Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J002206.5ON74074037540.0
Kpol_1045.836.5ON74869223810.0
TDEL0G046606.5ON73973322590.0
CAGL0A01133g6.5ON80162622430.0
ZYRO0F00396g6.5ON73273822340.0
TBLA0A071906.5ON79463222060.0
NDAI0I027306.5ON83267821880.0
Suva_16.356.5ON76769121770.0
YPL270W (MDL2)6.5ON77360321680.0
NCAS0D022106.5ON77365821470.0
Smik_6.4786.5ON77360321460.0
Skud_16.76.5ON77362521450.0
SAKL0E00748g6.5ON77466021120.0
Kwal_56.223296.5ON77667820820.0
KLTH0C11616g6.5ON74064220680.0
KLLA0D00748g6.5ON78968120260.0
KNAG0E028006.5ON74163019640.0
Ecym_30076.5ON76965719610.0
ACR022W6.5ON75464819510.0
KAFR0B064806.5ON75167618800.0
TPHA0B046201.67ON72066913001e-169
Kpol_2000.791.67ON70761612941e-168
SAKL0C02244g1.67ON71266712901e-168
Ecym_10721.67ON68360612771e-166
AFR683C1.67ON67768312741e-166
NDAI0A005601.67ON71467412761e-165
NCAS0B087001.67ON71564512651e-164
KLLA0C01991g1.67ON70660112641e-164
TDEL0C063501.67ON69365512601e-163
YLR188W (MDL1)1.67ON69562112451e-161
KLTH0F02024g1.67ON73465612391e-160
Skud_12.2531.67ON69269312241e-158
Kwal_33.133081.67ON70664812221e-157
Smik_12.2481.67ON69666212201e-157
Suva_10.2841.67ON69364412141e-156
ZYRO0F17050g1.67ON71470112131e-156
TBLA0A053001.67ON70760411721e-150
CAGL0E00385g1.67ON60860111251e-144
SAKL0H00968g5.20ON7004105182e-55
KLLA0A10131g5.20ON7204105165e-55
Kwal_26.94805.20ON7194095131e-54
KLTH0B09482g5.20ON6944225032e-53
KAFR0I025805.20ON7094114901e-51
TPHA0L022705.20ON7114184812e-50
KNAG0E013205.20ON6954284802e-50
Skud_13.4755.20ON6914134732e-49
TBLA0C070005.20ON7254064715e-49
Suva_13.4915.20ON6934134705e-49
TDEL0G004305.20ON6964114696e-49
Ecym_56495.20ON6963334671e-48
NCAS0D024305.20ON7023614671e-48
NDAI0I024405.20ON7304714662e-48
Smik_13.5185.20ON6874134616e-48
Kpol_513.235.20ON7084054611e-47
YMR301C (ATM1)5.20ON6904114582e-47
CAGL0M13739g5.20ON7273684592e-47
Kpol_1018.1851.527ON12764264652e-47
YKL209C (STE6)1.527ON12905064652e-47
TDEL0F003401.527ON12574194643e-47
NDAI0D015401.527ON12934634502e-45
ZYRO0D07106g5.20ON7094114422e-45
KAFR0E002301.527ON12704314448e-45
SAKL0A10208g1.527ON13104914422e-44
AGL335W5.20ON6914334352e-44
KNAG0G001901.527ON12754244403e-44
Suva_11.111.527ON12904414351e-43
ZYRO0G02244g1.527ON12734164342e-43
Skud_11.111.527ON12955104332e-43
TBLA0B100701.527ON12964474297e-43
TPHA0O001601.527ON12534214281e-42
KLLA0B14256g1.527ON12712414191e-41
KLTH0B01100g1.527ON12984304153e-41
AFR432W1.527ON12843954145e-41
Kwal_33.155611.527ON12974414101e-40
KNAG0E011204.6ON17175274092e-40
Smik_11.141.527ON13164384065e-40
TDEL0E056104.52ON15354914049e-40
NCAS0G035101.527ON12884354021e-39
CAGL0K00363g1.527ON12274734012e-39
CAGL0E03982g4.6ON16595103985e-39
YHL035C (VMR1)4.6ON15924993977e-39
ZYRO0G07612g4.6ON16955123896e-38
Smik_12.484.52ON15575083871e-37
Ecym_36121.527ON13153973852e-37
Ecym_84184.6ON16785013781e-36
NCAS0J00160singletonON16545183763e-36
KAFR0L001904.6ON16534973753e-36
TPHA0C009608.303ON15235023754e-36
NDAI0H001904.6ON16824883736e-36
Kpol_311.34.6ON16575223711e-35
NCAS0C059304.6ON16574933702e-35
Skud_12.524.52ON15615123702e-35
KLTH0H16038g4.6ON16495003692e-35
Smik_8.64.6ON15855273692e-35
Suva_10.234.6ON16615273692e-35
CAGL0E03355g4.52ON15355073664e-35
CAGL0C03289g4.6ON16485183665e-35
Kwal_34.157704.6ON14364993631e-34
YLL048C (YBT1)4.6ON16615903631e-34
Ecym_42658.303ON15054893621e-34
Suva_8.164.6ON15994933612e-34
TDEL0G018504.6ON16424973612e-34
SAKL0H26026g4.6ON16534953593e-34
KNAG0J027304.52ON15375083575e-34
KAFR0I013004.52ON15365083576e-34
ZYRO0G22176g4.52ON15705053576e-34
KLLA0E00529g4.6ON16505093568e-34
KLTH0C09240gna 1ON15464963559e-34
Kwal_56.22747na 1ON15385043551e-33
TBLA0G007104.6ON16915063541e-33
Skud_4.3958.303ON15164983532e-33
YLL015W (BPT1)4.52ON15595113523e-33
Skud_12.224.6ON16615273513e-33
Smik_12.114.6ON16615263504e-33
NDAI0J011508.303ON15174963488e-33
Skud_8.94.6ON15875623471e-32
TPHA0K023104.6ON16494993461e-32
NCAS0B034708.303ON15124943424e-32
Suva_10.60singletonON9905093414e-32
KAFR0B056308.303ON15154953424e-32
Suva_10.594.52ON15615093415e-32
NDAI0B006405.10ON14915083416e-32
SAKL0H00704g5.10ON14395383381e-31
KLLA0D04059g4.52ON15684993371e-31
TPHA0F001804.6ON16464783353e-31
Suva_2.2978.303ON15164933353e-31
KLTH0G12716g8.303ON15002533335e-31
SAKL0H16016g8.303ON14994833301e-30
Smik_4.3808.303ON15164933292e-30
TPHA0F004104.52ON15705123255e-30
KNAG0I009908.303ON15354903255e-30
CAGL0G00242g5.10ON14772853247e-30
AGR047W8.303ON14924643239e-30
YDR135C (YCF1)8.303ON15154933221e-29
KAFR0C065105.10ON14573053211e-29
Skud_7.6145.10ON14775073212e-29
CAGL0L06402g8.303ON15354983202e-29
SAKL0H23958g4.52ON15585073202e-29
ZYRO0D06160g8.303ON15254793193e-29
YGR281W (YOR1)5.10ON14772753183e-29
Kwal_56.238448.303ON14942493174e-29
NCAS0E041605.10ON15062883159e-29
Kpol_1033.288.303ON15315163131e-28
TDEL0F043008.303ON15142273122e-28
KLLA0F20075g8.303ON15162283112e-28
TPHA0A056205.10ON14775033112e-28
Smik_16.275.10ON14773083112e-28
Smik_11.367na 2ON15955693103e-28
Kwal_26.95325.10ON14715023103e-28
YKR104WsingletonON3063052924e-28
KNAG0K001705.10ON14423983086e-28
Suva_7.5775.10ON14782943077e-28
ACL072C4.6ON16274973068e-28
KLTH0B09724g5.10ON14865053032e-27
Skud_18.2singletonON15805143023e-27
TBLA0A06840singletonON10582802987e-27
TBLA0A038008.303ON15465322988e-27
KLTH0B00396gsingletonON15072342971e-26
Kpol_1060.75.10ON14602462933e-26
Kpol_YGOB_1041.454.52ON15685182862e-25
TDEL0G003305.10ON14652812853e-25
Kpol_1041.45singletonOFF15965182853e-25
Zrou_YGOB_Anc_5.105.10ON9922912817e-25
KLLA0C14234g5.10ON14545012819e-25
TBLA0C06400singletonON13775122738e-24
TBLA0C071005.10ON14855012721e-23
AGL346W5.10ON14004922683e-23
Ecym_56605.10ON15362472229e-18
SAKL0D10208g1.366ON7522781914e-14
NDAI0H035701.366ON7552481905e-14
Kwal_26.87308.661ON8313701905e-14
Kpol_175.1singletonON13774171871e-13
CAGL0K10472g1.366ON7522491852e-13
YKR103W (NFT1)na 2ON12181761843e-13
ACR128C8.661ON8272141781e-12
Ecym_24108.661ON8282471772e-12
ZYRO0G01144g1.366ON7522491762e-12
AEL032W1.366ON7532781753e-12
KNAG0C019601.366ON7522711744e-12
TPHA0A023101.366ON7522491735e-12
KAFR0C045401.366ON7522881735e-12
Smik_7.3131.366ON7522491719e-12
TBLA0C012201.366ON7512481711e-11
KNAG0I005301.427ON10472431701e-11
YFR009W (GCN20)1.366ON7522491701e-11
Ecym_11943.534ON6093281682e-11
KAFR0C052205.500ON14992481702e-11
SAKL0F01606g3.534ON6082301682e-11
KLLA0F11484g8.661ON8452731682e-11
NDAI0E012408.661ON8972681682e-11
KLTH0H13442g1.366ON7522481673e-11
TPHA0D011708.661ON9152091673e-11
Suva_6.841.366ON7522491664e-11
ZYRO0D11880g5.500ON14982571674e-11
TBLA0I033303.534ON6102441654e-11
ZYRO0E08800g3.534ON6102441654e-11
YPL147W (PXA1)8.661ON8701981656e-11
Kpol_1043.431.366ON7522491646e-11
Skud_5.1453.534ON6101871646e-11
Smik_5.1593.534ON6101871646e-11
YER036C (ARB1)3.534ON6101871636e-11
Suva_5.1343.534ON6101871637e-11
KLTH0D10890g8.661ON8302101647e-11
ZYRO0D11858gna 3ON15033081639e-11
CAGL0I04862g3.220ON15072721639e-11
Suva_16.1638.661ON8701981621e-10
Kwal_34.162401.366ON7522491621e-10
Smik_6.3448.661ON8701981621e-10
KAFR0J027003.534ON6081871611e-10
KAFR0A037908.661ON8762111611e-10
NCAS0D005801.366ON7532721611e-10
AGL142CsingletonON14972181621e-10
KLLA0A10857g1.366ON7522491611e-10
TPHA0A058903.534ON6101871602e-10
SAKL0D09394g1.427ON10272431612e-10
CAGL0C02343g3.534ON7202471602e-10
Skud_6.951.366ON7522491602e-10
ZYRO0F07018g8.661ON8612571602e-10
NDAI0G050201.427ON10972601602e-10
