Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J00240na 1ON25725712081e-169
Kpol_1045.81na 1ON3071661721e-13
TDEL0F03380na 2ON29064986e-04
AER244C5.417ON95771770.34
Ecym_55175.417ON95275721.3
ZYRO0C06248gna 2ON30561666.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00240
         (257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00240 Chr10 (54999..55772) [774 bp, 257 aa] {ON}                469   e-169
Kpol_1045.81 s1045 complement(190276..191199) [924 bp, 307 aa] {...    71   1e-13
TDEL0F03380 Chr6 (623519..624391) [873 bp, 290 aa] {ON}                42   6e-04
AER244C Chr5 complement(1087374..1090247) [2874 bp, 957 aa] {ON}...    34   0.34 
Ecym_5517 Chr5 complement(1048887..1051745) [2859 bp, 952 aa] {O...    32   1.3  
ZYRO0C06248g Chr3 (473999..474916) [918 bp, 305 aa] {ON} no simi...    30   6.1  

>TPHA0J00240 Chr10 (54999..55772) [774 bp, 257 aa] {ON} 
          Length = 257

 Score =  469 bits (1208), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/257 (92%), Positives = 237/257 (92%)

Query: 1   MLLVPLIATLVSPILVHSTVLEPVDMQLDAVHTVDRRIASAVTAVSNAGSAWLRLAHAVT 60
           MLLVPLIATLVSPILVHSTVLEPVDMQLDAVHTVDRRIASAVTAVSNAGSAWLRLAHAVT
Sbjct: 1   MLLVPLIATLVSPILVHSTVLEPVDMQLDAVHTVDRRIASAVTAVSNAGSAWLRLAHAVT 60

Query: 61  FVPTANWTLEAALDHYANTLAPIGEKDMVDAVXXXXXXXXXXXXXXXXXXXXTWLTAPID 120
           FVPTANWTLEAALDHYANTLAPIGEKDMVDAV                    TWLTAPID
Sbjct: 61  FVPTANWTLEAALDHYANTLAPIGEKDMVDAVARWSAGAGAGSDRSSDAGAWTWLTAPID 120

Query: 121 AATVSLIRLQSWHLRKLVVDSPEATSETRLQAASSALLVEQALRARRTVVHMLTSRCANS 180
           AATVSLIRLQSWHLRKLVVDSPEATSETRLQAASSALLVEQALRARRTVVHMLTSRCANS
Sbjct: 121 AATVSLIRLQSWHLRKLVVDSPEATSETRLQAASSALLVEQALRARRTVVHMLTSRCANS 180

Query: 181 NADGGAAISPRRKPTPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPAST 240
           NADGGAAISPRRKPTPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPAST
Sbjct: 181 NADGGAAISPRRKPTPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPAST 240

Query: 241 AIWISVILQFRRGMALP 257
           AIWISVILQFRRGMALP
Sbjct: 241 AIWISVILQFRRGMALP 257

>Kpol_1045.81 s1045 complement(190276..191199) [924 bp, 307 aa] {ON}
           complement(190278..191201) [924 nt, 308 aa]
          Length = 307

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 70/166 (42%), Gaps = 31/166 (18%)

Query: 115 LTAPIDAATVSLIRLQSWHLRKL---VVDSPEATSETRLQAASSALLVEQALRARRTVVH 171
           L  PI + T   I  Q W L K+   ++  P  T       +    +VE++L A    V 
Sbjct: 129 LARPISSYTRRFIEFQHWQLVKMYQNLLHDPN-TPINWWYVSQLFAVVERSLYANEVSVE 187

Query: 172 MLTS----------RCANSNADGGAAIS-----------------PRRKPTPDEYLLYLR 204
           M  S          R A    + G +                   P++KP  D+YLLY+R
Sbjct: 188 MFHSNSYRVVSEILRIAKYLLNTGNSFEQYKVPDETSVKFEIMEDPKKKPNQDQYLLYIR 247

Query: 205 KFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPASTAIWISVILQF 250
           K  FFM+Q   I  FC+AA    C F F  L+  S  IWI V++Q+
Sbjct: 248 KMMFFMSQGIAIVFFCVAANSIPCIFAFGSLISMSFVIWIFVMIQY 293

>TDEL0F03380 Chr6 (623519..624391) [873 bp, 290 aa] {ON} 
          Length = 290

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 187 AISPRRKP-TPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPASTAIWIS 245
           +I+ +R P T +  + YLR+    + ++ +   FC A  ++ C F F +LL  S+ IWI+
Sbjct: 222 SIAAQRDPATLESDIKYLRENLAVIIKSGMFMFFCFAFQIYICSFTFGVLLTVSSLIWIA 281

Query: 246 VILQ 249
           + LQ
Sbjct: 282 IFLQ 285

>AER244C Chr5 complement(1087374..1090247) [2874 bp, 957 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR359C
           (VID21)
          Length = 957

 Score = 34.3 bits (77), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 133 HLRKLVVDSPEATSETRLQAASS---ALLVEQALRARRTVVHMLTSRCANSNADGGAAIS 189
           + RK++   P+ T E  L+AA S    + ++Q    ++ V   L++   ++    G A+ 
Sbjct: 877 YARKIIAQKPDFTPELALKAAESYYQNVTLKQNTIGKQIVSQPLSAATVSTPPSNGRAVH 936

Query: 190 PRRKPTPDEYL 200
             R PTP E L
Sbjct: 937 KIRSPTPQEIL 947

>Ecym_5517 Chr5 complement(1048887..1051745) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AER244C
          Length = 952

 Score = 32.3 bits (72), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 7/75 (9%)

Query: 133 HLRKLVVDSPEATSETRLQAASSAL-------LVEQALRARRTVVHMLTSRCANSNADGG 185
           + RK++   PE T E  L+AA S           +Q     + +V   +S  A + +   
Sbjct: 868 YARKIIAQKPEFTPELALKAAESYFRNVTLKQQQQQQQAFTKQIVSQSSSVAATATSSSN 927

Query: 186 AAISPRRKPTPDEYL 200
            AI+  R PTP E L
Sbjct: 928 GAINKFRSPTPQEIL 942

>ZYRO0C06248g Chr3 (473999..474916) [918 bp, 305 aa] {ON} no
           similarity
          Length = 305

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 189 SPRRKPTPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPASTAIWISVIL 248
           SP R    D  + YLR+      +A +    CM   ++ C   F  ++  S  IWISV L
Sbjct: 241 SPPRDIAAD--MNYLREGLSITIKAGMFLLLCMQYQVYLCSVAFGFMISMSCFIWISVYL 298

Query: 249 Q 249
           +
Sbjct: 299 E 299

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,288,366
Number of extensions: 642487
Number of successful extensions: 1996
Number of sequences better than 10.0: 8
Number of HSP's gapped: 2031
Number of HSP's successfully gapped: 8
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)