Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002506.7ON1024102445590.0
KNAG0E009706.7ON1004105216970.0
Ecym_30096.7ON1027107415570.0
ACR020C6.7ON1002106215190.0
TBLA0A072106.7ON1041106214810.0
Kpol_1045.806.7ON101969814500.0
KLTH0C11594g6.7ON1006106014360.0
NCAS0F001806.7ON101871413581e-170
NDAI0K029106.7ON106373413411e-167
Suva_5.136.7ON102371712911e-160
Skud_5.346.7ON101971712831e-159
YEL055C (POL5)6.7ON102271712791e-159
Smik_5.326.7ON102071612731e-158
TDEL0G046406.7ON101770112661e-157
SAKL0E00770g6.7ON104772512491e-154
KLLA0D00792g6.7ON102071312371e-152
ZYRO0F00440g6.7ON103971612251e-150
KAFR0L003306.7ON102873212001e-147
CAGL0B03553g6.7ON102170611621e-142
Kwal_56.223346.7ON100872310501e-125
Ecym_61764.128ON1159107850.25
AER329C5.553ON23489771.0
Skud_12.4224.165ON90151727.3
NDAI0G038703.32ON92798727.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00250
         (1024 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...  1760   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   658   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   604   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   589   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   575   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   563   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   557   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   527   e-170
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   521   e-167
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   501   e-160
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   498   e-159
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   497   e-159
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   494   e-158
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   492   e-157
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   485   e-154
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   481   e-152
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   476   e-150
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   466   e-147
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   452   e-142
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   409   e-125
Ecym_6176 Chr6 complement(323400..326809,326910..326979) [3480 b...    37   0.25 
AER329C Chr5 complement(1243379..1244083) [705 bp, 234 aa] {ON} ...    34   1.0  
Skud_12.422 Chr12 complement(740046..742751) [2706 bp, 901 aa] {...    32   7.3  
NDAI0G03870 Chr7 complement(926437..929220) [2784 bp, 927 aa] {O...    32   7.7  

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
            YEL055C
          Length = 1024

 Score = 1760 bits (4559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1024 (86%), Positives = 884/1024 (86%)

Query: 1    MRVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNS 60
            MRVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNS
Sbjct: 1    MRVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNS 60

Query: 61   ARLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXD 120
            ARLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLS              D
Sbjct: 61   ARLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKD 120

Query: 121  ERGTLFGRLFAYKVLLNEPLFSLLFDQKFLIEFQERVIQLGSMKNWLLEPCFFSLYQAIE 180
            ERGTLFGRLFAYKVLLNEPLFSLLFDQKFLIEFQERVIQLGSMKNWLLEPCFFSLYQAIE
Sbjct: 121  ERGTLFGRLFAYKVLLNEPLFSLLFDQKFLIEFQERVIQLGSMKNWLLEPCFFSLYQAIE 180

Query: 181  KLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLENSAWKANDPLQK 240
            KLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLENSAWKANDPLQK
Sbjct: 181  KLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLENSAWKANDPLQK 240

Query: 241  GNLSVMAKVMLDTNVDGANSNTNKNWAPRLHYIWDIILREFFDNEQHGSDAKHVYQKKKH 300
            GNLSVMAKVMLDTNVDGANSNTNKNWAPRLHYIWDIILREFFDNEQHGSDAKHVYQKKKH
Sbjct: 241  GNLSVMAKVMLDTNVDGANSNTNKNWAPRLHYIWDIILREFFDNEQHGSDAKHVYQKKKH 300

Query: 301  DKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESVPASEVEYCFTQNI 360
            DKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESVPASEVEYCFTQNI
Sbjct: 301  DKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESVPASEVEYCFTQNI 360

Query: 361  MRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLTALLFSEEGSLNFDILTKS 420
            MRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLTALLFSEEGSLNFDILTKS
Sbjct: 361  MRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLTALLFSEEGSLNFDILTKS 420

Query: 421  KTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKFILDSLLNLIRSQKA 480
            KTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKFILDSLLNLIRSQKA
Sbjct: 421  KTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKFILDSLLNLIRSQKA 480

Query: 481  LLETDKEIVMEILESTIQLAFFQKDNEYINNIAKERLSSMLAELIVLPSTDGSWPYLALE 540
            LLETDKEIVMEILESTIQLAFFQKDNEYINNIAKERLSSMLAELIVLPSTDGSWPYLALE
Sbjct: 481  LLETDKEIVMEILESTIQLAFFQKDNEYINNIAKERLSSMLAELIVLPSTDGSWPYLALE 540

Query: 541  IIVTKEKSETLIDSLDDSLVAVKAEXXXXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSG 600
            IIVTKEKSETLIDSLDDSLVAVKAE                   GIESLMSMNLIQLYSG
Sbjct: 541  IIVTKEKSETLIDSLDDSLVAVKAESLDILKKISELKSKSSQLLGIESLMSMNLIQLYSG 600

Query: 601  DAESIGIIEDLTTFYHETSNHETANFTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIG 660
            DAESIGIIEDLTTFYHETSNHETANFTGVTEI                  VWEQFIDQIG
Sbjct: 601  DAESIGIIEDLTTFYHETSNHETANFTGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIG 660

Query: 661  KEEINLLLNFLHARENKEGFSVLFENEGDYEVVXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
            KEEINLLLNFLHARENKEGFSVLFENEGDYEVV                           
Sbjct: 661  KEEINLLLNFLHARENKEGFSVLFENEGDYEVVDSENDAEGEEDDENNEKDNDDSDEDSD 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXEKISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGX 780
                                 EKISQIDKETTSALAKALNLPD            MLEG 
Sbjct: 721  DDVSDDDDASLSSSDTDNADDEKISQIDKETTSALAKALNLPDNIINENGEVNINMLEGM 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESREN 840
                                        QLSEIFKRRKDALSTVSTGNQRKLDVKESREN
Sbjct: 781  DEDDDDDSSSAEDDDESMDDEKMMELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESREN 840

Query: 841  VIAFKHRIIDMLEIYIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTL 900
            VIAFKHRIIDMLEIYIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTL
Sbjct: 841  VIAFKHRIIDMLEIYIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTL 900

Query: 901  DKPLIEKIIKLFKGRFSKIRFTLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFC 960
            DKPLIEKIIKLFKGRFSKIRFTLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFC
Sbjct: 901  DKPLIEKIIKLFKGRFSKIRFTLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFC 960

Query: 961  SSTSLYLCRFLIDTTVEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020
            SSTSLYLCRFLIDTTVEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK
Sbjct: 961  SSTSLYLCRFLIDTTVEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020

Query: 1021 QRKA 1024
            QRKA
Sbjct: 1021 QRKA 1024

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1052 (37%), Positives = 587/1052 (55%), Gaps = 81/1052 (7%)

Query: 2    RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
            +V+RD FYKLASD+PEER+ + V ++  L  L +    + EW YVV+RL+KGL S+RN A
Sbjct: 4    KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLP-ASKDEWSYVVNRLIKGLSSDRNGA 62

Query: 62   RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
            RLGFS+CLTE + L +  D  + P  LK +  +L  +   F +                E
Sbjct: 63   RLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKE---E 119

Query: 122  RGTLFGRLFAYKVLLNEPLFSLLFDQ-----KFLIEFQERVIQLGSMKNWLLEPCFFSLY 176
            RG +FG+LFA + LLNEPLFS +F +     KF  +F + ++ L S KNW+ +PC F+LY
Sbjct: 120  RGLMFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLY 179

Query: 177  QAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKK---FTLSDFTLENSAWK 233
            Q IE+LLP  D  + +  V  +D +K T+TNEGL++YLL   K     L    + N  WK
Sbjct: 180  QTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTNKGWK 239

Query: 234  ANDPLQKGNLSVMAKVMLDTNV---DGANSNTNKNWAPRLHYIWDIILREFFDNEQHGSD 290
             N+PL KGNLS++++V+ ++ V   D      N NW P+LH++WDI+L   +++ +    
Sbjct: 240  YNNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPILYNDPRE--- 296

Query: 291  AKHVYQKKKHD------KSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAV 344
             + + +KKKH+      KS+    +EF  FW+A+VDE++F+DKAS ERK+ G LIF KA+
Sbjct: 297  -EPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKAL 355

Query: 345  ESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTPVLTA 403
             +VP+  +  CF+QN+MR +INQ SDS+R L+K+++K L ++V  CE++P  KL PV+ A
Sbjct: 356  PTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVGA 415

Query: 404  LLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPR 463
            LLF   GS+NFD LTKSKTV++L+ATK  +   +  L  LFTS LN S K   +      
Sbjct: 416  LLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELN-SQKNEAV------ 468

Query: 464  LKFILDSLLNLIRSQKALLETDK---EIVMEILESTIQLAFFQ------KDNEYINNIAK 514
            L FILD+LL+++RS K  L+ +     ++  +L   ++L FF       +D   ++ IA+
Sbjct: 469  LHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKINVSEIAR 528

Query: 515  ERLSSMLAELIVLPSTDG-SWPYLALEIIVTKEKSETLIDSLDDSLVAVKAEXXXXXXXX 573
            ER+ S+L+EL  +P+ D  SW +  L  + T E   TL ++LD+ L  VK          
Sbjct: 529  ERIYSILSELSSVPTGDAHSWQFHILNELTTVENELTLTNALDEDLTTVK--DTGLSVIH 586

Query: 574  XXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFY-HETSNHETANFTGVTEI 632
                       GIESL++M L+QLYSG+A+S+  I+++  +   E S+  + +  G+TEI
Sbjct: 587  SLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEI 646

Query: 633  XXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFENEGDYEV 692
                              VWEQ I+ +G +E+NL+L+ L ARENKEGFS LFE   +YE 
Sbjct: 647  LLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEEYEK 706

Query: 693  VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKISQIDKETT 752
            V                                                + ++ ID++T 
Sbjct: 707  V--------------SGDENEVAPEEESASSDTSDSSSDSDDESEEADNKDVTNIDRQTA 752

Query: 753  SALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSE 812
             ALAKAL LP+             ++                              QL++
Sbjct: 753  CALAKALKLPENVVNEDGEVKFNEID--------DLEDESSDDESMDDEAMMALDGQLAD 804

Query: 813  IFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNRADGGKV 872
            IFKRRKDALS V TGN RK++V++SRE+VI FK R+IDML IY+K++E+L L   D    
Sbjct: 805  IFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKD---- 860

Query: 873  VTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTLFEDIETSTE 932
            V  EK    L  +   V+    CVQ+TLD+PL +KI KL K +  K++  +    E    
Sbjct: 861  VMKEK----LQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPV--SAEDGER 914

Query: 933  IMNSLERIH-IHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKMFEKLVDVY 991
             + SL+RIH  +L   K GQ+ A YY  CSS S++ C+ LI++     K     +++D+Y
Sbjct: 915  FVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIES--RDNKDAAHNEVIDIY 972

Query: 992  AATTKIWMQEGKYGAKIFVDFYNWLASKKQRK 1023
            A TTK WM + K+   +F DFYNWL+SK+Q++
Sbjct: 973  AETTKKWMDKKKFPTSVFFDFYNWLSSKRQQQ 1004

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1074 (36%), Positives = 582/1074 (54%), Gaps = 103/1074 (9%)