TDEL0B057601.427ON10362471602e-10
AFR232C3.534ON6071871582e-10
ZYRO0E04092g1.427ON10622411593e-10
TDEL0D060203.534ON6101871573e-10
NCAS0A085701.427ON10602231583e-10
Kwal_47.191163.534ON6071831574e-10
Ecym_27141.366ON7482491574e-10
YOL075C3.133ON12942271575e-10
TBLA0A024405.500ON16212131575e-10
Skud_16.1358.661ON8701981566e-10
YOR328W (PDR10)na 4ON15642311576e-10
TBLA0D01820singletonON15512001576e-10
KNAG0A029808.661ON8712731566e-10
TBLA0D017805.500ON15952001566e-10
KNAG0B038705.500ON15132171558e-10
Kpol_1049.234.6ON110991409e-10
KNAG0K009503.133ON12842331559e-10
NCAS0E004803.534ON6101871549e-10
Smik_15.843.133ON12952131551e-09
NCAS0B015308.661ON8682001541e-09
NCAS0F00410singletonON15312681541e-09
TDEL0D023701.366ON7532481531e-09
KNAG0C045005.500ON15552371541e-09
NDAI0I030203.534ON6091871521e-09
Kpol_1050.263.534ON6101871521e-09
Kwal_0.3271.427ON10192301531e-09
KAFR0C05210na 3ON14932531531e-09
Kpol_1053.483.133ON12882531531e-09
Skud_4.6805.500ON14453201532e-09
Skud_4.681na 3ON14453201532e-09
KLLA0A01452g3.534ON6073711512e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00220
         (740 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...  1450   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   921   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   874   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   868   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   865   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   854   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   847   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   843   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   839   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      831   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   831   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   830   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   818   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   806   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   801   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   785   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   761   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   759   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   756   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   728   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   505   e-169
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   503   e-168
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   501   e-168
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   496   e-166
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   495   e-166
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   496   e-165
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   491   e-164
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   491   e-164
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   489   e-163
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   484   e-161
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   481   e-160
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   476   e-158
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   475   e-157
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   474   e-157
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   472   e-156
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   471   e-156
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   456   e-150
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   437   e-144
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   204   2e-55
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   203   5e-55
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   202   1e-54
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   198   2e-53
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   193   1e-51
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   189   2e-50
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   189   2e-50
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   186   2e-49
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   186   5e-49
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   185   5e-49
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   185   6e-49
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   184   1e-48
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     184   1e-48
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   184   2e-48
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   182   6e-48
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   182   1e-47
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   181   2e-47
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   181   2e-47
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   183   2e-47
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   183   2e-47
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   183   3e-47
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   177   2e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   174   2e-45
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   175   8e-45
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   174   2e-44
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   172   2e-44
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   174   3e-44
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   172   1e-43
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   171   2e-43
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   171   2e-43
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   169   7e-43
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   169   1e-42
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   166   1e-41
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   164   3e-41
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   164   5e-41
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   162   1e-40
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   162   2e-40
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   160   5e-40
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   160   9e-40
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   159   1e-39
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   159   2e-39
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   157   5e-39
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   157   7e-39
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   154   6e-38
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   153   1e-37
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   152   2e-37
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   150   1e-36
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   149   3e-36
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   149   3e-36
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   149   4e-36
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   148   6e-36
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   147   1e-35
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   147   2e-35
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   147   2e-35
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   146   2e-35
