Query: 180 SEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVK 239
              L  +F+  + SK++    FPKSIY++  L LPA   DL  LQT+ F KSV + TI K
Sbjct: 184 GPTLECLFK--NDSKASF---FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKK 238

Query: 240 PLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKS 299
           PL+ I  N      +  S   DIL   ++LCGTTVFGNIS ER   L+ I ++EN+C  S
Sbjct: 239 PLDFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSS 298

Query: 300 LVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVF 359
            VC I +LCLKPL+ +F S++TFSI ++LR +I +++ FGL YKNV +E PL+ IDD VF
Sbjct: 299 FVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVF 358

Query: 360 KLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDI 419
           +    YNGYD  N+     +PNYEE L+ YQF +  T +   LKQR RAW R+GFNDDDI
Sbjct: 359 QGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDI 418

Query: 420 KMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSY 479
           K MKFG  ++  S +II++N++++  F  ++ N   N   +KD+ FT S   + FMSLS 
Sbjct: 419 KRMKFGKTEQGKSKRIIEVNNVTEFQF-HVDDNATFN---IKDVCFTKSQNLETFMSLSC 474

Query: 480 THCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
              + +G N+CIH+P+ Y++++FVE FQ+F++
Sbjct: 475 AFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  429 bits (1103), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 233/521 (44%), Positives = 328/521 (62%), Gaps = 27/521 (5%)

Query: 4   RPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFINA 63
           R L+S+E+ +L++S +   NGT F A+Y+  +   +  D+ ATLLT  +          A
Sbjct: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWS--DEEATLLTVKDSRLCLGLLTKA 62

Query: 64  LATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRHI 123
           L  +I ++ EL+ TIN + EFE + +IKT DVIS+I+F+S KDE +NC+ GAPPYLLRHI
Sbjct: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122

Query: 124 FNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHR---KFFAALEGATPTS 180
           FN D+FVPGSGKPLW LY++DDS+  FHGQD LFD++S A+FHR   K    L       
Sbjct: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182

Query: 181 EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP 240
           +KL  +F+    S S +    PKSIYD+P L +P    DL +LQT+ F KS+   T+ KP
Sbjct: 183 KKLDYVFKFGPDSMSEVK-QLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKKP 241

Query: 241 LNIIMFNDEPMKSF-TNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKS 299
           +  +   D    S  +N    DIL+  S LCG TVFG +SNERF YL +I  +E +C KS
Sbjct: 242 IEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKS 301

Query: 300 LVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVF 359
            + GI MLCLKP++K+ S  +TFSI ++LR  ++E  +FGL+YK++R+E PLS IDD+  
Sbjct: 302 FIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDD-- 359

Query: 360 KLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDI 419
           K K    G   S         +++E+L+ YQF  I  F+  +L+QR+  + + GFNDDDI
Sbjct: 360 KSKDCMKGASVSEE-------DFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDI 412

Query: 420 KMMKFGSKDKNT------SAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQ 473
           + MKF   DKNT      +   IQI D S ++   +N+ GE NS  ++  + T SL  ++
Sbjct: 413 RRMKF--DDKNTLGGSSNNGTFIQIYDTSLIN---VNEFGEPNSFMIRACNLTKSLNSEE 467

Query: 474 FMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFIDGGD 514
            MSLSYT+C+  G NICIH+PE Y +E FVE FQ+F++ G+
Sbjct: 468 LMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEEGN 508

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  421 bits (1083), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 223/524 (42%), Positives = 336/524 (64%), Gaps = 27/524 (5%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYT---DMQTNSTINDDAATLLTQNEENN---M 56
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+   +   ++  N D  TL T + +++    
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLT 63

Query: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116
                  L  +I   P L+ T+N + EFEP+ ++KT D+++ I+F + KD+ VNC  G P
Sbjct: 64  LPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123

Query: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG 175
           P YLLRH FNK +FVPGS KPLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L  
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNN 183

Query: 176 ATPTSEKL-TTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234
            +  +      +F +SD++ S L   FPKSIYDS  L LPA T  +   QT+ F KS+  
Sbjct: 184 ISLEAHSDDRVLFDISDVNISNLN--FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241

Query: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIA 290
            T+ +P   +  N   +   T++  +    DIL   SSLCGTTVFG ++N+RF+YL+SI 
Sbjct: 242 NTLKRPFGYLT-NQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 291 EEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVP 350
            +E++C +S +CGI M+CLKPL+KDF+  I FSI ++LR +++     GLF+K +RIE P
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360

Query: 351 LSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWR 410
           LS IDD +     S + + A N N KE +  + E+L+ YQFN++   +S  +  ++++W 
Sbjct: 361 LSLIDDEL-----SADEFLA-NRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWE 414

Query: 411 RNGFNDDDIKMMKFGSKD---KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTH 467
           +NGFNDDDI+ MK+ + D   +N+  K+IQIND+SD+S   ++ N +  +  +    FT 
Sbjct: 415 KNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDIS---LSMNNDEKAFKIISSGFTS 471