Query: 2    RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
            +V+RDLFY+LASD+ EER+ + VG+V  L ++ V  + E+EW YV+ RL+KGL S R  A
Sbjct: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEI-VEQDNEQEWQYVLGRLIKGLASARQGA 61

Query: 62   RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
            RLGFSMCL+E + L L     E+ R L+ V  Y+  +  +                  +E
Sbjct: 62   RLGFSMCLSEVVTLGL-----EKGR-LESVEVYIGQLFEKL--------ADGHVKNGKEE 107

Query: 122  RGTLFGRLFAYKVLLNEPLFSLLF------DQKFLIEFQERVIQLGSMKNWLLEPCFFSL 175
            RG +FG+LF  + LLNEPLF  +F      D +F + F + +++L   K WL EPC F+L
Sbjct: 108  RGLVFGKLFGLQALLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTL 167

Query: 176  YQAIEKLLPGLDQ-EYAQATVAQIDEHKLTMTNEGLSVYLLLA-----------KKFTLS 223
            YQ IEKL     +  + +A    +D HKLT+TNEGL++YLLL            K   LS
Sbjct: 168  YQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILS 227

Query: 224  DFTLENSAWKANDPLQKGNLSVMAKVMLDT-NVDGANSNTNKNWAPRLHYIWDIILREFF 282
              TL  S WK NDPL KGN+++++ V+ D   V+        +WAPRLH++WDI++    
Sbjct: 228  KITLR-SCWKNNDPLSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILC 286

Query: 283  DNEQHGSDAKHVYQKKKHDKSKNPQRVE----FKSFWQAVVDESFFNDKASPERKYQGYL 338
              ++    A+HV +K+K DK    ++V     F  FWQ VVDESFFN KAS ERKY G L
Sbjct: 287  RQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLL 346

Query: 339  IFQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLT 398
            I +KA++ VP+S V   F++NIMR++INQ+S+S R L+K+S   L  +VSICES+P K+ 
Sbjct: 347  IIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVL 406

Query: 399  PVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELE 458
            PV+ +L F   GS+NFDILTKSKT+  ++A +     +LA+L+ L  S ++        +
Sbjct: 407  PVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEID--------K 458

Query: 459  ELNP--RLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ------------- 503
            E +P  +++++LD LL+++++ K  L+ D      +L S ++L+FF              
Sbjct: 459  ESSPVSKVRYLLDILLHIVQAHK--LKADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDA 516

Query: 504  -----KDNEYINNIAKERLSSMLAELIVLPST----DG-SWPYLALEIIVTKEKSETLID 553
                  +++ I  +++ERL S+L +LI  P++    DG +WPY+ L+I++ +E   +LI 
Sbjct: 517  HADADAESKKIPVLSRERLFSILGQLI--PTSKQNVDGPTWPYVTLQIVIAEEHRRSLIF 574

Query: 554  SLDDSLVAVKAEXXXXX---XXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIED 610
             LD+ L   K                        G+E L+ + ++Q+YSGDAES  I+E+
Sbjct: 575  KLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEE 634

Query: 611  LTTFYHETSNHETANFTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNF 670
            LTTFY ++ + +     G+TEI                  VWE  ID+I  +E+NLL + 
Sbjct: 635  LTTFY-KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDI 693

Query: 671  LHARENKEGFSVLFENEGDYEVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 730
            L  RENK+GF+ LF  E   E V                                     
Sbjct: 694  LSVRENKQGFAALF--EAADEYVEVDDDEINEDVDISHENCDSSDHNDSHSSSYFEECGS 751

Query: 731  XXXXXXXXXXXEKISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXX 790
                       E I +I+KETTSALA AL LP+                           
Sbjct: 752  NEEDSGNNGYNEYIDKINKETTSALADALKLPENMIDENGDVGFED--------FDDGDE 803

Query: 791  XXXXXXXXXXXXXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIID 850
                              QLSEIFKRRK+ALS V TGN+RKL+V+ESRE+VI+FKHR++D
Sbjct: 804  EEEEEESMDDEAMMELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLD 863

Query: 851  MLEIYIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIK 910
            MLEIY K++ +L+      GK    E ++  L  + +++D    C+QQT+D+PL EK  K
Sbjct: 864  MLEIYCKYVVRLA------GKSQQCEASK--LLNIHSMIDPLLKCIQQTIDRPLAEKAAK 915

Query: 911  LFKGRFSKIRFTLFEDI--ETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLC 968
            L K    K++   F+    E S  +  SLE IH  +   KPGQF   Y+  CS++SL+L 
Sbjct: 916  LLKNHICKLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLG 975

Query: 969  RFLIDTTVEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQR 1022
            + L+ T  + E T  + +++D+Y+ + K W  +GK+G   F+DF NWLASK+ +
Sbjct: 976  KILVVTKPD-EVT--YNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKRSK 1026

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1062 (35%), Positives = 557/1062 (52%), Gaps = 105/1062 (9%)

Query: 2    RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
            +V+RDLFYKL SD+ +ER+ S + ++  L +L+V + G KEW YV+ RLV+GL S+  SA
Sbjct: 4    QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENG-KEWEYVLGRLVRGLASSNKSA 62

Query: 62   RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
            RLGFS+CLTE     L          +    +YL+ +++  P+               +E
Sbjct: 63   RLGFSLCLTEVAAAALENG------HIGSAEEYLERLEAALPVDKVKNGK--------EE 108

Query: 122  RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174
            RG LFGR+F  + +LNEPLFS +F        Q F  +F +R++QL   K WL +PC F+
Sbjct: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168

Query: 175  LYQAIEKLLP-GLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLENSA-- 231
            LYQ IE+L P   D E+ +A +  +DEH LT T+EGL++YL L  K       L+ +   
Sbjct: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228

Query: 232  --------WKANDPLQKGNLSVMAKVMLDTN-VDGANSNTNKNWAPRLHYIWDIILREFF 282
                    WKA++PL KGN   +A V+ D   ++G        W PRLH++WD++L    
Sbjct: 229  DALPLVKRWKADNPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLL- 287

Query: 283  DNEQHGSDAKHVY-----QKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGY 337
              E+  S   HV+     +  K  KS     + F  FWQ VVDESFF++KAS ERKY G 
Sbjct: 288  -AEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGV 346

Query: 338  LIFQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKL 397
            LI +KAV SVP+S V+  F++N +R++INQ+S++ R L+KLS   L T+VS CE++ +K+
Sbjct: 347  LIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKV 406

Query: 398  TPVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPEL 457
             PVLTA+ F   G++NFD LTKSKT   L+  K      L          L +     E 
Sbjct: 407  VPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKS-----LTATELAQLVTLLLQQLEHEN 461

Query: 458  EELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFF------QKDNEYINN 511
             +++ ++KFILD+LL++IR+ K   +        +L + ++ AFF       + +E I  
Sbjct: 462  TDIS-KIKFILDTLLHVIRAHK--WKAHLSWTNPLLLALVRYAFFSAPSHLSEQSEEIIT 518

Query: 512  IAKERLSSMLAELIVLPSTD---GSWPYLALEIIVTKEKSETLIDSLDDSLVAVKAEXXX 568
            +++ERL S+L ELI L   D    SW Y  LE+++ +++   L   LD  L  V +    
Sbjct: 519  LSRERLFSVLGELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALK 578

Query: 569  XXXXXXXXXXXXXXXX----GIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETA 624
                                G+E L+S++++Q+++GD +S   +E+L +FY   +     
Sbjct: 579  ILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADN 638

Query: 625  NFTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684
               G+TEI                  VWE FID++GKEE+ LLLN L ARENK GF+ LF
Sbjct: 639  GLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698

Query: 685  ENEGDYEVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKI 744
            E   +YE +                                                E +
Sbjct: 699  EGADEYEEL----------------GSDEAGTDNEDQSSESNEDSSDEVSDQEDYSDEDV 742

Query: 745  SQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXXX 804
            ++IDKE TSALA AL LPD            +L+                          
Sbjct: 743  AKIDKEATSALAHALRLPD-----------NILDEDGNVGFEEMDDEEEEEESMDDEAMM 791

Query: 805  XXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSL 864
                QLSEIFKRRKDAL+ + TGNQRK++ KESR++VIAFKHR++DMLEIY K++E+   
Sbjct: 792  ELDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVER--- 848

Query: 865  NRADGGKVVTTEKTEQTL-AIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923
                   V   +K   T+ A ML++ +     +QQTLD+PL EKI KL K    K++   
Sbjct: 849  ------SVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAA 902

Query: 924  FEDIETST---EIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEK 980
            +++  +      I+ SLE +H  + + KPGQF   ++  CSSTSL+L + LI    +   
Sbjct: 903  YKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPST 962

Query: 981  TKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQR 1022
            +   E+++ +Y+ T K W   GK+G   F+DF NWLASKK +
Sbjct: 963  S---EQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSK 1001

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/1062 (36%), Positives = 560/1062 (52%), Gaps = 75/1062 (7%)

Query: 3    VDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGE------KEWVYVVDRLVKGLES 56
            V+RD+FY+LASD+ EER+ SVV +V  L++L   +  E      KEW YVV+RL+ GL S
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 57   NRNSARLGFSMCLTEALHLVLSRDVAE-RPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXX 115
            NR  ARLGFS+CLTE L+L LS+      P  L D+  +L  +     +           
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 116  XXXXDERGTLFGRLFAYKVLLNEPLFSLLFDQK---FLIEFQERVIQLGSMKNWLLEPCF 172
                DERG LFG+LFA + LLN+P+F  +F++     L EF   +I L ++KNW+ EP  
Sbjct: 124  LKGKDERGLLFGKLFALQSLLNDPIFGKIFNKDNKAILFEFIYELIALSNLKNWIKEPTL 183

Query: 173  FSLYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA---KKFTLSDFTLE- 228
            F+L+  I+K++  LD+      +  +  + LT+TNEGLS+Y+ L       +  D  ++ 
Sbjct: 184  FTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHISPEDIQIDN 243

Query: 229  --NSAWKANDPLQKGNLSVMAKVMLDTNVDGANS--NTNKNWAPRLHYIWDIILREFFDN 284
              N+ WK NDP  K N+ +++KV+L+T+    +    +N NW PRLHY+WD+IL    + 
Sbjct: 244  NNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSEKHTSNANWTPRLHYVWDVILPILLNP 303

Query: 285  EQHGSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAV 344
            +   S  K + +     +  +  R++F  FW+ V+DESFFN+KAS ERKY G+LI QK  
Sbjct: 304  K---SSDKLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERKYLGFLIIQKTF 360

Query: 345  ESV-PASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTPVLT 402
              +  A+++E  FT N++RS+INQ +DSKR LNK+S KT++ +VS C+S    +L PVL 
Sbjct: 361  PLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNSELRLIPVLN 420

Query: 403  ALLFSEEG--SLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460
              LF EE   S+NFD LTK+KT+SRL+  +      L+ L  LFTS+L+    T EL+  
Sbjct: 421  GFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKLDSFTTTTELQ-- 478

Query: 461  NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDNEY-INNIAKERLSS 519
                 F+LDS+L++IRS K+ +    + +  +LE  I L FF++  +  I+NI K+RL S
Sbjct: 479  -----FLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETADVSISNILKDRLIS 533

Query: 520  MLAELIVLPSTDGSWPYLALEIIV--TKEKSETLIDSLDDSLVAVKAEXXXXXXXXXXXX 577
            +L +L  +     S  YL L +IV   ++    L    DDSL+ VK              
Sbjct: 534  ILNDLTTVGENSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKDSAITTLKRAIEHS 593

Query: 578  XXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHE------TSNHETANFTGVTE 631
                    + SL+S+++IQLY  D +SI  I+DL  FY          N +     G+ E
Sbjct: 594  KRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNTIMKNDKNRPSLGIIE 653

Query: 632  IXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFENEGDYE 691
            I                  +WE FID I   E + + + L  RENKEGF+ LFE + +YE
Sbjct: 654  ILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENKEGFARLFEGDDEYE 713

Query: 692  VVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKISQIDKET 751
             +                                                + I++IDKE 
Sbjct: 714  EI---------DSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESNDDINRIDKEA 764

Query: 752  TSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--- 808
            TSALAKAL LPD             LE                                 
Sbjct: 765  TSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQMMELDG 824

Query: 809  QLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNRAD 868
            QLS+IF RRK+ALS + TGN+RKLDVKESRENVIAFKHRI+DM+E+Y+KHIE ++     
Sbjct: 825  QLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEIIT----- 879

Query: 869  GGKVVTTEKTEQT-----LAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923
                 ++E  E+T     L  +  I+ +   C+QQTLD+ L EKI KL K +  KI+   
Sbjct: 880  ----KSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVE 935

Query: 924  FEDIE--TSTEIMNSLERIHIH-LNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEK 980
            F+D    TS  I+  +  +H   +   K GQ+   Y+  CS +SL+ CR   +T+  A+ 
Sbjct: 936  FKDCGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNAD- 994

Query: 981  TKMFEKLVDVYAATTKIWMQ--EGKYGAKIFVDFYNWLASKK 1020
              +++ L+D+Y  TTK W +  E K    IF DF+NWL+SK+
Sbjct: 995  --LYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/698 (42%), Positives = 449/698 (64%), Gaps = 33/698 (4%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RD FYKLASD+PEER+ S V ++ +L  L    E EKE+ YV++RL+ GL SNRNSA
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61

Query: 62  RLGFSMCLTEALHLVLSRDVAERP-RCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXD 120
           RLGFS+CLTE ++L L R   ++P  CL+ + D+L  VD    L               D
Sbjct: 62  RLGFSLCLTEVVNLALDR--KDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGK--D 117

Query: 121 ERGTLFGRLFAYKVLLNEPLFSLLFD------QKFLIEFQERVIQLGSMKNWLLEPCFFS 174
           ERG +FGR+FA + LLNEPLF+ +F        KF I FQ ++++L  +KNWL EPC F+
Sbjct: 118 ERGIMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFT 177

Query: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLL----AKKFTLSDFTLENS 230
           LYQ +EK +P +D  Y ++ V  +D++KLT+TNEGL++YL L     KK   S   LE+ 
Sbjct: 178 LYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIA-SSLPLESQ 236

Query: 231 AWKANDPLQKGNLSVMAKVMLDTNVDGANS--NTNKNWAPRLHYIWDIILREFFDNEQHG 288
            WK NDPL KGNL  + +V+L++N++ + +      NW+PRLH++WDI+L      +   
Sbjct: 237 GWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQDSTT 296

Query: 289 SDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESVP 348
           +D +HV +K+K  K+ +   ++F+SFW+ VVDESFFN+K+S ERKY G+LI QK++E VP
Sbjct: 297 ND-EHVSKKQKS-KTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQKSLELVP 354

Query: 349 ASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLTALLFSE 408
           A  VE  F QN++RSMINQ++D+KRML+K+SQK LN+++  CE +  K+TP++  +LF E
Sbjct: 355 AQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVKVILFGE 414

Query: 409 EGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKFIL 468
            G+ NFD LTK+KT++++L+ K  +   L+ +  + ++ +  S ++ + ++      F+L
Sbjct: 415 NGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQ------FVL 468

Query: 469 DSLLNLIRSQKALLETD-KEIVMEILESTIQLAFFQKDNEYINNIAKERLSSMLAELIVL 527
           D++L+++R+ K  LE +   I++++L   I LAFF K+NE I+NIAKER  S+L+EL  +
Sbjct: 469 DTILHVVRNHK--LEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAI 526

Query: 528 PSTDGSWPYLALEIIVTKEKSETLIDS-LDDSLVAVKAEXXXXXXXXXXXXXXXXXXXGI 586
            ++  SW Y ALE+I  KE S + ++  +D  L+A+K E                   G+
Sbjct: 527 TTSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIK-EKGIECLKEVTKKSDTVQLRGL 585

Query: 587 ESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEIXXXXXXXXXXXXXX 646
           E L+SM+L+QLY+GD +S+ I+EDL TFY E  + ++ +  G+TEI              
Sbjct: 586 ECLLSMSLLQLYAGDVDSVSIVEDLCTFYDERED-DSVSLVGITEILLALLAQRKAVLKK 644

Query: 647 XXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684
                WEQF+  IG EE+ +L++ L+ARENKEGF+ LF
Sbjct: 645 IALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  228 bits (581), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 172/280 (61%), Gaps = 9/280 (3%)

Query: 746  QIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXXXX 805
            +I+KETTSALAKALNLPD             LEG                          
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEK 797

Query: 806  XXX---QLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQL 862
                  QLSEIFKRRK+ALS+V++GNQRKLDVKESRENVIAFKHRIID+LE YIK++E++
Sbjct: 798  MMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 863  SLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFT 922
            +  + +   +      EQ L  +  +++A   C+Q TLD+PL +KI KL K +  KI  T
Sbjct: 858  TSRKLEDQPI----NKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLT 913

Query: 923  LFEDIETSTE--IMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEK 980
             F++   S +  ++  L+ IH  L T+KPGQ ++ Y+  CS++SL+L + LI+TT   E+
Sbjct: 914  FFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADER 973

Query: 981  TKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020
            +  F +L+D+Y   +K W+ +G++G  +F+DFYNWL SKK
Sbjct: 974  SYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/1060 (34%), Positives = 540/1060 (50%), Gaps = 98/1060 (9%)

Query: 3    VDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSAR 62
            VDRDLFYKLASD+ EER+ +++G+V  L K+   ++  +EW YV++RL+KGL S+RN AR
Sbjct: 6    VDRDLFYKLASDLSEERLQAIIGLVTQLSKV---EKESREWEYVLNRLIKGLSSSRNGAR 62

Query: 63   LGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDER 122
            LG+ +CLTE +   L + V               A   ++                 +ER
Sbjct: 63   LGYCLCLTEVVASALEKSVL--------------AHADEYLRLLLSTLSRENIKNGKEER 108

Query: 123  GTLFGRLFAYKVLLNEPLFSLLF------DQKFLIEFQERVIQLGSMKNWLLEPCFFSLY 176
            G LFG+LF  +VLLNEPLFS +F      + +F++ +   +I +   K W+ E   F+LY
Sbjct: 109  GILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLY 168

Query: 177  QAIEKLLPGL-DQEYAQATVAQIDEHKLTMTNEGLSVYLLL-----------AKKFTLSD 224
            QAIEKL P +  Q+  +A +  +D   LT T+EGL+VYL L            KK  L D
Sbjct: 169  QAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLED 228

Query: 225  FTLENSAWKANDPLQKGNLSVMAKVMLDTNVDGANSNTNKN-WAPRLHYIWDIILREFFD 283
              L NS WK NDPL KGNL  +A  + + N     S   K  W PRLH++WDIIL  FF+
Sbjct: 229  LKL-NSPWKNNDPLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFE 287

Query: 284  NEQHGSDAKH-VYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQK 342
              ++   A     +K+K    +  Q+++F  FW++VVDESFFN+K+S ERKY G+L+F+K
Sbjct: 288  GGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEK 347

Query: 343  AVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLT 402
            A    P S      ++N+ R +INQ   S+R L+K+SQ+ L T+V +C+++P K  P   
Sbjct: 348  AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFE 407

Query: 403  ALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNP 462
             L   E GS++FD LTKSKT++ LL+ K      L  L  + T+ L  S +       + 
Sbjct: 408  TLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRD------HS 461

Query: 463  RLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDNE-----------YINN 511
            R++F+LD++L+L+R+ K+    DK  +  +L+S +Q  FF+ D              ++ 
Sbjct: 462  RVRFLLDAMLHLVRAHKS--AADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSK 519

Query: 512  IAKERLSSMLAELIV--LPSTDGSWPYLALEIIVTKEKSETLIDSLDDSLVAV---KAEX 566
            +A ERL S+LA+LI     S    WP   +EI+++K K   L++ +D+ L  +     + 
Sbjct: 520  LAVERLYSILADLISADYKSEKVCWPRFTVEILMSKLKKNKLLNPMDEELTEILNSSIKT 579

Query: 567  XXXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANF 626
                              G + + S+N++Q YSG+ +SI +++DL +F+     +++ ++
Sbjct: 580  FKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSY 639

Query: 627  TGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFEN 686
             G  EI                  VWE F+ +  +++I +LL  L ARENKEGFS LF  
Sbjct: 640  AGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLF-- 697

Query: 687  EGDYEVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKISQ 746
            EGD E                                                  E   Q
Sbjct: 698  EGDDE-------------GGSDEEEISDELFAEEGASGDNTEEEESGPDSDDQDGEDTEQ 744

Query: 747  IDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXXXXX 806
            IDKE TSAL KALNLP+                                           
Sbjct: 745  IDKEATSALVKALNLPESIVNDNGEVHFED--------LEDTEDEEISDEDLDDEKMMEL 796

Query: 807  XXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNR 866
              QLSEIFKRRK+ALS + TGN+RK +VKESRENVIAFKHR++DMLEI+++  E      
Sbjct: 797  DGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQG 856

Query: 867  ADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTLFED 926
                K VT++     L +         +CV+ TLDKPL EK+ KL K +  K++ T    
Sbjct: 857  GRPEKSVTSKIISIILPL--------ISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTS 908

Query: 927  IETSTEIM--NSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKMF 984
            ++   E +  NSL+ +H  +   K GQF   Y+  CS+ S++L +  +  +   E    +
Sbjct: 909  LDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPE---TY 965

Query: 985  EKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQRKA 1024
              L +VY  T   W   GK+ A +F++F NWL+ KKQ+ +
Sbjct: 966  FTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNS 1005

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
           YEL055C
          Length = 1018

 Score =  527 bits (1358), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 294/714 (41%), Positives = 436/714 (61%), Gaps = 40/714 (5%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLFYKLASD+ EER  + + +V  L  L + DE E EW YVV+RL+KGL S+R+SA
Sbjct: 4   KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETE-EWTYVVNRLIKGLASDRSSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPL-SXXXXXXXXXXXXXXD 120
           RLGFS+CLTE ++L LS      P  L+ + D+L+ +     L +              D
Sbjct: 63  RLGFSLCLTEVINLALSMK-ENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRD 121

Query: 121 ERGTLFGRLFAYKVLLNEPLFSLLFDQK---------FLIEFQERVIQLGSMKNWLLEPC 171
           ERG LFG++F  + + NEP+FS +F  K         F  +F   V+ L   KNW+ E C
Sbjct: 122 ERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESC 181