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   146   2e-35
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   146   2e-35
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   145   4e-35
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   145   5e-35
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   144   1e-34
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   144   1e-34
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   144   1e-34
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   143   2e-34
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   143   2e-34
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   142   3e-34
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   142   5e-34
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   142   6e-34
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   142   6e-34
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   141   8e-34
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   141   9e-34
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   141   1e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   140   1e-33
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   140   2e-33
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   140   3e-33
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   139   3e-33
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   139   4e-33
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   138   8e-33
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   138   1e-32
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   137   1e-32
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   136   4e-32
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   135   4e-32
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   136   4e-32
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   135   5e-32
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    135   6e-32
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   134   1e-31
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   134   1e-31
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   133   3e-31
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   133   3e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   132   5e-31
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   131   1e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   131   2e-30
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   129   5e-30
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   129   5e-30
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   129   7e-30
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   129   9e-30
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   128   1e-29
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   128   1e-29
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   128   2e-29
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   127   2e-29
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   127   2e-29
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   127   3e-29
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   127   3e-29
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   126   4e-29
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    125   9e-29
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   125   1e-28
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   124   2e-28
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   124   2e-28
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   124   2e-28
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   124   2e-28
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   124   3e-28
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   124   3e-28
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   117   4e-28
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   123   6e-28
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   122   7e-28
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   122   8e-28
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   121   2e-27
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   120   3e-27
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   119   7e-27
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   119   8e-27
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   119   1e-26
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   117   3e-26
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   114   2e-25
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   114   3e-25
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   114   3e-25
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   112   7e-25
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   112   9e-25
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   109   8e-24
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           109   1e-23
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   107   3e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    90   9e-18
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    78   4e-14
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    78   5e-14
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    78   5e-14
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    77   1e-13
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    76   2e-13
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    75   3e-13
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    73   1e-12
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    73   2e-12
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    72   2e-12
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    72   3e-12
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    72   4e-12
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    71   5e-12
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    71   5e-12
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    70   9e-12
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    70   1e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    70   1e-11
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    70   1e-11
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    69   2e-11
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    70   2e-11
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    69   2e-11
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    69   2e-11
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     69   2e-11
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    69   3e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    69   3e-11
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    69   4e-11
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    69   4e-11
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    68   4e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    68   4e-11
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    68   6e-11
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    68   6e-11
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    68   6e-11
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    68   6e-11