Query: 468 SLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           S+     MSLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 472 SINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  417 bits (1071), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/525 (42%), Positives = 340/525 (64%), Gaps = 27/525 (5%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYT---DMQTNSTINDDAATLLTQNEENN---M 56
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+     + ++  + D  TL T + +++    
Sbjct: 4   FRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLT 63

Query: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116
                  L  +I   P L+ T+N + EFEP+ ++KT D+++ I+F + KD+ VNC  G P
Sbjct: 64  LPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123

Query: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAAL-E 174
           P YLLRH FNK +FVPGS KPLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L E
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNE 183

Query: 175 GATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234
            +T T  +   +F ++D++ S L   FPKSIYDS  L LPA T  +   QT+ F KS+  
Sbjct: 184 ISTVTHSEDRILFDVNDINLSEL--KFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYY 241

Query: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIA 290
            T+ +P   +  N   + S  ++  +    DIL   +SLCGTTVFG ++N+RF+YL+SI 
Sbjct: 242 NTLKRPFGYLT-NQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 291 EEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVP 350
            +E++C +S +CGI M+CLKPL+KDFS  I F+I +NLR+ +      GLF+K +R+E P
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECP 360

Query: 351 LSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWR 410
           LS IDD +     S N +  ++++ ++ +  + E+L+ YQFN++   +S  +  ++R+W 
Sbjct: 361 LSLIDDEL-----SANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWE 415

Query: 411 RNGFNDDDIKMMKFGSKD----KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFT 466
           +NGFNDDDI+ MK+ + D    +N+  K+IQIND+SD+S   ++ NG+  S  +    FT
Sbjct: 416 KNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDIS---LSMNGDDKSFKIVSTGFT 472

Query: 467 HSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
            S+     MSLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  413 bits (1062), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 228/534 (42%), Positives = 343/534 (64%), Gaps = 35/534 (6%)

Query: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDM---QTNSTINDDAATLLTQNEENNMF 57
           M  R L+S+E+ VL ++ +++ NG  ++A+Y       ++ST++D AATLL   +     
Sbjct: 1   MSIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSD-AATLLATKDIRLNI 59

Query: 58  SRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPP 117
                 L  +I ++ ELY+TIN   EF+ +T+IK +DVIS I F++ KDE +NC +GAPP
Sbjct: 60  GIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPP 119

Query: 118 YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG-- 175
           YLLRHIFNK+KF     KPLW LYI+D++++IFHG D+LFDI+SAA+FH+ FF  L    
Sbjct: 120 YLLRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYF 177

Query: 176 -----ATPTSEKLTTIFRLSDLSKSALT--YPFPKSIYDSPLLMLPAKTIDLVSLQTRFF 228
                +   S+ L  +F+++   K+ +     FP+SI+D+P L LPA T DL +LQT+ F
Sbjct: 178 LTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSF 237

Query: 229 LKSVVSKTIVKPLNIIMFNDE----------PMKSFTNSDPMDILEKTSSLCGTTVFGNI 278
            K++ S TI KP++  +FN             +K +   + +D+L  TSSLCGTTVFG +
Sbjct: 238 FKTIYSNTIKKPID--LFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTV 295

Query: 279 SNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEF 338
           S  R++YL+ + +++ +C +S +CGI M+CLKP IK++S NI FSI +NLR+ I+ +  F
Sbjct: 296 SPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNF 355

Query: 339 GLFYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFI 398
           GLFYK+V+I+ PLS IDD  FK    YNGY  S S   E +  + E+L+ YQF Q+  FI
Sbjct: 356 GLFYKDVKIDCPLSLIDDRNFK----YNGYKDS-SIPDENDLEFNEKLLEYQFKQVTEFI 410

Query: 399 SRNLKQRMRAWRRNGFNDDDIKMMKFGSKDK-NTSAKIIQINDISDLSFCPMNKNGELNS 457
              + +R++ W +  FNDDDIK MKF   +    ++KIIQIND +++     + N +  +
Sbjct: 411 ENVILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNK--A 468

Query: 458 VSLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
            +L + +FT +L  ++FMS+S+  C+ TG N+CIH+P+ Y +E FVE FQ FI+
Sbjct: 469 FTLTNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  409 bits (1052), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/525 (42%), Positives = 335/525 (63%), Gaps = 28/525 (5%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYT---DMQTNSTINDDAATLLTQNEENN---M 56
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+     + ++  + D  TL T + +++    
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLT 63

Query: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116
                  L  +I   P L+ TIN + EFEP+ ++KT D+++ I+F + KD+ VNC  G P
Sbjct: 64  LPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVP 123

Query: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG 175
           P YLLRH FNK +F+PGS +PLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L  
Sbjct: 124 PPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNN 183

Query: 176 -ATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234
            ++ T  +   +F ++++S S L   FPKSIYDS  L LPA T  +   QT+ F KS+  
Sbjct: 184 ISSVTHYEDRILFDINNVSISDLN--FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241