Query: 172 FFSLYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA------KKFTLSDF 225
            F+L+Q I+KLLP  +++   + ++ +D H L++T+EGL+VYL +        K   S  
Sbjct: 182 LFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSI 241

Query: 226 TLENSAWKANDPLQKGNLSVMAKVMLDTNV-------DGANSNTNKNWAPRLHYIWDIIL 278
             +N  WK NDPL +GNL ++ +V+ D++V       + +      NW PRLH++WDI+L
Sbjct: 242 EFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDILL 301

Query: 279 REFFDNEQH-GSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGY 337
                 +    S+ +H+ +K+K + ++ P+ +EF  FWQ VVDESFFN+KAS ERKY G+
Sbjct: 302 PILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLGF 361

Query: 338 LIFQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-K 396
           LIF K ++ V  +++  CF+ N MRS+INQ++DSKR+L+K+SQ  LNT++ +C+ + + K
Sbjct: 362 LIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSNK 421

Query: 397 LTPVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPE 456
           L   + A++F   GS+NFD LTKSKT+S+L++    D   LA L  LFTS  N+S+K+  
Sbjct: 422 LVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTS--NISEKS-- 477

Query: 457 LEELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDNEYINNIAKER 516
             E   + +++LD+LL+++R+ K  LE D  IV  +L+  IQ AFF K+NE +N +AKER
Sbjct: 478 --ENKQKNRYVLDTLLHIVRTHKTGLEYD-AIVTPLLDPLIQWAFFAKENEPLNELAKER 534

Query: 517 LSSMLAELI-VLPS-TDGSWPYLALEIIVTKEKSET--LIDSLDDSLVAVKAEXXXXXXX 572
            SS+LAEL  V+P     SW Y AL+II+ KE++    L++ LD++L  +K +       
Sbjct: 535 FSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKND-ACDVIV 593

Query: 573 XXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHE-TSNHETANFTGVTE 631
                       G+ESL+SM L+QL+SG+ ES+  IE+L  FY E   + E+ +  G+TE
Sbjct: 594 KIIKSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTSLVGITE 653

Query: 632 IXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFE 685
           I                  VWEQFI  +GKEE+N+LL+ L ARENK+GF+ LFE
Sbjct: 654 ILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFE 707

 Score =  191 bits (484), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 155/277 (55%), Gaps = 14/277 (5%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXX 803
            ++ IDKE TSALAKALNLP+             LE                         
Sbjct: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMM 815

Query: 804  XXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863
                 QLSEIFKRRK+ALST STGNQRK++ KESRENVIAFK R++D+L +Y+K++E+L 
Sbjct: 816  LLDD-QLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQ 874

Query: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923
                       T    Q    +++ V+    CVQ+TLDK L +K+ KL K R  KI+ + 
Sbjct: 875  -----------TADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSST 923

Query: 924  FEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKM 983
            F++     E++  L+++H  L T KPGQ    YY   SS SL+  +  + ++   ++T  
Sbjct: 924  FKNSANPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASS--TDETNA 981

Query: 984  FEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020
            + KL+D Y+ TTK WM + K+G   F DF+NWLAS+K
Sbjct: 982  YNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  521 bits (1341), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 302/734 (41%), Positives = 436/734 (59%), Gaps = 57/734 (7%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLFYKLASD+ EER+ S V ++  L +L+V D+ E EW YV++RL+KGL S+RNSA
Sbjct: 4   KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIE-EWTYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXX-- 119
           RLGFS+CLTEA++L L       P+ ++ + ++L  +    P+                 
Sbjct: 63  RLGFSLCLTEAINLALGMG-DNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKK 121

Query: 120 --DERGTLFGRLFAYKVLLNEPLFSLLF--------DQKFLIEFQERVIQLGSMKNWLLE 169
             DERG LFG+LFA + LLNEPLFS +F        D    I + + +  LGS KNW+ E
Sbjct: 122 GRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRE 181

Query: 170 PCFFSLYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKF--------T 221
            CFF+LYQ IEKLLP  D E+ Q  +  +D+++LT++ EGL++YLL+  +         T
Sbjct: 182 SCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKT 241

Query: 222 LSDFTLENSAWKANDPLQKGNLSVMAKVMLDTNV------DGANSNTNK----NWAPRLH 271
           LSD  L NS WK+N+PL +GNL  +  ++ D+NV      +   +  NK    NWAPRLH
Sbjct: 242 LSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRLH 301

Query: 272 YIWDIIL----REFFDNEQHGSDAKHVYQKKKHDKSKNPQR-VEFKSFWQAVVDESFFND 326
           ++WDI+L        + + +  D     ++KK  K+++    + F  FWQ  +DESFFN+
Sbjct: 302 FVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFFNE 361

Query: 327 KASPERKYQGYLIFQKAVESVP---ASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTL 383
           KAS ERKY G+LIFQK ++S+    A  +  CFT+N MRS+INQ+SD+KR+L+K+SQ  +
Sbjct: 362 KASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIAI 421

Query: 384 NTLVSICESEPA-KLTPVLTALLFSEE--GSLNFDILTKSKTVSRLLATKQSDHHYLATL 440
           +T+V +CE +P+ KL P L ALLF+    GS+NFD LTKSKTVS+L++ K      L  L
Sbjct: 422 DTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLRQL 481

Query: 441 IRLFTSRLNVSDKTPELEELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLA 500
           I+LF S++N      E+  +N   +F LD++L+++RS K+  + D  +V  +L   ++LA
Sbjct: 482 IKLFISQINAMSTEKEITIVN---QFALDTILHVVRSHKSEFDYD-SVVEPLLNPLVKLA 537

Query: 501 FFQKDNEYINNIAKERLSSMLAELIVLPSTDG------SWPYLALEIIVTKEKS--ETLI 552
           FF KDNE +N +AKERL S+L+EL    S+        SW Y  L++I+  EKS  + L+
Sbjct: 538 FFSKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELV 597

Query: 553 DSLDDSLVAVKAEXXXXXXXXXXXXX--XXXXXXGIESLMSMNLIQLYSGDAESIGIIED 610
           + LD  L  +K                       G+E L+SM ++QL+SGD ES+  IE+
Sbjct: 598 NKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEE 657

Query: 611 LTTFYHETSNHETANFTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNF 670
           L  FY  +   E+ +  G+TEI                  VWE FI  IGK E+N+LL  
Sbjct: 658 LVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAV 717

Query: 671 LHARENKEGFSVLF 684
           L  RENK+GF+ LF
Sbjct: 718 LPVRENKQGFAHLF 731

 Score =  205 bits (521), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 166/288 (57%), Gaps = 23/288 (7%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXX 803
            I+ IDKE TSALAKALNLP+             LE                         
Sbjct: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMD 846

Query: 804  XXXXX----QLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHI 859
                     QLSEIFKRRK+ALS +STGNQRK++VKESRENVIAFKHR+IDML IY+K++
Sbjct: 847  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906

Query: 860  EQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKI 919
            E L+L   +G K             +L  ++    CV+QTLDK L +K++KL K +  KI
Sbjct: 907  EGLTLTTENGEK----------FGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKI 956

Query: 920  RFTLFEDIET----STEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTT 975
            + + F+ IE+       +M  L+R H  L T+K GQF + YY  CS+ S++L + L+   
Sbjct: 957  KSSNFQ-IESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVH-- 1013

Query: 976  VEA-EKTKMFEKLVDVYAATTKIW-MQEGKYGAKIFVDFYNWLASKKQ 1021
            VE+ +K   + KL+D+Y  TTK W M +GK+G   F DFYNWL+S++Q
Sbjct: 1014 VESNDKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  501 bits (1291), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 288/717 (40%), Positives = 426/717 (59%), Gaps = 53/717 (7%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLF+KLASD+ EER+ + V ++ +L  L +  + E EW YV++RL+KGL S+RNSA
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSE-EWSYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CLTE ++L ++    +RP+ L+ + D+L  +   F L               DE
Sbjct: 63  RLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTL--SFILDINVNETGKKPVKGKDE 120

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174
           RG LFG+LF  K LLNEPLFS +F       + +F+I F E++I L   KNW+ EPC +S
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180

Query: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230
           L+Q I+ LLP +++  A   +   D++ LT+TNEGLS YLLL     K    S   L+N 
Sbjct: 181 LFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNL 240

Query: 231 AWKANDPLQKGNLSVMAKVMLDTNV---------DGANSNTNKNWAPRLHYIWDIILREF 281
            WK NDPL +GNL ++ KV+ D+ V         D      N NW PRLH++W+I+L  F
Sbjct: 241 GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300

Query: 282 FDNEQHGSDAKHVYQKKKHDKSKN-PQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIF 340
              +    +A+H+ +K+K   +K  P  ++F  FWQ  VDESFFN+KAS ERKY G+LI 
Sbjct: 301 GSGKLE--NAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLII 358

Query: 341 QKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTP 399
               ++VP S + YCF++N+MR++INQ+ DS+R+LNK++Q TL++++  CE +P  KL P
Sbjct: 359 DATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVP 418

Query: 400 VLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEE 459
            L+A+LF   GS+NFD LTK+   S+L+A K+     L  L  LF   L + +K  +L  
Sbjct: 419 CLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFV--LQLQEKKDDL-- 474

Query: 460 LNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ-----KDNEYINNIAK 514
             P   F+LDSLL++IR+ KA +  D EI+  +L   + +AFF+     K++E ++ +AK
Sbjct: 475 --PHTHFVLDSLLHIIRAHKAEI-NDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAK 531

Query: 515 ERLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKSET--LIDSLDDSLVAVKAEX 566
           ERL S+L EL +   + S D    SW +L L +I+  EKS    L + LD+ L   K E 
Sbjct: 532 ERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNE- 590

Query: 567 XXXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANF 626
                             G+ +L+SM LIQLY+G+ +SI +IE+L  F    +  E ++ 
Sbjct: 591 -AISSLTEISKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF----AKDENSSM 645

Query: 627 TGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVL 683
            G+TEI                  +W+QFI  +G +E+ +LL+ L  RENK+GF++L
Sbjct: 646 VGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702

 Score =  219 bits (557), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 173/278 (62%), Gaps = 10/278 (3%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXX 803
            +  IDKE TSAL KALNLPD             LE                         
Sbjct: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLE--GISDDGDGGDDDEDEESMDDEKM 808

Query: 804  XXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863
                 QLSEIFKRRK+ALS++STGNQRK++VKESRENVIAFKHRI+DML IY+KH E+L+
Sbjct: 809  MELDDQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLA 868

Query: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923
            +  A+ G++  + +    L+ ++  +     C+++TLD+PL +KI KL KG+  KIR + 
Sbjct: 869  I--ANKGEL--SIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSA 924

Query: 924  FEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKM 983
            F+D++ + E+++ L+  H  + T+KPGQ +  ++  CS++SL+L +  +D          
Sbjct: 925  FKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDIN----GNDK 980

Query: 984  FEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
            F+ L+D+YA+TTK W Q+GK+GA IF+DF NWL+SKK+
Sbjct: 981  FDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
           YEL055C (REAL)
          Length = 1019