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    67   6e-11
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    67   7e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    68   7e-11
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    67   9e-11
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    67   9e-11
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    67   1e-10
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    67   1e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    67   1e-10
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    67   1e-10
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    67   1e-10
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       67   1e-10
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    67   1e-10
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    67   1e-10
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    66   2e-10
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    67   2e-10
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    66   2e-10
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    66   2e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    66   2e-10
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    66   2e-10
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    66   2e-10
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    65   2e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    66   3e-10
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    65   3e-10
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    65   3e-10
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    65   4e-10
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    65   4e-10
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    65   5e-10
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    65   5e-10
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    65   6e-10
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    65   6e-10
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              65   6e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    65   6e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    65   6e-10
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    64   8e-10
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    59   9e-10
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    64   9e-10
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 64   9e-10
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    64   1e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    64   1e-09
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                64   1e-09
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    64   1e-09
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    64   1e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    63   1e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    63   1e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    64   1e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            64   1e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    64   1e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    64   2e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    64   2e-09
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    63   2e-09
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    63   2e-09
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    63   2e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    63   2e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              63   2e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    63   3e-09
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    62   4e-09
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    62   4e-09
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    62   5e-09
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    62   5e-09
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    62   5e-09
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    62   5e-09
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    62   6e-09
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    62   7e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    62   7e-09
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            61   7e-09
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    61   7e-09
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    61   8e-09
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    61   9e-09
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    61   9e-09
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    61   9e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    61   9e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    61   1e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    61   1e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    60   1e-08
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    61   1e-08
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    60   1e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    60   1e-08
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    60   1e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             60   2e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    60   2e-08
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    60   2e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   2e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    60   2e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    60   2e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    60   2e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    60   2e-08
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    60   2e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    60   2e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    60   2e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    60   2e-08
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    59   3e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    59   3e-08
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    59   3e-08
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    59   3e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    59   3e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    59   3e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    59   4e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    59   4e-08
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    59   4e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   4e-08
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    59   4e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    59   5e-08
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    59   5e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    59   5e-08
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    59   5e-08
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    58   6e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    58   6e-08
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    58   7e-08
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    58   7e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    58   8e-08