Query: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIA 290
            T+ +P   +  N   + S  ++  +    DIL   SSLCGTTVFG +SN+RF+YL+SI 
Sbjct: 242 NTLKRPFGYLT-NQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 291 EEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVP 350
            +E++C +S +CGI M+CLKPL+KDFS  I FSI ++LR  +      GLF+K +RI  P
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 351 LSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWR 410
           LS IDD +     S N + A NSN  E +  ++E+L+ YQFN +   +S  +  ++++W 
Sbjct: 361 LSLIDDEL-----SVNEFLA-NSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWE 414

Query: 411 RNGFNDDDIKMMKFGSKD----KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFT 466
           +NGFNDDDI+ MK+ + D    +N+  K++QIND+SD+S   ++ N +  S  +    FT
Sbjct: 415 KNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDIS---LSMNNDDKSFKIVSSGFT 471

Query: 467 HSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
            S+     +SLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  407 bits (1045), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 224/547 (40%), Positives = 323/547 (59%), Gaps = 55/547 (10%)

Query: 4   RPLASYERNVLIESYENQTNGTIFSAKY----TDMQTNSTINDDAATLLTQNEENNMFSR 59
           R L+SYER +L E  EN  NGT+F A Y    +        +DD  TL     E+    +
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 60  ---------FINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVN 110
                       AL ++I +NPE+YTT+N  LEF P+ EI+T DVIS + F++ KDE VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 111 CKNGAPP-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKF 169
           C +G PP YL+RHI   D F PGS KPLWNLY++D+S ++FH QD+LFDI+SAA+FH+ F
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 170 FAALEGAT-PTSEKLTTIFRLSDLSKS-ALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRF 227
              L     P       +  L  L KS    Y  PKSIYD+  L LPA   +L++LQT+ 
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 228 FLKSVVSKTIVKPLNIIMF---------------------NDEPMKSFTNSDPMDILEKT 266
           F KS+    + KPL+ I                           +K F  +   +IL   
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLF-RTRYTNILTSA 301

Query: 267 SSLCGTTVFGNISNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAM 326
           +S CG T+FG++SNERF+YL S+ + E +C +S +  ITMLCLKP++K F+  + FS+ M
Sbjct: 302 TSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPM 361

Query: 327 NLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQL 386
           NLRDS+ E  +FGL YK++R+E PLS IDD              S   + E++P Y E+L
Sbjct: 362 NLRDSMNEKRDFGLVYKDIRVECPLSMIDDK-----------QCSVPGLNESDPEYNEKL 410

Query: 387 IAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIKMMKFGSKDKN--TSAKIIQINDISDL 444
           +  QF QIAT+++ +++QRM  W++ G+ND+D+K MKF   D+    + ++I+IND+S++
Sbjct: 411 LEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEV 470

Query: 445 SFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVE 504
           SF     + ++    +K   FT SL  +  MSLSYTHC+  G NICIH+P+ Y++E FV+
Sbjct: 471 SF----DDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVD 526

Query: 505 KFQNFID 511
            F++F++
Sbjct: 527 CFESFME 533

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  405 bits (1041), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 226/529 (42%), Positives = 330/529 (62%), Gaps = 34/529 (6%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDM---QTNSTINDDAATLLTQNEENN---M 56
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+     + ++  + D  TL T + +++    
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRLT 63

Query: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116
                  L  +I   P L+ T+N   E+ P+ ++KT D+++ I+F +TKD+ VNC  G P
Sbjct: 64  LPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVP 123

Query: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG 175
           P YLLRH FNK +FVPGS KPLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L  
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNS 183

Query: 176 ATPTSEKL-TTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234
            T  S      +F ++D++ + L+  FPKSIYDS  L LPA T  ++  QT+ F KS+  
Sbjct: 184 ITSVSRSDDRVLFDINDVNFAELS--FPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFY 241

Query: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM-------DILEKTSSLCGTTVFGNISNERFDYLQ 287
            T+ +P   +        SF++  P        DIL   SSLCGTTVFG ++N+RF YL+
Sbjct: 242 NTLKRPFGYLT----NQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLK 297

Query: 288 SIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRI 347
           SI  +E++C +S +CGI M+CLKPL+KDFS  I FSI ++LR  +      GLF+K +RI
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRI 357

Query: 348 EVPLSFIDDNVFKLKTSYNGYDA-SNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRM 406
           E PLS IDD +     S N +   SN N    N  + E+L+ YQFN++   +S  +  ++
Sbjct: 358 ECPLSLIDDEL-----SINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKL 412

Query: 407 RAWRRNGFNDDDIKMMKFGSKD----KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKD 462
           ++W RNGFNDDDI+ MK+ + D    +N+  K+IQIND+SD+S    N +     VS   
Sbjct: 413 KSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVS--- 469

Query: 463 LSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
             FT+S+     MSLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 470 SGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  394 bits (1012), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/516 (41%), Positives = 318/516 (61%), Gaps = 19/516 (3%)