 Score =  498 bits (1283), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 293/717 (40%), Positives = 425/717 (59%), Gaps = 52/717 (7%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLF+KLASD+ EER+ + V ++ +L  L +  + E EW YV++RL+KGL S+RNSA
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAE-EWSYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CLTE ++L ++    +RP+ L+   ++L  + S   L               DE
Sbjct: 63  RLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSS--ILDIYVNDGSKKPVKGKDE 120

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174
           RG LFG+LF  K LLNEPLFS +F       + +F+I F E++I L   KNW+ EPC FS
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180

Query: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230
           L+Q I+ LLP +++  A   +   D++ LT+TNEGLS YL+L     +    S   L NS
Sbjct: 181 LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240

Query: 231 AWKANDPLQKGNLSVMAKVMLDTNV--------DGANSNTNKNWAPRLHYIWDIILREFF 282
            WK NDPL +GNL ++ KV+ D++V          A    N NW PRLH++WD++L  F 
Sbjct: 241 GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300

Query: 283 DNEQHGSDAKHVYQKKKHDKSKNPQR-VEFKSFWQAVVDESFFNDKASPERKYQGYLIFQ 341
             +   ++  H+ +K+K    K  Q  ++F  FW+  VDESFFN+KAS ERKY G+LI  
Sbjct: 301 SGKLENTE--HITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIID 358

Query: 342 KAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEP-AKLTPV 400
              ++VP S +  CF+QN+MR++INQ+ DS+R+LNK++Q TL ++V  CE +P  KL P 
Sbjct: 359 ATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPC 418

Query: 401 LTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460
           L A+LF   GS+NFD LTKS  +S+L+A K+     LA LI  F   L + +K  +L   
Sbjct: 419 LNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFL--LQLQEKRGDL--- 473

Query: 461 NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFF-----QKDNEYINNIAKE 515
            P   FILDSLL++IR+ K  +  D  I+  +L   I +AFF     +++ E ++ +AKE
Sbjct: 474 -PHTHFILDSLLHIIRAHKVEI-NDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKE 531

Query: 516 RLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKS--ETLIDSLDDSLVAVKAEXX 567
           RL S+L EL +   + S D    SW YL L +I+  EKS    LI+ LD+SL  +K E  
Sbjct: 532 RLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNE-- 589

Query: 568 XXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFT 627
                            G+ +L+SM LIQLY+G+ +SI +IE+L  F    + H+  +  
Sbjct: 590 AISSLAEISKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF----TKHDNNSMV 645

Query: 628 GVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684
           G+TEI                  +W+QFI+ +G EE+ +LL+ L ARENK+GF+ LF
Sbjct: 646 GITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702

 Score =  211 bits (538), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 165/280 (58%), Gaps = 14/280 (5%)

Query: 742  EKISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXX 801
            E +  IDKE T AL KAL+LPD             L G                      
Sbjct: 748  EDVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDDEKMMELD 807

Query: 802  XXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQ 861
                   QLSEIFKRRK+ALS +STGNQRK++VKESRENVI+FKHRI+DML +Y+K+ E+
Sbjct: 808  D------QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEK 861

Query: 862  LSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRF 921
            L++      KV  +   E  L+ ++  +     C+++TLDKPL +KI KL KG+  KI+ 
Sbjct: 862  LAI----ANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKA 917

Query: 922  TLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKT 981
              F+ ++ + E+MN L+  H  + T+KPGQ ++ ++  CS++SL+L +       E    
Sbjct: 918  NTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYF----EIGGN 973

Query: 982  KMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
               ++L+D+YAATTK WM +GK+   +F+DF NWL+SKKQ
Sbjct: 974  NALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  497 bits (1279), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 289/717 (40%), Positives = 432/717 (60%), Gaps = 52/717 (7%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLF+KLASD+ EER+ + V ++ +L  L + D+ E EW YV++RL+KGL S+RNSA
Sbjct: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAE-EWSYVLNRLIKGLSSDRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CLTE ++L ++    +RP+ L+   ++L  + +   L+              DE
Sbjct: 63  RLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLST--ILNVNVNEGTKKSMKGKDE 120

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174
           RG LFG+LF  K LLNEPLFS +F       + +F I F E++I L   KNW+ EPCFF+
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230
           L+Q ++ LLP +D+  A+  +   D++ LT+TNEGLS YLLL     +    S   L+N 
Sbjct: 181 LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240

Query: 231 AWKANDPLQKGNLSVMAKVMLDTNV----DGANSNT----NKNWAPRLHYIWDIILREFF 282
            WK NDPL +GNL ++ KV+ +++V    +G    T    N NW PRLH++W ++L  F 
Sbjct: 241 GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300

Query: 283 DNEQHGSDAKHVYQKKKHDKSKNPQR-VEFKSFWQAVVDESFFNDKASPERKYQGYLIFQ 341
           + +    +  H+ +K+K   +K  Q  ++F  FW+  VDESFFN+KAS ERKY G+LI  
Sbjct: 301 NGKLE--NTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIID 358

Query: 342 KAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTPV 400
            A ++VP S + +CF+QN+MR++INQ+ DS+R+LNK+SQ TL+++V  CE + A +L P 
Sbjct: 359 AAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPC 418

Query: 401 LTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460
           L A+LF   GS+NFD LTKS TVS+L+A K+     LA L+ +F   L + DK   L   
Sbjct: 419 LNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFF--LQLQDKKGVLS-- 474

Query: 461 NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDN-----EYINNIAKE 515
                F LDS+L+++R+ K  +  D +I+  +L   + +AFF+  +     E ++ +AKE
Sbjct: 475 --HTLFALDSILHIVRAHKVEI-NDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKE 531

Query: 516 RLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKSET--LIDSLDDSLVAVKAEXX 567
           RL S+L EL +   +   D    SW YL L++I+  E S    LI+ LD++L  +K E  
Sbjct: 532 RLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNE-- 589

Query: 568 XXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFT 627
                            G+ +L+SM L+QLY+GD +SI +IE+L  F    S HE  +  
Sbjct: 590 AISCLSKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEF----SKHENNSMV 645

Query: 628 GVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684
           G+TEI                  +W+QFI+++G EE+ +LL+ L ARENK+GF+ LF
Sbjct: 646 GITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702

 Score =  223 bits (568), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 166/278 (59%), Gaps = 13/278 (4%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXX 803
            I  IDKE TSAL KALNLPD             LEG                        
Sbjct: 752  ILNIDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDD 811

Query: 804  XXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863
                 QLSEIFKRRK+ALS++STGNQRK +VK+SRENVI+FKHR++DML +Y+K+ E+L+
Sbjct: 812  -----QLSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLT 866

Query: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923
            L      K   +     +L+ ++  +     CV +TLD+PL +KI KL KG+  KI+ T 
Sbjct: 867  L----ANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTA 922

Query: 924  FEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKM 983
            F+D+    E+M+ L++ H  + T+KPGQ +A +Y  CS++SL+L +      VE      
Sbjct: 923  FKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLY----VEIGGNDK 978

Query: 984  FEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
             ++L+D+Y ATTK WMQ+GK G  IF+DF NWL+SKKQ
Sbjct: 979  LDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQ 1016

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  494 bits (1273), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 291/716 (40%), Positives = 430/716 (60%), Gaps = 52/716 (7%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLF+KLASD+ EER+ + V ++ +L  L++  + E EW+YV++RLVKGL S+RNSA
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAE-EWLYVLNRLVKGLASDRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CLTE ++L ++    +RP+ L+   D+L  + S   L               DE
Sbjct: 63  RLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSV--LDVNVNDGGKKSVKGKDE 120

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174
           RG LFG+LF  K LLNEPLFS +F       +  F I F E +I L   KNW+ EPCFF+
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFT 180

Query: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230
           L+Q I+ LLP +D+  A   +   D++ +T+TNEGLS YLLL     K    S   L+N 
Sbjct: 181 LFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNL 240

Query: 231 AWKANDPLQKGNLSVMAKVMLDTNV----DGANSNT----NKNWAPRLHYIWDIILREFF 282
            WK++DPL +GNL ++ KV+ D++V    DG + +T    N NW PRLH++WDI+L  F 
Sbjct: 241 GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDILLPLFG 300

Query: 283 DNEQHGSDAKHVYQKKKHDKSKNPQR-VEFKSFWQAVVDESFFNDKASPERKYQGYLIFQ 341
             +   ++  HV +K+K   +K  Q  ++F  FW+  +DESFFN+KAS ERKY G+LI  
Sbjct: 301 SGKLENTE--HVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFLIID 358

Query: 342 KAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESE-PAKLTPV 400
            A ++VP S +  CF+QN+MR++INQ+ DS+R+LNK++Q TL ++V  CE +   KL P 
Sbjct: 359 AAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKLVPC 418

Query: 401 LTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460
           L ++LF   GS+NFD LTKS TVS+L+A K+     L  L+ +F  +L  S +       
Sbjct: 419 LNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDL----- 473

Query: 461 NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ-----KDNEYINNIAKE 515
                FILDS+L++IR+ K  ++ D +++  IL   I +AFF+     ++ E ++ +AKE
Sbjct: 474 -THTHFILDSILHIIRAHKVEID-DMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKE 531

Query: 516 RLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKSE--TLIDSLDDSLVAVKAEXX 567
           RL S+L EL +   + S D    SW +L L++I+  EKS    LI+ LD++L   K E  
Sbjct: 532 RLFSILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEE-- 589

Query: 568 XXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFT 627
                            G+ +L+SM LIQLY+G+ +SI +IE+L  F  + +N    +  
Sbjct: 590 AISSLAEISRSSTAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKDKNN----SMV 645

Query: 628 GVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVL 683
           G+TEI                  +W+QFI+ +G EE+ +LL+ L ARENK+GF+ L
Sbjct: 646 GITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQL 701

 Score =  220 bits (561), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 119/279 (42%), Positives = 168/279 (60%), Gaps = 15/279 (5%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXX 803
            +  IDKE TSAL KALNLPD             LEG                        
Sbjct: 750  VVNIDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDG 809

Query: 804  XXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863
                 QLSEIFKRRK+ALS +STGNQRK++VKESRENVI+FKHRI+DML +Y+K+ E+L+
Sbjct: 810  -----QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLA 864

Query: 864  L-NRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFT 922
            L N+++    + +      L+ ++  +     C+ +TLD+PL +KI KL KG+  KI+  
Sbjct: 865  LANKSEDSSSIGS-----PLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVN 919

Query: 923  LFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTK 982
             F++++ + E+M+ L+  H  L T+KPGQ  A +Y  CS++SL+L +      VE     
Sbjct: 920  AFKEMDKNIEVMDLLKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLY----VEIHGND 975

Query: 983  MFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
              ++L+D+YAATTK W   GK+GA +F+DF NWL+SKKQ
Sbjct: 976  KLDELIDLYAATTKEWTNRGKFGANVFIDFINWLSSKKQ 1014

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  492 bits (1266), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 287/701 (40%), Positives = 413/701 (58%), Gaps = 28/701 (3%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           RV+RD FYKLASD+ EER+ + V ++  L  L + D G  EW YV+ RL+ GL S+RNSA
Sbjct: 4   RVNRDWFYKLASDLQEERVQAAVALIQELSALDLPD-GASEWSYVLKRLINGLSSSRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CLTE ++L L+ +  +RP  L  + D    + S                   DE
Sbjct: 63  RLGFSLCLTEVINLALNLE-GDRPEELSSI-DTFLDLLSSTLSLQPSGQDSKKQIKGKDE 120