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    58   8e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    58   9e-08
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    58   1e-07
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    58   1e-07
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    57   1e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    57   1e-07
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    57   1e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    57   1e-07
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    57   1e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    57   2e-07
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    57   2e-07
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    56   2e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    57   2e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    57   2e-07
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    56   3e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    56   3e-07
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    56   3e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    56   3e-07
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    56   4e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    55   4e-07
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    55   4e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    55   5e-07
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    55   5e-07
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    55   5e-07
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    55   6e-07
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    55   6e-07
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    55   9e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    54   1e-06
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    54   1e-06
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    54   1e-06
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    54   1e-06
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    54   2e-06
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    53   2e-06
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    54   2e-06
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    54   2e-06
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    53   2e-06
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    53   2e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    53   3e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    53   3e-06
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    53   3e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    53   3e-06
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    51   3e-06
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    53   3e-06
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     53   3e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    52   4e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    52   4e-06
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    52   4e-06
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    52   4e-06
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    52   5e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    52   5e-06
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    52   5e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    52   5e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    52   6e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    52   6e-06
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    51   7e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    51   9e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    51   1e-05
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    51   1e-05
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    51   1e-05
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    51   1e-05
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    50   1e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    51   1e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    51   1e-05
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    50   1e-05
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    50   2e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    50   2e-05
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    50   2e-05
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    50   2e-05
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    50   2e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    50   2e-05
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    50   2e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     50   3e-05
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    50   3e-05
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    49   3e-05
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    49   3e-05
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    49   4e-05
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    48   4e-05
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    49   4e-05
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    49   4e-05
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    49   4e-05
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    49   4e-05
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    49   6e-05
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    47   7e-05
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    49   7e-05
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    48   8e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    48   8e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    48   9e-05
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    48   9e-05
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    48   9e-05
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    47   1e-04
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    47   1e-04
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    47   1e-04
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    47   1e-04
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    47   1e-04
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    47   2e-04
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    47   2e-04
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    47   2e-04
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    46   2e-04
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    47   2e-04
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    47   2e-04
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    47   2e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    47   2e-04
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    47   2e-04
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    45   2e-04
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    47   2e-04
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    47   2e-04
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    47   2e-04
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    46   2e-04
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    47   3e-04