Query: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEEN--NMFS 58
           MPFR L  YE+ VL ++ E + NG +FS++ T  + +    DD ATL T    N  ++ S
Sbjct: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60

Query: 59  RFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPY 118
               AL  +I  + ELYTTIN +L F P+ +I+T+DVI +I ++ +KD+ +  K+     
Sbjct: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119

Query: 119 LLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATP 178
           LLRHIFNK  F P +GKPLW   I +DS +IFHG DVLFDI+S A+F +     +     
Sbjct: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLN 179

Query: 179 TSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIV 238
           +++KL T+  L           +P+SIY++P L LPA T DL++LQT+ F K++   T+ 
Sbjct: 180 SNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLK 239

Query: 239 KPLNIIM---FNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENV 295
           KP+++I     N+    S   +   DIL   +SLCG TV G IS ER+ +L+ + E+EN+
Sbjct: 240 KPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENI 299

Query: 296 CTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFID 355
             +S +  ITM+CLKP++K+F  +I FSI +NLR  I +S++FGLFYKN+++E PL  I+
Sbjct: 300 SLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIN 359

Query: 356 DNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFN 415
           D  +           +N  +  +  N    L+  QF +I+  +S  + QRM+AW + GFN
Sbjct: 360 DEKY----------YTNPEVLHSMQN--NSLLEIQFERISRHVSDVISQRMKAWEKFGFN 407

Query: 416 DDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFM 475
           DDDIK MKF + +K   A IIQIND++++SF   N N    S S+ +L+FT SL  ++FM
Sbjct: 408 DDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISY-SFSVNNLNFTKSLSCNEFM 466

Query: 476 SLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           SL Y+H    G NICIH+P+ Y++E FVE FQ+FI+
Sbjct: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  384 bits (987), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/526 (41%), Positives = 325/526 (61%), Gaps = 33/526 (6%)

Query: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF 60
           M  R L+SYER +L E+   + NG IF+A Y+    +S    D  TLLT  +     +  
Sbjct: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYS---ASSEEWGDDTTLLTLKDSRPTIAIL 57

Query: 61  INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL 120
             A+  +I+ + EL+TTIN   EFE +  IK DD+++ ++F+S KDE +NC NG PPYLL
Sbjct: 58  TKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLL 117

Query: 121 RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS 180
           RHIF+ ++FVPGS KPLW+L+I+D+S+VIFHGQD+LFDI+SAA+FH+      E     +
Sbjct: 118 RHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLK--ETNIVAN 175

Query: 181 EKLTT-----IFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSK 235
           E L +     IF L +  K        KSIYD+P + LPA + DL +LQT+ F KSV   
Sbjct: 176 EPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHS 235

Query: 236 TIVKPLNIIMFN--------DEPMKSFTNSDP-MDILEKTSSLCGTTVFGNISNERFDYL 286
           T+ KP++ ++ N        D  +   T      DI +  ++L  TTVFG I+ +R++YL
Sbjct: 236 TVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYL 295

Query: 287 QSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEEST-EFGLFYKNV 345
            S+   + +C KS + GI MLCLKP I++F  ++ FSI +NLR  ++ES  EFGLFYK+V
Sbjct: 296 NSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDV 355

Query: 346 RIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQR 405
            I+VPLS IDDN   L    +GY     +  + +P+  E+++ +QF ++ + +   +++R
Sbjct: 356 LIDVPLSLIDDNAVML----SGY----RDFSDNDPDLTEKILEFQFKRVTSLVKDLIERR 407

Query: 406 MRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSF 465
           +  +   GFNDDDI+ MK+G   ++T  KII++ D S++S     ++G+     L + +F
Sbjct: 408 ISKFSTMGFNDDDIRQMKYGKPAEDT--KIIRLFDTSEVSLGSGKRDGK---YILHNTNF 462

Query: 466 THSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           T SL  + F S+SYT C ++G N+C+ FP+  D+E FVE FQ+FI+
Sbjct: 463 TKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  308 bits (788), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 197/532 (37%), Positives = 291/532 (54%), Gaps = 39/532 (7%)

Query: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKY-TDMQTNSTINDDAATLLTQNEENNMFSR 59
           M  R L+ YE  +L ++ + + NG  F+AKY  +   +S  + D +TL++  +     S 
Sbjct: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSV 60

Query: 60  FINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYL 119
               L  +I ++ ELYT I+    +  +TEI+  DVI  I F+S KDE +NC  G PPYL
Sbjct: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120

Query: 120 LRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG---- 175
           LRHIFNK  F  G  KPLW LYI+D++ +IFHG D+LFD +SAA FH+ F A +      
Sbjct: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180

Query: 176 --ATPTSEKLTTIFRLSDLSKSALTY-PFPKSIYD---SPLLMLPAKTIDLVSLQTRFFL 229
             ++   + L  +F+LS  +     Y   P+SIYD   SP   L A    + + QT+ F 
Sbjct: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAV---MFNDQTKSFF 237