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLFDQK------FLIEFQERVIQLGSMKNWLLEPCFFSL 175
           RG LFG++F  + LL+EPLF  +F  K      F + F + + QL   K+WL EPC F+L
Sbjct: 121 RGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFTL 180

Query: 176 YQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKF------TLSDFTLEN 229
           +QA E++LP  D E AQ  +  +D+++LT+TNEGL++YLLL  K       ++     E+
Sbjct: 181 FQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDFES 240

Query: 230 SAWKANDPLQKGNLSVMAKVMLDTNVDGANSNTNK--NWAPRLHYIWDIILREFFDNEQH 287
            +WK+NDPL +GNL ++++V+ D++V   + ++ K  NW PRLH++WDI+L      +  
Sbjct: 241 KSWKSNDPLARGNLPLLSQVLRDSSVATEDESSPKASNWTPRLHFVWDILL-PIITQDNS 299

Query: 288 GSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESV 347
             +++    K K  K +    ++F  FWQ  VDES FN+KAS ERK+ G +IFQKA+E  
Sbjct: 300 RRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIFQKALEVT 359

Query: 348 PASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTPVLTALLF 406
           P   V  CF+QN+MR++IN ASDSKR+L K+S K LN++V IC+  P  KL P L+A+LF
Sbjct: 360 PHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVPCLSAILF 419

Query: 407 SEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKF 466
              GS+NFD LTKSKT + LLA    D   L  L  L +S L  S    +  +     +F
Sbjct: 420 GPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKNQ-----QF 474

Query: 467 ILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDNEYINNIAKERLSSMLAELIV 526
           ILD++L+ +RS K+ L  D  IV  IL   I LAFF   +E+ +N+AKER  S+L+E+  
Sbjct: 475 ILDTMLHAVRSHKSELNKDI-IVTSILRPIISLAFFTVKDEHTSNLAKERFYSILSEITH 533

Query: 527 LPSTDGSWPYLALEIIVTK-EKSETLIDSLDDSLVAVKAEXXXXXXXXXXXXXXXXXXXG 585
           L +   S+  +AL+II  +    + L   LDD+L  VK+E                   G
Sbjct: 534 LNNEGPSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSE-ALRTLQAISNNEKNPQLRG 592

Query: 586 IESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEIXXXXXXXXXXXXX 645
           +E L+SM L+QLYSG++E++ +IE+L  FY +T  + T+   G+TEI             
Sbjct: 593 LEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDENSTS-LVGITEILLSLLAQKKAVLR 651

Query: 646 XXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFEN 686
                 W+QF+ +IG+ E+  LL+ L ARENK+GFS LFE 
Sbjct: 652 KLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLFEG 692

 Score =  181 bits (459), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 129/212 (60%), Gaps = 12/212 (5%)

Query: 809  QLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNRAD 868
            QLS+IFKRRKDALS +STGNQRK + KESRE+VIAFK R+IDMLEIY+K +E+ SL   +
Sbjct: 818  QLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIYVKFVEKQSLKEEN 877

Query: 869  GGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTLFEDIE 928
              K+ +           L +++    C+QQT DK L  +I KL + +  K++ + F    
Sbjct: 878  YSKISSC----------LLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKTSAFCGSC 927

Query: 929  TSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKMFEKLV 988
               E+M  L   H  + T KPGQ  A YY  CS+ SL+L + +I+ +    K      ++
Sbjct: 928  DQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENS--DSKDAAVHDII 985

Query: 989  DVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020
            D+YA T K W   GK+G  IF+DF NWL+S+K
Sbjct: 986  DLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 20/22 (90%)

Query: 742 EKISQIDKETTSALAKALNLPD 763
           + +++IDKE TSALAKALNLPD
Sbjct: 743 DDVAKIDKEATSALAKALNLPD 764

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  485 bits (1249), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 284/725 (39%), Positives = 426/725 (58%), Gaps = 66/725 (9%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +++RDLFYKLASD+ EER+ + + ++  L  L   D    EW YV++RL+KGL SNRNSA
Sbjct: 4   KINRDLFYKLASDLQEERVQAAISLIKELASLENNDS---EWEYVLNRLIKGLSSNRNSA 60

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CLTE L + L +        L  + +Y++ + S                   +E
Sbjct: 61  RLGFSLCLTEVLSVALEKGY------LNSIEEYIQLLQSTL--------LKETVKNGKEE 106

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLFDQK-------FLIEFQERVIQLGSMKNWLLEPCFFS 174
           RG LFGR+F  + LLNEPL S +F  K       F++ F   ++Q+   K W+ EPC F+
Sbjct: 107 RGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFT 166

Query: 175 LYQAIEKLLPGLDQEYAQATVAQI-DEHKLTMTNEGLSVYLLL------AKKFTLSDFTL 227
           L+Q +EKL P L+      ++ ++ D++KL++TNEGL++YL L        KF      L
Sbjct: 167 LFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLL 226

Query: 228 EN----SAWKANDPLQKGNLSVMAKVMLDTN-VDGANSNTNKNWAPRLHYIWDIILREFF 282
           +N    S WK NDPL KGNL  ++ V+ D + V+ +      +WAPRLH++W+IIL    
Sbjct: 227 KNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILA 286

Query: 283 -DNEQHGSDAKHVYQKKKHDKSKNPQ--RVEFKSFWQAVVDESFFNDKASPERKYQGYLI 339
            D++  GS  +H+ +K+K +K+K+ Q   +EF  FW+AVVDESFFN+K+S ERKY G+LI
Sbjct: 287 RDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLI 346

Query: 340 FQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTP 399
            + A + VP S V   F++N+MR++INQ+SDSKR+L+K+SQK L +++ +CES P K  P
Sbjct: 347 LEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVP 406

Query: 400 VLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEE 459
            + A+LFSE G++NFD LTK+KTV  L+A       +L++L+ LF S L   D   E   
Sbjct: 407 SIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHL--PDDPNEEAA 464

Query: 460 LNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ----------KDNEYI 509
           L    +F+LDS+L+++R+ K +  +DK  V  ++ S I + FF+          +D+++ 
Sbjct: 465 LT---RFLLDSMLHVVRTHKTV--SDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHT 519

Query: 510 NNI---AKERLSSMLAELIVLPST---DGSWPYLALEIIVTKEKSETLIDSLDDSLVAVK 563
           +     A+ERL S+LA+LI L        SWPY+ L++++++E+S+ LI  LDD L  +K
Sbjct: 520 DGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIK 579

Query: 564 AEXXXXXXXXXXXXXXXXXXX---GIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSN 620
            +                      G+E L+SM ++Q+Y GD ES+ ++EDL TFYH   +
Sbjct: 580 LDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRD 639

Query: 621 HETAN-FTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEG 679
               N   GV EI                  VWE F+D++G  E+ +L + L ARENKEG
Sbjct: 640 SSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEG 699

Query: 680 FSVLF 684
           F+ LF
Sbjct: 700 FTALF 704

 Score =  190 bits (483), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 157/284 (55%), Gaps = 21/284 (7%)

Query: 742  EKISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXX 801
            E I++IDKETTSALAKALNLPD             L                        
Sbjct: 777  EDINKIDKETTSALAKALNLPDGIINENGEVNFNELS---ESDDEDESEEDEDEESMDDE 833

Query: 802  XXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQ 861
                   QLS+IF+RRK+ALS +STGN+RKL+ KESRENVIAFKH+++DMLE+++K +E+
Sbjct: 834  KMMELDDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVER 893

Query: 862  LSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRF 921
             S N+  G         E  L  + ++      CVQQT DK L +K+ KL K R  K++ 
Sbjct: 894  TSKNKECG---------ETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKL 944

Query: 922  TLF----EDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVE 977
                   +DIE  T  +++L  +H  +  +K GQF   Y+  CS  SL+L + L+  +  
Sbjct: 945  PKLINDSDDIEELT--ISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQAST- 1001

Query: 978  AEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
                 ++++L+D+Y +T K W  +GK+G   F DF NWLASKKQ
Sbjct: 1002 --NDSIYDRLIDIYLSTMKKWFSKGKFGTSFFFDFINWLASKKQ 1043

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  481 bits (1237), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 280/713 (39%), Positives = 415/713 (58%), Gaps = 46/713 (6%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSV--GDEGEKEWVYVVDRLVKGLESNRN 59
           RV+RDLF+K+AS++ +ER+ + + ++  + ++     ++G +EW YV+ RLVKGL SNR 
Sbjct: 9   RVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASNRG 68

Query: 60  SARLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXX 119
            ARLGFSMCLTE + L L     ER   L  +  +L  ++   P                
Sbjct: 69  GARLGFSMCLTEVIALAL-----ERRDILPSIYAFLNQLEQTLPAGTAFKNGK------- 116

Query: 120 DERGTLFGRLFAYKVLLNEPLFSLLF--------DQKFLIEFQERVIQLGSMKNWLLEPC 171
           +ERG LFG++FA + LLNEP+FS LF        + +FL+ +  ++IQL   K WL EPC
Sbjct: 117 EERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPC 176

Query: 172 FFSLYQAIEKLLPGL--DQEYAQATVAQIDEHKLTMTNEGLSVYLLL-AKKFTLSD-FTL 227
            +S+YQ I+K    L  D       +  +DE KLT+TNEGLS+YL+  A++ T S    +
Sbjct: 177 LYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDTYSSSLVI 236

Query: 228 ENSAWKANDPLQKGNLSVMAKVMLDT-NVDGANSNTNKNWAPRLHYIWDIILREFFDNEQ 286
            NS WK NDPL KGN+ ++A V+ D   V+ ++      WAPRLHY+WDI+L    D+  
Sbjct: 237 HNSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTWAPRLHYVWDILLPLLEDDGS 296

Query: 287 HG-SDAKHVYQKKKHD----KSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQ 341
            G S   H+ +K+K +     S+   R++F  FWQAVVDESFFN+K+S ERKY G+LI +
Sbjct: 297 FGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLILE 356

Query: 342 KAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVL 401
           +A++      ++   +QN++R +INQ+ DS+RMLNK+S + L ++V+ CE  PAK+ P++
Sbjct: 357 EAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVPLV 416

Query: 402 TALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELN 461
               F   GS+NFD L KSK V+ L++T   +  +L  L+ L  S+L     T +   L 
Sbjct: 417 EVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFNLT 476

Query: 462 PRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFF-QKDNEYINNIAKERLSSM 520
              +FI D+ L++ R+ K  LE+    V  +L + I+ AFF + DN  ++ +AKERL S+
Sbjct: 477 ---RFIFDTFLHITRAHKTRLES--HWVKPLLSAIIKAAFFNESDNSKLSELAKERLYSI 531

Query: 521 LAELIVLPSTD----GSWPYLALEIIVTKEKS-ETLIDSLDDSLVAVK--AEXXXXXXXX 573
           L ELI  PS       +WPY+AL+II+  E S  TL   LD+ L +V+  A         
Sbjct: 532 LGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKSLKQNHS 591