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    46   3e-04
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    45   3e-04
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    46   3e-04
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              46   3e-04
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    45   3e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    46   3e-04
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    46   3e-04
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    46   4e-04
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    46   4e-04
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    45   4e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    45   5e-04
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             46   5e-04
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    46   5e-04
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    45   5e-04
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    45   5e-04
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    45   5e-04
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    45   6e-04
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    45   6e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    45   6e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    45   6e-04
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    45   6e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    45   6e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    45   7e-04
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    45   7e-04
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    45   7e-04
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    45   8e-04
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    45   8e-04
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    45   8e-04
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    45   8e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    45   8e-04
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    45   9e-04
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    45   0.001
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    45   0.001
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    45   0.001
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    45   0.001
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    44   0.001
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    44   0.001
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.001
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.001
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    44   0.001
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    44   0.001
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    43   0.001
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              44   0.001
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    44   0.002
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    44   0.002
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    44   0.002
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    43   0.002
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    43   0.002
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    44   0.002
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    44   0.002
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    43   0.002
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    44   0.002
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    43   0.002
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    44   0.002
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    44   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    43   0.002
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    42   0.002
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    43   0.003
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    43   0.003
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    43   0.003
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    43   0.004
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    43   0.004
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    43   0.004
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    42   0.004
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    43   0.004
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    42   0.004
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    42   0.004
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.004
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    42   0.005
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    42   0.005
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    42   0.005
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    42   0.005
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.006
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.006
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    42   0.006
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.006
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    42   0.006
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    42   0.006
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    42   0.007
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    42   0.008
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    41   0.009
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    41   0.009
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    41   0.010
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    40   0.015
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    40   0.017
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    40   0.020
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    40   0.024
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    39   0.050
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    39   0.050
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    39   0.056
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    39   0.067
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    37   0.19 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    37   0.23 
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    37   0.23 
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    37   0.31 
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    36   0.32 
ADR196W Chr4 (1043225..1044346) [1122 bp, 373 aa] {ON} Syntenic ...    35   0.55 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    35   1.0  
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    33   1.1  
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    33   1.4  
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    34   1.6  
KLLA0D15180g Chr4 (1284273..1291412) [7140 bp, 2379 aa] {ON} wea...    33   3.1  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    33   4.2  
Skud_16.263 Chr16 complement(479329..481842) [2514 bp, 837 aa] {...    32   4.8  
YBR275C Chr2 complement(751356..757106) [5751 bp, 1916 aa] {ON} ...    33   5.1  
KLTH0G03806g Chr7 (304242..305396) [1155 bp, 384 aa] {ON} highly...    32   5.6  
TPHA0A03580 Chr1 (791948..792679) [732 bp, 243 aa] {ON} Anc_3.35...    32   6.3  