Query: 230 KSVVSKTIVKPLNIIMFNDEPMKSFTNS---------DPMDILEKTSSLCGTTVFGNISN 280
           KS+    + KP+  I      +K++            +PM I     SLCG T+FG IS+
Sbjct: 238 KSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGI---HRSLCGNTIFGTISS 294

Query: 281 ERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGL 340
            RF+ L   A  E +  KSL+CG+ M+ LKP + DFS N+ FSI +NLRD + +S  FGL
Sbjct: 295 CRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGL 354

Query: 341 FYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISR 400
           +Y+++ IE PLS IDD   +  + Y  +    +   ET     EQ    QF  + T+I  
Sbjct: 355 YYRDIIIECPLSLIDDRAIQF-SGYRDHVGITAQELETYEKVYEQ----QFKDVTTYIQN 409

Query: 401 NLKQRMRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNS-VS 459
            + +++  W+     D+DIKMMK       +  +IIQIND++++    +N+N   N    
Sbjct: 410 VMNEKIGYWK----TDNDIKMMKMMDDMHQSKDEIIQINDLTEID---INENLSQNDPYC 462

Query: 460 LKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           +K  S   SL   +  S+SYTHC+++G  I IH P++  +E FVE FQ F+D
Sbjct: 463 VKSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  278 bits (710), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 181/534 (33%), Positives = 290/534 (54%), Gaps = 60/534 (11%)

Query: 3   FRPLASYERNVLIESYENQT-NGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFI 61
            RPL+S E+  L  S E++T +G++ S K+    +NS    D ATLL+  ++    S   
Sbjct: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWV---SNSLDISDDATLLSSKDKPLTISLVS 68

Query: 62  NALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLR 121
            AL  +I+ + E++TTIN   EF+ + +I T DV+ SI F + KDE VNC +GAPPYL+ 
Sbjct: 69  RALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLIN 128

Query: 122 HIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTSE 181
           +IF+   F P S KPLW L+IV+ S+V+F+G D LFDI++ A+F +  F  +      ++
Sbjct: 129 YIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENK 188

Query: 182 KLT--TIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVK 239
           ++    IF+L ++ ++     FPKSIYD+P+L LPA   +L +LQT+ F KS+   T  K
Sbjct: 189 EIQDDIIFKLPNI-RNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKK 247

Query: 240 PLNIIMFNDE-PMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIAEEEN 294
             + + F  + P+    N +      +IL   S +    V GN+S ER+  L  + + E 
Sbjct: 248 SFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEK 307

Query: 295 VCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSI---------------EESTEFG 339
           +  KS  C I ++CLK +I  F  +I F I  NLR                  + + E G
Sbjct: 308 IDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELG 367

Query: 340 LFYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFIS 399
           + YK++ +EVPL  I+                    K  N    E ++  QF  +  +I+
Sbjct: 368 IIYKDIYVEVPLKLIE--------------------KIGN----EDVVEEQFKIVCNYIN 403

Query: 400 RNLKQRMRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSF-CPMNKNGELNSV 458
            ++++R++AW +NGFNDDDIK MKFG +       II++ND++ L   C  +     +  
Sbjct: 404 ESIQKRIKAWEKNGFNDDDIKRMKFGYEQ---VGNIIEVNDLTSLDLSCSKD-----SLF 455

Query: 459 SLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFIDG 512
            ++DLS T +L  +Q +SLS+      G N+CI++   Y ++ F++ FQ+F++ 
Sbjct: 456 HIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  273 bits (699), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/515 (33%), Positives = 276/515 (53%), Gaps = 26/515 (5%)

Query: 4   RPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFINA 63
           R L+S E+    E Y ++ NG +F+  Y+  +  S    D  TL    +      +  NA
Sbjct: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQISNA 68

Query: 64  LATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRHI 123
           L  +I EN EL  TI    +F P   I+ DDV+  I+F + KDE + C+NG PPY+LR+I
Sbjct: 69  LEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRNI 128

Query: 124 FNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTSEKL 183
              +KF    G+PLW L IVD ++VI H  +V+FD+++AA+FH KF  AL      +  L
Sbjct: 129 LENNKF--EFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTHAL 186

Query: 184 TTIF--RLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKPL 241
             +F    ++L  S   +     I  SP+  LP + I +        LK     T+ K L
Sbjct: 187 DILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISV--------LKGAYRTTVKKSL 238

Query: 242 NIIMFNDEPMKSFT-----NSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVC 296
           N+I  N       T      SD    +   ++LCGTTV G+++ ER   L  +   ENVC
Sbjct: 239 NVIRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVC 298

Query: 297 TKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDD 356
             S++C IT+L LKPLI+ F+ +ITF + +++R+ + E  + G+ Y N+ +E PLSFI+D
Sbjct: 299 MTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPLSFIND 357