Query: 574 XXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEIX 633
                      G+E L+S+ ++QLY+GD ES+ I++DL +FY E  + E+ +  G+TEI 
Sbjct: 592 DNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEEC-DKESTDLVGITEIL 650

Query: 634 XXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFEN 686
                            VWE F+  IG+ E+N+LL  L ARENK+GF+ LFE 
Sbjct: 651 LSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLFEG 703

 Score =  180 bits (457), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 158/282 (56%), Gaps = 20/282 (7%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXX-XXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXX 802
            + +I+KE TSALAKALNLPD               E                        
Sbjct: 752  LEKIEKEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEA 811

Query: 803  XXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQL 862
                  QLSEIFKRRK+AL +V TGN+RK++V+ESRENVI+FKHR++DMLEIY+K     
Sbjct: 812  MMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVK----- 866

Query: 863  SLNRA---DGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKI 919
            S +RA   +   ++T E+     +I+L ++     C+Q TLDK L +K  KL K R  K+
Sbjct: 867  SFDRAVARNNTSIITVEEWNNLSSIILPLL----KCLQHTLDKALADKCAKLMKLRLCKV 922

Query: 920  RFTLFEDIETST-EIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEA 978
            + T+ ++ +T T EI + LE++H  + T KPGQF   ++  CS  SL+L +  + +    
Sbjct: 923  KATIAKEEKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSS---- 978

Query: 979  EKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020
                  E L+D+YA T+K WM++GK     F+DF NWL +K+
Sbjct: 979  --GGSHENLIDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  476 bits (1225), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 282/716 (39%), Positives = 430/716 (60%), Gaps = 47/716 (6%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RD FY+LASD+ +ER+ + V ++  L  L +    E EW YV+ RL+ GL S RNSA
Sbjct: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNE-EWSYVLKRLISGLASGRNSA 62

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFS+CL+E + + L +     P+ L     YL+ + +   LS              DE
Sbjct: 63  RLGFSLCLSEVVKMALDKGTLA-PQDLSSPDQYLELLSNN--LSPDAVGKSKKDLKGKDE 119

Query: 122 RGTLFGRLFAYKVLLNEPLF-SLLFDQK-----FLIEFQERVIQLGSMKNWLLEPCFFSL 175
           RG LFG++F  + +LNEPLF S+ FDQ+     F + F + + +L   KNWL E C ++L
Sbjct: 120 RGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTL 179

Query: 176 YQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLL--------AKKFTL-SDFT 226
           +Q +++L+P ++ E   + +  +D+++LTMTNEGL++YLLL         K F + S   
Sbjct: 180 FQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLA 239

Query: 227 LENSAWKANDPLQKGNLSVMAKVMLDTNV------DGANSNTNKNWAPRLHYIWDIILRE 280
           LE +AWK NDPL KGNL  +++V+ D         DG++  +  NW PRLH++WDI++  
Sbjct: 240 LEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKS-ANWNPRLHFVWDILIPI 298

Query: 281 FFDNEQHGSDAKHVYQKKKHDKSKNP-QRVEFKSFWQAVVDESFFNDKASPERKYQGYLI 339
               +   SD +   +K    K K+  + +EF  F+QA VDE+FF++KAS ERKY G+L+
Sbjct: 299 LAPGK---SDEEIPSKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLV 355

Query: 340 FQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLT 398
           F +AVE V +  ++ CFTQN MR++INQ+SDSKR+LNK+SQK L+ +V  CE + + K+ 
Sbjct: 356 FIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIA 415

Query: 399 PVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELE 458
             L A+LF   G+++FD LTKSKT S+L+A K      L  L  + +++L     + E E
Sbjct: 416 LCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQL-----SREEE 470

Query: 459 ELNPRLKFILDSLLNLIRSQKALLETDKEIVME-ILESTIQLAFFQKDNEYINNIAKERL 517
                 +F+LD++L+ +R+ +  LE  +E++   +L+S + LAFF K  E I+++A+ERL
Sbjct: 471 PNKQHYQFVLDTVLHAVRTHR--LEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERL 528

Query: 518 SSMLAELIVLPSTDG-SWPYLALEIIVTKE-KSETLIDSLDDSLVAVKAEXXXXXXXXXX 575
            S+L+EL +    DG SW +  L++I++KE +    I+ LD+ L A++ E          
Sbjct: 529 FSILSELTI--QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETE---ALDILQN 583

Query: 576 XXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEIXXX 635
                    G+E L+S  L+QLYSGD+ES+ I+E+L  FY E  N E+ +  G+TEI   
Sbjct: 584 ISSDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLN-ESNSLVGITEILLS 642

Query: 636 XXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFENEGDYE 691
                          VWEQF+ ++G++E+ +LL  L ARENKEGF+ LFEN  DY+
Sbjct: 643 LLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFENVDDYQ 698

 Score =  209 bits (533), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 166/287 (57%), Gaps = 15/287 (5%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXX---------XXXXXXXXXXX 794
            +++ID+E TSALAKALNLP+             LE                         
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 795  XXXXXXXXXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEI 854
                          QLS+IFKRRK+ALS V+TGN+RK++VKE+RENVI FKHRI+DMLE 
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 855  YIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKG 914
            YIKH ++++L   D      ++ T + L +    V+    C+Q TLDKPL +KI KL KG
Sbjct: 875  YIKHADRIALQ--DNNDEANSKDTFKNLFLF---VEPMIRCLQLTLDKPLADKISKLLKG 929

Query: 915  RFSKIRFTLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDT 974
            R  KI+ + F+    S  ++  LE  H  L T+KPGQF A Y+  CS+TSL+L + L++ 
Sbjct: 930  RLYKIKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVEN 989

Query: 975  TVEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
              E +    + +++D+YA TTK W+  GK+GA +F DF+NWL S+K+
Sbjct: 990  NSE-DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  466 bits (1200), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 291/732 (39%), Positives = 427/732 (58%), Gaps = 62/732 (8%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RDLFYKLAS++ EER+ + V ++  L  L + D  E EW YV+ RL+KGL S+R  A
Sbjct: 7   KVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTE-EWNYVLGRLIKGLSSDRTGA 65

Query: 62  RLGFSMCLTEALHLVLSRDVAERP---RCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXX 118
           RLGFS+CLTE ++L +  D+A +      L ++  YL  +     +              
Sbjct: 66  RLGFSLCLTEVINLAI--DLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 119 XDERGTLFGRLFAYKVLLNEPLFSLLF--DQKFLIEFQER----VIQLGSMKNWLLEPCF 172
            DERG LFG++F  K LLNEPLFS  F  ++K    F ER    ++ L S KNW+ EPC 
Sbjct: 124 -DERGLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 173 FSLYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLL-------AKKFT--LS 223
           F+L+Q +EKLLP  D E+ +  +  +D+HK T+TNEGL++YLLL        K+F   + 
Sbjct: 183 FTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIK 242

Query: 224 DFTLENSAWKANDPLQKGNLSVMAKVMLDTNVDGANSNT---NKNWAPRLHYIWDIILRE 280
              L+NS+WK NDPL +GNL  + +V+ ++++          + NW PRLH++WDI+L  
Sbjct: 243 LLVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWDILLPT 302

Query: 281 FFDNEQHGSDAKHVYQKKKHDKSKNPQR---VEFKSFWQAVVDESFFNDKASPERKYQGY 337
               E + SD KH+ +++K  K+K P+    + F  FWQ  VDESFFN+KAS ERKY G+
Sbjct: 303 VSTIESN-SDEKHMSKRRK--KNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYLGF 359

Query: 338 LIFQKAVESVPAS-EVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA- 395
            IF++A+  V      E CF+QN MRS+INQ+SD+ R+L+K+S + +NT+V  CE  P+ 
Sbjct: 360 SIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPST 419

Query: 396 KLTPVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTP 455
           KL PV+ ++LF+  GS NFD LTKSKTVS+L++      H L  L  + TS++ V     
Sbjct: 420 KLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGT--- 476

Query: 456 ELEELNPRLKFILDSLLNLIRSQKALL------ETDKEIVME-ILESTIQLAFF------ 502
              E   + +FILDSLL+++RS K  +       T+ E++++  +   ++LAFF      
Sbjct: 477 --SEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIA 534

Query: 503 ----QKDNEYINNIAKERLSSMLAELIVLPSTD-GSWPYLALEIIVTK--EKSETLIDSL 555
               + DN+ ++ +AKERL S+L+EL    +    SW Y  L  I+ +  E   +LI+ +
Sbjct: 535 KKEDESDNQ-VDELAKERLFSVLSELTTTTNKQLHSWQYYTLLEIIDRENENPNSLINKM 593

Query: 556 DDSLVAVK--AEXXXXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTT 613
           DD L  V+  A                    G+ESL+SM L+QLYSGDA+S+  IE+L T
Sbjct: 594 DDDLKTVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELIT 653

Query: 614 FYHETSN-HETANFTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLH 672
           FY+ + +  E     G+TEI                  VWEQF+ +I ++ +NLLL+ L 
Sbjct: 654 FYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVLP 713

Query: 673 ARENKEGFSVLF 684
           ARENK+GF+ LF
Sbjct: 714 ARENKQGFAELF 725

 Score =  204 bits (518), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 163/283 (57%), Gaps = 28/283 (9%)

Query: 742  EKISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXX 801
            E I++IDKE TSALAKALNLPD             L                        
Sbjct: 773  EAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDD- 831

Query: 802  XXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQ 861
                   QL+EIFKRRK+ALS+VSTGNQRK++VKESRE+VIAFKHR+ D+L IYIKH   
Sbjct: 832  -------QLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKH--- 881

Query: 862  LSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRF 921
                          E +E      +  ++    CVQQTLDK L +KI KL K +  K++ 
Sbjct: 882  -------------AEDSELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKT 928

Query: 922  TLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKT 981
               E+I T+ ++ + +  +H  L T+KPGQ+   +Y  CSSTS++L + L+   V  +K 
Sbjct: 929  KNMEEI-TAEQVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLL--LVSNDKE 985

Query: 982  KMFEKLVDVYAATTKIW-MQEGKYGAKIFVDFYNWLASKKQRK 1023
            + + K+VD+Y+ TTK W +++ K+G+ IF+DFYNWL+SKK  K
Sbjct: 986  EAYGKIVDIYSETTKKWVLKDSKFGSNIFIDFYNWLSSKKSTK 1028

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  452 bits (1162), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 275/706 (38%), Positives = 407/706 (57%), Gaps = 39/706 (5%)

Query: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61
           +V+RD FYKLASD+PEER+ + VGV+ +L  L V  E E EW Y ++RLVKGL S+RNSA
Sbjct: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIE-EWNYTINRLVKGLGSSRNSA 61

Query: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXDE 121
           RLGFSMCL+EAL+L LS    + P  L  + +YLK ++     +              DE
Sbjct: 62  RLGFSMCLSEALNLALSLG-DKAPEGLNSIENYLKILNE----TLGADFDEGKKRKGKDE 116

Query: 122 RGTLFGRLFAYKVLLNEPLFSLLFDQK-----FLIEFQERVIQLGSMKNWLLEPCFFSLY 176
           RG LFG+LF  + LLNEPLFS +F  K     F+  F + +I L   KNW+ EP  FSLY
Sbjct: 117 RGILFGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176

