Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002306.6ON62623123e-39
Kpol_1045.826.6ON62622056e-23
Kthe_YGOB_Anc_6.66.6ON62621943e-21
Skud_16.66.6ON62611934e-21
Smik_6.4796.6ON62611935e-21
Klac_YGOB_Anc_6.66.6ON61601925e-21
Suva_16.346.6ON62611926e-21
CAGL0A01111g6.6ON69611918e-21
ZYRO0F00418g6.6ON62601882e-20
YPL271W (ATP15)6.6ON62611882e-20
KNAG0E027906.6ON65591841e-19
Sklu_YGOB_Anc_6.66.6ON61601796e-19
TDEL0G046506.6ON62621788e-19
Kwal_56.223336.6ON62621762e-18
NDAI0I027406.6ON66591641e-16
TBLA0A072006.6ON65621641e-16
NCAS0D022006.6ON85591572e-15
KAFR0B064906.6ON66591414e-13
Ecym_30086.6ON61531102e-08
ACR021W6.6ON62541059e-08
Suva_8.1895.474ON62626601.7
TBLA0B067001.236ON37734583.0
NCAS0C040008.68ON122331565.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00230
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...   124   3e-39
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    84   6e-23
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    79   3e-21
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       79   4e-21
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    79   5e-21
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    79   5e-21
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    79   6e-21
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    78   8e-21
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    77   2e-20
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    77   2e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    75   1e-19
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    74   6e-19
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    73   8e-19
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    72   2e-18
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    68   1e-16
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    68   1e-16
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    65   2e-15
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    59   4e-13
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    47   2e-08
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    45   9e-08
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...    28   1.7  
TBLA0B06700 Chr2 complement(1573909..1575042) [1134 bp, 377 aa] ...    27   3.0  
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....    26   5.6  

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score =  124 bits (312), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 SD 62
          SD
Sbjct: 61 SD 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 83.6 bits (205), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAG+TY+ Y+ +AA+TVR++LKN+LKTN+VL+RSKT+ K+  FE G  K EP  I
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 SD 62
            
Sbjct: 61 QQ 62

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 79.3 bits (194), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAGLTY+NY+A+AA+TVR +LKNDL+T  VL RSKT+ ++  +EKGT  +E   +
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 SD 62
           +
Sbjct: 61 KN 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 79.0 bits (193), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (78%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAG++Y+ YL VAA+T+R SLK +L+T SVLSRSKTD  YT ++ G A SEPT I
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 61 S 61
          +
Sbjct: 61 T 61

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 79.0 bits (193), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAG++Y+ YL VAAK +R SLK +L+T SVLSRSKTD  YT ++ G A SEPT I
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 61 S 61
          +
Sbjct: 61 T 61

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 78.6 bits (192), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%), Gaps = 1/60 (1%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MSTWRKAGLT++NY++VAA TVR +LK +L+TNSVL+RSK++ K+  FE G A SEP  +
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPL 59

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 78.6 bits (192), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAG++Y+ YL VAA+T+R SLK +L+T +VLSRS+TD  YT ++ GTA SEP SI
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 61 S 61
          +
Sbjct: 61 T 61

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 78.2 bits (191), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 49/61 (80%)

Query: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSIS 61
          + WRKAGL+YS++LA+AA+TVR+SLK +L+T +V+ R KTD  YT +EKG+ KS+P  + 
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 62 D 62
          +
Sbjct: 69 E 69

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 77.0 bits (188), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAGLTY+ YL+VAAKTVR +LK + +T +VLSR + D KYT FEKG  + EP  +
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 77.0 bits (188), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (78%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAG++Y+ YL VAA+ +R SLK +L+T SVL+RS+TD  YT ++ GTA SEPT I
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 61 S 61
          +
Sbjct: 61 T 61

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 75.5 bits (184), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (77%)

Query: 4  WRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSISD 62
          W+KAG+TY+ YL V AKT+R +LKN+L+T +VLSR  TD  YT++EKGT K++P  + +
Sbjct: 5  WKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPLQE 63

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 73.6 bits (179), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (76%), Gaps = 1/60 (1%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAGLTY+NYL++AAKTVR +LK + +T  VLSRSK++ K+  FE GT  S+P  +
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 73.2 bits (178), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (75%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          M+ WRKAGLTY+ YL+VAA+TVR +LK +L+   VL+RSKTD +Y  +EKG+A S+   +
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 SD 62
           +
Sbjct: 61 QE 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 72.4 bits (176), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 46/62 (74%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAGLTY+NY+A+AA+TVR +LK + +T  VL RSKT+ ++  +E GTA +E   +
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 SD 62
           +
Sbjct: 61 KE 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 45/59 (76%)

Query: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          + WRKAG+TYS YL++AA+T+R +LK +L+T +V++RS TD  +T ++ G   SEP S+
Sbjct: 5  AVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 47/62 (75%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          MS WRKAG+TY+ Y+A+AAKTVR +LK +L+T +V+ RS T+ ++T + KG+  ++P  +
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 61 SD 62
           +
Sbjct: 61 KE 62

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 65.1 bits (157), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (74%)

Query: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          +T RKAG+TY+ YL VA++T+R SLK +L+T  V++RS TD  YT +EKG+  ++P  +
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPL 80

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 58.9 bits (141), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 43/59 (72%)

Query: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
          S WRKAGLTY++YL++A+KT+R+ LK + +T +V SRS T+   T ++ G+  S+P  +
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 47.0 bits (110), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 39/53 (73%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTA 53
          MS WRKAGL+Y+ Y+AVAA+ VR +LK +LK  +VLSRS T+ K   ++ G A
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA 53

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 45.1 bits (105), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (79%), Gaps = 1/54 (1%)

Query: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIF-EKGTA 53
          MS WRKAGLTY++YLAVAA+TVR +LK +L++ +VL+RS T+ K   +  KG+A
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSA 54

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 27.7 bits (60), Expect = 1.7,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 6   KAGLTYSNYLAVAAKTVRQSLKNDLK 31
           + G+ Y++YL V AK ++  LKN +K
Sbjct: 108 QTGIFYNSYLYVHAKNIQSKLKNSIK 133

>TBLA0B06700 Chr2 complement(1573909..1575042) [1134 bp, 377 aa]
           {ON} Anc_1.236 YKR046C
          Length = 377

 Score = 26.9 bits (58), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 8   GLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKT 41
            L + N L    ++V + L++ L++N VLS++KT
Sbjct: 189 NLPHVNELTATTRSVSKELQDKLQSNEVLSQTKT 222

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score = 26.2 bits (56), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 30  LKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60
           LK NS+L++ ++ + YT+ EK    S+  SI
Sbjct: 283 LKENSILTKKRSQLDYTVKEKEKVISQCNSI 313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.119    0.317 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,902,364
Number of extensions: 163515
Number of successful extensions: 531
Number of sequences better than 10.0: 25
Number of HSP's gapped: 531
Number of HSP's successfully gapped: 25
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)