Query: 357 NVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFND 416
             F+  T  +G   S   I   +P+Y E L+ YQF Q+ + +  +LK++ +AW++  F+ 
Sbjct: 358 KDFQ-HTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDM 416

Query: 417 DDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMS 476
             +K  K    +K    K I+IN + D+      ++G+ ++   K+++FT SL     +S
Sbjct: 417 SSLKGKKLRRSNKIIRGKFIEIN-LVDMG---EAQDGQFHT---KNVNFTSSLGSKCLIS 469

Query: 477 LSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           +S    +  G NI +H+PE  D++ FVE FQ  ++
Sbjct: 470 VSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  267 bits (683), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 167/527 (31%), Positives = 270/527 (51%), Gaps = 41/527 (7%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKY------TDMQTNSTINDDAATLLTQNEENNM 56
           +R L   E+ +L E+     NG +FSA Y       D+  N T+  D    + Q   ++M
Sbjct: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSD----MNQRLSDSM 63

Query: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116
             +   AL  VI E+ EL   ++  LEFEP+ +I  +DV+  I+F+   DE VNC NG P
Sbjct: 64  IWK---ALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120

Query: 117 PYLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGA 176
           PYLLRHIF+K  F  G  +PLW L+++D ++V+FHG DVLFD ++AA+FH+ F  AL   
Sbjct: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180

Query: 177 TPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKT 236
           + +      +F+   +  +      P++++        +   D    Q++  L+S+ +  
Sbjct: 181 SESCTSPRPVFKGGKILPT-----LPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLA 235

Query: 237 IVKPLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVC 296
           I KPL  I        +  +S   + L   + LCGT VFG IS  RF  L+ I  +  + 
Sbjct: 236 IKKPLRFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKIS 295

Query: 297 TKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDD 356
            K+ +   T+ CL+P++      ITFS+ +NLRD I  S+  G++++NV IE PL     
Sbjct: 296 MKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGR 355

Query: 357 NVFKLKTSYNG----------YDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRM 406
           N      SY             DA+ +N  + +P   E L    F +  T +S  LK+ +
Sbjct: 356 NSNCSAGSYVSNPELLEGMTLSDANQTNADQADP---ESL----FERTVTHVSNELKKAL 408

Query: 407 RAWRRNGFNDDDIKMMKFGSK--DKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLS 464
           +      F D D+  M+  +K     + +KII+IND+S++    +N +  +    ++D+ 
Sbjct: 409 QDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYV----VEDIC 464

Query: 465 FTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
            T S   + FMS+SY+   + G N+ IH+ E  ++  FVE F+ F++
Sbjct: 465 ATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  250 bits (638), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 164/518 (31%), Positives = 273/518 (52%), Gaps = 22/518 (4%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFI- 61
           +R L + E+ ++ E+     NG +FS+ Y +   N  +++ + ++        +    + 
Sbjct: 8   YRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDN--VDNTSPSVSCMKMGKGLPDAIMW 65

Query: 62  NALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLR 121
            AL+ +I EN EL ++IN  ++FE I  I  DDV+  I+F++  DE V+C NG PPYLLR
Sbjct: 66  QALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLR 125

Query: 122 HIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG-ATPTS 180
           HIF+K  F  G  KPLW ++++D S+V+FHG DVLFD ++AA+FH+ F  AL        
Sbjct: 126 HIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKG 185

Query: 181 EKLTTIFRL-SDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVK 239
           +K   IF+   DL       P  +S+     + L +   D V   ++  LK++ S  I K
Sbjct: 186 QKSDLIFKTREDL------IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKK 239

Query: 240 PLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKS 299
           PL  I            S+P D+      LCGT VFGN++ ER   L+++  E  +  +S
Sbjct: 240 PLRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRS 299

Query: 300 LVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVF 359
            +  +TM CL P+++     I FS+ +NLR+SI  +++ G+F  NV  E PL  I  ++ 
Sbjct: 300 FIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIE 359

Query: 360 KLK--TSYNGYDASNSNIKETNPNYEEQLIAYQ-FNQIATFISRNLK-QRMRAWRRNGFN 415
                +++N      S + +     E+Q      F +I T ++  L+   MR  + +   
Sbjct: 360 PCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSG 419

Query: 416 DDDIKMMKFGSKDKNTS-AKIIQINDISDLSFCPMNKNGELNS-VSLKDLSFTHSLVPDQ 473
           +D IK  +       +S +KI++IND+ ++       + +++S   + D+  T S   D 
Sbjct: 420 EDLIKAEREARYFAASSRSKIVEINDLLEVDL-----SSKIHSRYKIGDVCSTSSRKSDT 474

Query: 474 FMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
           FMS+SY   + +G N+ IH+ E +++E FVE F+ F+D
Sbjct: 475 FMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  239 bits (609), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 152/475 (32%), Positives = 249/475 (52%), Gaps = 35/475 (7%)

Query: 43  DAATLLTQNEENNMFSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFN 102
           D++TL++         +  +AL ++I EN E+  T+    +F P++ I+ DDV+  I+F 
Sbjct: 30  DSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQ 89