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score = 1450 bits (3754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/740 (96%), Positives = 714/740 (96%)

Query: 1   MMLALRATRLLGPWTKIQRPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKT 60
           MMLALRATRLLGPWTKIQRPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKT
Sbjct: 1   MMLALRATRLLGPWTKIQRPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKT 60

Query: 61  TAPQVRVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLK 120
           TAPQVRVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLK
Sbjct: 61  TAPQVRVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLK 120

Query: 121 NAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXX 180
           NAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFG        
Sbjct: 121 NAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVL 180

Query: 181 XXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLC 240
                    SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLC
Sbjct: 181 SERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLC 240

Query: 241 XXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS 300
                    SISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS
Sbjct: 241 GGVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS 300

Query: 301 GVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSY 360
           GVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSY
Sbjct: 301 GVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSY 360

Query: 361 LVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTT 420
           LVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTT
Sbjct: 361 LVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTT 420

Query: 421 GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
           GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL
Sbjct: 421 GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI 540
           KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI
Sbjct: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI 540

Query: 541 RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
           RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA
Sbjct: 541 RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600

Query: 601 LDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG 660
           LDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG
Sbjct: 601 LDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG 660

Query: 661 NPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQD 720
           NPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQD
Sbjct: 661 NPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQD 720

Query: 721 EKDILDKQPFPDKSSINLKI 740
           EKDILDKQPFPDKSSINLKI
Sbjct: 721 EKDILDKQPFPDKSSINLKI 740

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/692 (66%), Positives = 548/692 (79%), Gaps = 21/692 (3%)

Query: 45  KIACTITTKRWSSSKTTAPQVRVPKSRNDGN-------DIKRLLSLAKKDWKLLCIAVGL 97
           ++   I +KR++S+ T   +     +  DG+       D+KRL  LAK+DWKLL  A+ L
Sbjct: 66  RLLLNIPSKRFNSTNTKEQE---SSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISL 122

Query: 98  LTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLG 157
           L+VSC IGMSLPK+IG+VLD LK  +S        + D +++  ++P IAFGL+LYEF+ 
Sbjct: 123 LSVSCLIGMSLPKIIGIVLDELKQIMS--------NPDFTVD--DVPEIAFGLNLYEFIS 172

Query: 158 CIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLG 217
            +G +LL+GTAAN+G                 + VIKKT+HQDAEFFDNNKVGDLISRL 
Sbjct: 173 LVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLS 232

Query: 218 SDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLI 277
           SDAYVVSRS+TQKVSDGFKA+LC         SISP+LSAFLLF TPPVMLS+ YFGRLI
Sbjct: 233 SDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLI 292

Query: 278 RDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINA 337
           R+NSR LQEATG LT+V+EEQFSG+KTVQ+FVAEQ+EIKRYN+ I+ ++NVGK+SAFINA
Sbjct: 293 RNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINA 352

Query: 338 KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIM 397
           K F++T+ LGDMSFL+VLAYGSYLVLHG LSIGDLTAYMMYTE TGS++FGLS+FYSEIM
Sbjct: 353 KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIM 412

Query: 398 QGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIE 457
           QG GAASRLFELTDRIP ISPT GKK++P KGEIEFKNVSF+YPTR  +QIFK+L+FKI+
Sbjct: 413 QGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKID 472

Query: 458 PGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPI 517
            GSNVCIVGPSGRGKSTIASLLL+YY PT G I VDGQDISK++SKSLRRH+ IVQQEP+
Sbjct: 473 AGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPV 532

Query: 518 LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQ 577
           LMSG+IRDNITYGL  + T +E+R +TK+CFCHNFITKFP+ Y TILGP+GTLLSGGQKQ
Sbjct: 533 LMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQ 592

Query: 578 RIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRS 637
           RIAIARAL+KKP +LILDEATSALDVESE AINYTFGKLMK K +TIISIAHRLSTIRRS
Sbjct: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRS 652

Query: 638 EIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNA 697
           E VIVLGNDGSV E+GKFK L+ +P SELS+LL+EK+T +ER  N    +  + E   N 
Sbjct: 653 ENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINI 712

Query: 698 ANESIVDVVLEEEILQNDIRSQDEKDILDKQP 729
            N S  +  + +E+L+N I+        D +P
Sbjct: 713 EN-STPESDITQELLENPIKEAIMDVAADNKP 743

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/733 (60%), Positives = 547/733 (74%), Gaps = 26/733 (3%)

Query: 1   MMLALRATRLLGPWTKIQRPSTMQGWM-LTRKL-----SFRAITIKP------NEVKIAC 48
           +++    + L+GP   I R   ++ +  L R+L     S R++  K       ++++   
Sbjct: 3   LIIGRTGSLLMGPSPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQFQT 62

Query: 49  TITTKRWSSSKTTAPQVRVPK---SRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIG 105
           T    R  +S     Q + PK    ++   D+ RLL LAK DWKLL IA+ LLTVSC IG
Sbjct: 63  TRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIG 122