Query: 177 QAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA------KKFTLSDFTLENS 230
           Q +EKL+  + +      ++Q+DE+ LTMTNEGL++YLLL        +  +++  L+N 
Sbjct: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236

Query: 231 AWKANDPLQKGNLSVMAKVMLDTN-VDGANSNTNK------NWAPRLHYIWDIILREFFD 283
            WK+NDPL KGNL  + KV+LD + V  A  N  +      NW PRLH++W+ +L     
Sbjct: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII- 295

Query: 284 NEQHGSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKA 343
           N  H  + +  +  KK  K+     ++F  FWQ VVDE++FNDKAS ERKY G+LIFQ+A
Sbjct: 296 NGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRA 355

Query: 344 VESVPASE-VEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLT 402
              + + E V     QN +RS+INQ S+ KR LNK++ +T+  +V  CE++  K+ PV  
Sbjct: 356 FPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVFE 415

Query: 403 ALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNP 462
            L F + GS+ FD L+K+K +SRLL  K   +  L+ L  + + +L++  +     +   
Sbjct: 416 TLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQ--- 472

Query: 463 RLKFILDSLLNLIRSQKALLETDKEIVME-ILESTIQLAFFQKDNEYINNIAKERLSSML 521
              FILDS+L+L+R+QKA  E D  ++ E +L   ++LAFF  DNE +  ++KERL S+L
Sbjct: 473 ---FILDSMLHLVRNQKA--EVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFSIL 527

Query: 522 AEL--IVLPSTDGSWPYLALEIIVTK-EKSETLIDSLDDSLVAVKAEXXXXXXXXXXXXX 578
           +EL  + L  +     Y+ ++++    E  E +   LDD L   ++              
Sbjct: 528 SELNSLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETES-SALRILAEIAKAT 586

Query: 579 XXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEIXXXXXX 638
                 G+ SL +  L+QLY+GD+ES+G +++L   Y +  + +    + +TEI      
Sbjct: 587 DKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLSSITEILLSLLA 646

Query: 639 XXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684
                       VWEQ +  + ++E+NLLL+ L ARENK+GF+ LF
Sbjct: 647 QKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  196 bits (497), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 157/280 (56%), Gaps = 14/280 (5%)

Query: 742  EKISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXX 801
            + ++ IDKETTSALAKAL+LP              L                        
Sbjct: 751  DAVNNIDKETTSALAKALDLPADIINANGEVDIEKL-----EMQSDDDEDDEDDESMDDE 805

Query: 802  XXXXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQ 861
                   QLSEIFKRRK+ALS + TGN+RK +VKESRE+VIAFKHRI+D+L +YIKH+E+
Sbjct: 806  QMMDLDDQLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEK 865

Query: 862  LSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRF 921
            + + R D    V        L  +L        C++QTLDK L EK+ KL K R  KIR 
Sbjct: 866  M-IQRED----VDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRV 920

Query: 922  TLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKT 981
            T  + ++T+ +++   +RIH      KPGQF   YY  CSSTSLY  + L+D      + 
Sbjct: 921  TGIK-LDTA-DVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNA--DYQQ 976

Query: 982  KMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021
             ++E LVD Y+ T K W+++ K+   IF+DF NWLASKKQ
Sbjct: 977  GVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
           (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  409 bits (1050), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 257/723 (35%), Positives = 399/723 (55%), Gaps = 69/723 (9%)

Query: 1   MRVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNS 60
           + ++RDLFYKLASD+ EER+ + + +V  L KL   ++   EW YV+DRL+KGL S+RN 
Sbjct: 4   IEINRDLFYKLASDLSEERLQATIDLVTQLSKL---EKDSSEWQYVLDRLIKGLSSSRNG 60

Query: 61  ARLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSXXXXXXXXXXXXXXD 120
           ARLGFS+CLTE + L L + V  R      V  Y+  + S                   +
Sbjct: 61  ARLGFSLCLTEVVALALEKGVLAR------VDQYMHLLISAL--------SKENVKNGKE 106

Query: 121 ERGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFF 173
           ERG LFG+LF  +VLLNEPLFS +F       + + +  +   +I +   K W+ E   F
Sbjct: 107 ERGLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLF 166

Query: 174 SLYQAIEKLLPGL-DQEYAQATVAQIDEHKLTMTNEGLSVYL-----------LLAKKFT 221
           +L+QA+EKL P L  ++  +A +  +D   LT T+EGL++YL           +L KK  
Sbjct: 167 TLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGF 226

Query: 222 LSDFTLENSAWKANDPLQKGNLSVMAKVMLDTNVDGANSNTNKN-WAPRLHYIWDIILRE 280
           L +  L+N  WK NDPL++GNL  ++  + D+      S T K  WAPRLH+ WDI+L+ 
Sbjct: 227 LDELNLKN-PWKNNDPLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQT 285

Query: 281 FFDNEQHGSDAKHVYQKKKHDKSKNPQR---VEFKSFWQAVVDESFFNDKASPERKYQGY 337
                 H  +++    +    K K  ++   ++F  FW++VVDESFFN+K+S ERKY G 
Sbjct: 286 LL----HAENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGI 341

Query: 338 LIFQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKL 397
           L+F+K  +  P   +   F++N++R +INQ   ++R L+K+SQK L T+V +C+++P K 
Sbjct: 342 LVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKT 401

Query: 398 TPVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPEL 457
            P    L F E G++NFD LTK+KTV+ LL+ K      L  L     S L        L
Sbjct: 402 APSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNL-----FGNL 456

Query: 458 EELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ-------KDNE--- 507
           +EL+ R +FILD++L+L+R+ KA    D+  +  +L++ + L FFQ       KD++   
Sbjct: 457 KELS-RARFILDAILHLVRAHKA--HADEVWLKPVLKALVCLGFFQQSELKDVKDSQESF 513

Query: 508 -YINNIAKERLSSMLAELIVLPSTDGS--WPYLALEIIVTKEKSETLIDSLDDSLVAV-- 562
             +++IA ERL S+LA+L+ +     S  WP++A++++ T    +TL+ S+D+ L  +  
Sbjct: 514 HSLSSIASERLFSILADLLTVEQDTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILD 573

Query: 563 KAEXXXXXXXXXXXXXXXXXXXGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHE-TSNH 621
            +                    G++ L S+N++Q Y+G+ ESI ++EDL +F +E     
Sbjct: 574 SSMTVLSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGA 633

Query: 622 ETANFTGVTEIXXXXXXXXXXXXXXXXXXVWEQFIDQIGKEEINLLLNFLHARENKEGFS 681
           ++A   G  EI                   WE F+  + ++++ +LLN L  RENKEGFS
Sbjct: 634 KSAPLAGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFS 693

Query: 682 VLF 684
            LF
Sbjct: 694 NLF 696

 Score =  184 bits (466), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 154/282 (54%), Gaps = 20/282 (7%)

Query: 744  ISQIDKETTSALAKALNLPDXXXXXXXXXXXXMLEGXXXXXXXXXXXXXXXXXXXXXXXX 803
            + +IDKE TSALAKALNLPD              E                         
Sbjct: 745  MGKIDKEATSALAKALNLPDSIVDDKG-------EVRFEDLGDTDEEEEESEEDLDDEKM 797

Query: 804  XXXXXQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863
                 QLSEIFKRRK+ALS + TGN+RK +VKESRENVIAFKHR++DMLEI ++ IE  S
Sbjct: 798  MELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE--S 855

Query: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923
              + DG   +     ++  AI+L ++D    C++ TLDKPL EKI KL K +  K++ + 
Sbjct: 856  KMKKDGH--IEKSVLDKVFAIILPLLD----CIRTTLDKPLAEKIAKLLKNKICKLKPSF 909

Query: 924  FEDIET--STEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKT 981
                E      +++ L  +H  +   K GQF   Y+  CS+TS++L R ++DT  E E  
Sbjct: 910  SSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE-- 967

Query: 982  KMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQRK 1023
              +E+L  +Y  T   W   GK+G  +FV+F NWL+ KK ++
Sbjct: 968  -TYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQQ 1008

>Ecym_6176 Chr6 complement(323400..326809,326910..326979) [3480 bp,
           1159 aa] {ON} similar to Ashbya gossypii AFL002C
          Length = 1159

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 11/107 (10%)

Query: 822 STVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNRADGGKVVTTEKTEQT 881
           +T + G +RKL   ESRE   + K R +D  E+ I   E  S+N ++GG       TE +
Sbjct: 480 NTTARGRKRKLG-SESREE--STKKRAVDTPEVEISAPENDSVNVSNGG------NTESS 530

Query: 882 LAIMLAIVDAF-ANCVQQTLDKPLIEKIIKLFKGRFSKIRFTLFEDI 927
           +   L  +  F A+ ++    +  I  I+K++ G  + +R  L+ED+
Sbjct: 531 VVDTLVNIGGFAAHSLKSIQRQKAILDIVKIYGG-VTYVRDQLYEDV 576

>AER329C Chr5 complement(1243379..1244083) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR439W
           (LRS4)
          Length = 234

 Score = 34.3 bits (77), Expect = 1.0,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

Query: 844 FKHRIIDMLEIYIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKP 903
           +   +I   EIYI+ I  L  N+   G+   +  TE+T+++M+ I    ++ V+Q   + 
Sbjct: 11  YYESVIRCEEIYIEFISGLGPNKTKSGQQSGSVATEETISLMMQIEHFVSDSVKQ---RQ 67

Query: 904 LIEKIIKLFKGRFSKIRFTLFEDIETSTE 932
           +IEK+ +L K +    R  L   +ET+ +
Sbjct: 68  VIEKLRELNKTQ----RAVLESKLETAKK 92

>Skud_12.422 Chr12 complement(740046..742751) [2706 bp, 901 aa] {ON}
           YLR336C (REAL)
          Length = 901

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 456 ELEELNPRLKFILDSLLNLI--RSQKALLETDKEIVMEILESTIQLAFFQK 504
           +L+E +PRL+F++D++ +L   R + ++L TD  ++ + L+ST++ +  Q+
Sbjct: 521 DLQEQSPRLRFLMDTMSDLKNNRLKPSILATDHHLLKKSLQSTLKASTSQE 571

>NDAI0G03870 Chr7 complement(926437..929220) [2784 bp, 927 aa] {ON}
           Anc_3.32 YNL313C
          Length = 927

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 9/98 (9%)

Query: 180 EKLLP-GLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLENSAWKANDPL 238
           +KLLP  + QEY    +  +D ++    +   ++ LLL        +T+  ++  A DPL
Sbjct: 371 DKLLPMAIRQEYIPQELQDLDPNEQPALSNYDNIQLLLRL------YTIRQTS-PAKDPL 423

Query: 239 QKGNL-SVMAKVMLDTNVDGANSNTNKNWAPRLHYIWD 275
            +  L S++ +++  T  D AN N  +NW      +W+
Sbjct: 424 VEEELASLINRIIYQTPADNANVNEKRNWTIFARSLWE 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,051,625
Number of extensions: 3601029
Number of successful extensions: 12318
Number of sequences better than 10.0: 45
Number of HSP's gapped: 12421
Number of HSP's successfully gapped: 81
Length of query: 1024
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 904
Effective length of database: 39,721,479
Effective search space: 35908217016
Effective search space used: 35908217016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)