Query: 103 STKDEFVNCKNGAPPYLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSA 162
           + KDE + C +G PPY+ RHI NK KF   +GKPLW +YI D S+VIFH  +VLFD+++A
Sbjct: 90  TYKDEAIACHDGIPPYVARHILNKSKF--EAGKPLWEVYIADGSMVIFHCHNVLFDLFAA 147

Query: 163 ASFHRKFFAALEGATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLP-AKTIDLV 221
            +FH +F  AL+          T+F         L  P        P + +P   +   V
Sbjct: 148 GNFHVRFQQALQRCEKNEPHNETLFVYEG---GPLQLPIDPDACSLPGVDVPYPASSPFV 204

Query: 222 SLQTRFFLKSVVSKTIVKPLNIIMFNDEPM----KSFTNSDPMDILEKTSSLCGTTVFGN 277
           S     F+K+V  +  +KP   +     P     +S     P  +     SL GTTV G 
Sbjct: 205 S-----FVKNVC-RYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGY 258

Query: 278 ISNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTE 337
           +++++ D L  +  +E VC +S +C IT+L LKPLI++F  +I FSI ++LR    ++T 
Sbjct: 259 LNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTP 318

Query: 338 FGLFYKNVRIEVPLSFIDDNVFKLKTSYNG-YDASNSNIKETNPNYEEQLIAYQFNQIAT 396
           FG   K + ++ PL+ IDD VF  ++ +N       + + + +P + E L+ YQF ++ T
Sbjct: 319 FGFQSKRILVDCPLALIDDRVF--ESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTT 376

Query: 397 FISRNLKQRMRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELN 456
            + ++L  +            D    +  SK +    KII+IN + D+   P  +     
Sbjct: 377 HVMKSLTAQ---------TSGDWTGKRKYSKCQLRKKKIIEIN-VVDMGTSPSAR----- 421

Query: 457 SVSLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511
              +K+++FT SL  + FMSLS    +  G N+C+H+ E   +++FV+ FQ F+D
Sbjct: 422 -FQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  137 bits (346), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 143/256 (55%), Gaps = 31/256 (12%)

Query: 263 LEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITF 322
           L K S +    +FG I+ ERF+ L+++  +  +C +S++CGI MLC KP I++F  NI F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 323 SIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNY 382
           SI ++++  +++S++FG+  KN+ ++ PL  IDD  +K        D  + +IK  +   
Sbjct: 74  SIGVDMKPIVDDSSQFGILKKNIIVDCPLKLIDDKHYK--------DTDSESIKNGD--- 122

Query: 383 EEQLIAYQFNQIATFISRNLKQRMRA----WRRNG--FNDDDIKMMKFGSKDKNTS-AKI 435
              ++  QF ++  F++  L  ++++    ++RN   FN        F S +   S +K+
Sbjct: 123 ---ILEIQFRKVTDFVTEELSNKLQSMAKHFKRNNCPFN--------FSSINSQISDSKV 171

Query: 436 IQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPE 495
           IQIND++D+ F    +N   N  S  DL  T  L P++ MSLSY    ++  +I IH+ E
Sbjct: 172 IQINDLTDIPFTTTEQNP--NGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTE 229

Query: 496 VYDLELFVEKFQNFID 511
              ++ FVE F+ FI+
Sbjct: 230 TKYMDSFVECFRTFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 69/138 (50%), Gaps = 2/138 (1%)

Query: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFIN 62
            R L   E++ L ++ E   NG IFS K +  +    ++DDA TL T  E  N+    + 
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISK-KCEDNLSDDA-TLHTTGESGNLQLLLLK 59

Query: 63  ALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRH 122
           +L  +I +  EL TT++  L F  + E+KT DV+  I ++  K +     +G    L+  
Sbjct: 60  SLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119

Query: 123 IFNKDKFVPGSGKPLWNL 140
           I+    F PGSGKP   L
Sbjct: 120 IYYHSNFQPGSGKPYGKL 137

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 65/151 (43%), Gaps = 16/151 (10%)

Query: 58  SRFINALATVITENPELYTTINTKLEF---EPITE-IKTDDVISSIKFNSTKDEFVNCKN 113
           S    A+   + E P LY+ + TK E    EPI E I  + V+    +    ++  N   
Sbjct: 36  SEICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYTDYGLLDEDICN--- 92

Query: 114 GAPPYLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQD-VLFDIYSAASFHRKFFAA 172
                    IF + +F  GSGKPLW + +++D   +    D V+ D  S  +F +KF  +
Sbjct: 93  --------KIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGS 144

Query: 173 LEGATPTSEKLTTIFRLSDLSKSALTYPFPK 203
           L     TS     +F  S  +     +P+ +
Sbjct: 145 LNATASTSLVSEVVFEPSVHNSVVPQHPYDR 175

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 16/124 (12%)

Query: 58  SRFINALATVITENPELYTTINTK---LEFEPI-TEIKTDDVISSIKFNSTKDEFVNCKN 113
           S  + A+  V+ E P+LY+ + T+   L  EP+ + +   DV+   +  S  +E  N   
Sbjct: 36  SEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN--- 92

Query: 114 GAPPYLLRHIFNKDKFVPGSGKPLWNLYIV-DDSIVIFHGQDVLFDIYSAASFHRKFFAA 172
                    IF +  FV G+ KPLW + I+ D    +     ++ D  SA  F   F  +
Sbjct: 93  --------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRS 144

Query: 173 LEGA 176
           L  +
Sbjct: 145 LNAS 148

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 121/302 (40%), Gaps = 50/302 (16%)

Query: 58  SRFINALATVITENPELYTTI---NTKLEFEPITE-IKTDDVISSIKFNSTKDEFVNCKN 113
           S FI AL  V+  + +LY      N ++   PI E IK DDV+  + +++  +E +N   
Sbjct: 37  SDFICALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS-- 94

Query: 114 GAPPYLLRHIFNKDKFVPGSGKPLWNLYIVDDS-IVIFHGQDVLFDIYSAASFHRKFFAA 172
                    +F K  F  G  KPLW + +V  +  +IF    + FD  +   F  +   +
Sbjct: 95  ---------VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKS 145

Query: 173 LEGATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDS-----PLLMLPAKTIDLVSLQTRF 227
           LE           + + +DL    + Y  P    DS     P   LP      V      
Sbjct: 146 LE----------ELKQDNDLDVDEIIYR-PGGSTDSIDQCHPYEKLPIPFSWKVKRPIVK 194

Query: 228 FLKSVVSKTIV-KPLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGN--------I 278
            L ++    +V +  +II F++  +       P D L+K S+  G     N        +
Sbjct: 195 ALFTIAPGAVVSQDASIIQFDEYKI-------PEDYLKKNSNDDGCYQIKNTNRQISLKM 247

Query: 279 SNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKD--FSSNITFSIAMNLRDSIEEST 336
           S+ +   +    ++ +V   + +  +  L L  + K+    S I + + MN R+ I  S 
Sbjct: 248 SSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNRISNSG 307

Query: 337 EF 338
           E+
Sbjct: 308 EY 309

>KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} similar
           to uniprot|Q12046 Saccharomyces cerevisiae YDL209C
          Length = 341

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 10/75 (13%)

Query: 250 PMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSL-----VCGI 304
           P +S +N   ++   +  SL G ++FG +SN +   L+ +  EEN+   S+      CG 
Sbjct: 269 PAESPSNKRLLESSAEQESLNGDSIFGRLSNAKLSKLKRVKIEENLSKDSVEIDKQGCGQ 328

Query: 305 TMLCLKPLIKDFSSN 319
           T     PL+  +SS+
Sbjct: 329 T-----PLVNYYSSD 338

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 17/121 (14%)

Query: 59  RFINALATVITENPELYTTINTKLE-----FEPITEIKTDDVISSIKFNSTKDEFVNCKN 113
           +  +AL + I  +P+L+  +    E      + +  IK DDV+  + ++   D  + C  
Sbjct: 40  QIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTI-C-- 96

Query: 114 GAPPYLLRHIFNKDKFVPGSGKPLWNLYI-VDDSIVIFHGQDVLFDIYSAASFHRKFFAA 172
                   HIF    F     KPLW + +   ++ ++      LFD  SA  F + F ++
Sbjct: 97  --------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFMSS 148

Query: 173 L 173
           L
Sbjct: 149 L 149

>AER299C Chr5 complement(1186065..1187603) [1539 bp, 512 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR170W
           (NMD3)
          Length = 512

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 40/98 (40%), Gaps = 5/98 (5%)

Query: 145 DSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTSEKLTTIFRLSDLSKSALTYPFPKS 204
           D+I I   +D L   YS  +   K    L    P   K +      D    A TY F  S
Sbjct: 187 DTISISEAKDGLDFYYSQKNHAVKMLDFLNAVVPVKAKKSEELISQDTHTGASTYKFTYS 246

Query: 205 IYDSP-----LLMLPAKTIDLVSLQTRFFLKSVVSKTI 237
           +  +P     L++LP K    V   T+F L S VS T+
Sbjct: 247 VELAPICRDDLVVLPKKLAHNVGNITQFVLCSKVSNTL 284

>KNAG0D01100 Chr4 (184665..186464) [1800 bp, 599 aa] {ON} Anc_6.221
           YPL208W
          Length = 599

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 398 ISRNLKQRMRAWRRNGFNDDDIKMMKFGSKDK 429
           IS NL +R+  WR NG     + + KFG+ D+
Sbjct: 57  ISNNLAERVFGWRDNGLLKIVVSLFKFGAGDE 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,560,636
Number of extensions: 2841036
Number of successful extensions: 10251
Number of sequences better than 10.0: 68
Number of HSP's gapped: 10569
Number of HSP's successfully gapped: 68
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)