Query: 106 MSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLI 165
           M++PKVIGM+LD+LK  +  +E       D  I  +++PPI  G S+YEFLG   A ++ 
Sbjct: 123 MTIPKVIGMILDVLKTGLETNE-----GKDGPISMADVPPIFMGYSIYEFLGGFAALMVF 177

Query: 166 GTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSR 225
           G  AN+G                 + VIKKTIHQD+EFFD +KVGDLISRLGSDAYVVSR
Sbjct: 178 GIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSR 237

Query: 226 SMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQ 285
           SMTQKVSDGFKAL+C         SISP+LS  LL FTPPV+ S+  FGR IRD S  LQ
Sbjct: 238 SMTQKVSDGFKALICGGVGVGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQ 297

Query: 286 EATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSS 345
           EATGQLTRVSEEQ SGV+TVQ+FVAEQ+EI RY++ I+D++NVGK +A+INA+ FT TSS
Sbjct: 298 EATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSS 357

Query: 346 LGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASR 405
           LGD+SFL+VLAYGSYLVL GGL+IGDLTA+M+YTE TGS+VFGL+SFYSE+MQGVGAA+R
Sbjct: 358 LGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATR 417

Query: 406 LFELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIV 465
           LFELTDR+P I PTTGKK++PGKGEI FK+V+F+YPTRPG+ IF+ ++ KI  GSNVC+V
Sbjct: 418 LFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVV 477

Query: 466 GPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRD 525
           GPSGRGKSTIA LLL++Y P++G I +DGQDISKLN KSLRRHIG+VQQEP+LMSG++RD
Sbjct: 478 GPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRD 537

Query: 526 NITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARAL 585
           NITYGLT   + EEIR V KQCFCHNFI KFP  Y T++GP G LLSGGQKQRIAIARAL
Sbjct: 538 NITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARAL 597

Query: 586 LKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
           +KKP +L+LDEATSALDVESE AINYTFG+LMK K VTI+SIAHRLSTIRRSE +IVLGN
Sbjct: 598 IKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGN 657

Query: 646 DGSVVEIGKFKTLFGNPLSELSQLLNEK---STINERNPNEKPAETPEQES-QKNAANES 701
           DGSVVE GKFK LF +P SELS+LLNEK   S  +  + +   +E PE E+ QKNA  E+
Sbjct: 658 DGSVVETGKFKELFADPSSELSKLLNEKSSRSENSSSSYSPNASEQPEDEANQKNAPEEA 717

Query: 702 IVDVVLEEEILQN 714
             D V  EEIL++
Sbjct: 718 HDDSV--EEILKD 728

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/626 (67%), Positives = 503/626 (80%), Gaps = 7/626 (1%)

Query: 54  RWSSSKTTAPQVRVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIG 113
           R  S K    Q    ++ ++  DI RL+ L ++DWKLL  AVGLLT+SC+IGM++PKVIG
Sbjct: 97  RKYSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIG 156

Query: 114 MVLDLLKNAIS-KSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFG 172
           ++LD LKNA++  S D +  S D      +LPPI FGLS YEFLG    ALL+G AAN+G
Sbjct: 157 LILDQLKNALAANSVDGQPVSID------KLPPIVFGLSFYEFLGGFALALLVGIAANYG 210

Query: 173 XXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVS 232
                            + VIKKTIHQDAEFFD +KVGDLISRLGSDAYVVSRSMTQKVS
Sbjct: 211 RIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVS 270

Query: 233 DGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLT 292
           DGFKAL+C         ++SP+LS  LL FTPPV+LS+  FG+ I   SR+LQEATG LT
Sbjct: 271 DGFKALICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLT 330

Query: 293 RVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFL 352
           +V+EEQ SG+KTVQ+FVAEQREI RYN  I+D++N+GK++A INAK F+ TS++GD+SFL
Sbjct: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFL 390

Query: 353 LVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDR 412
            VL +GSYLVL   L+IGDLTA+MMYTE TG+++FGLS+FYSEIMQG GAASRLFELTDR
Sbjct: 391 TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDR 450

Query: 413 IPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGK 472
           +P IS T G KY PG GEIEFKNVSFAYPTRP + IFK+LNFKIE GSNVCIVGPSGRGK
Sbjct: 451 VPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGK 510

Query: 473 STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
           ST+A LL KYYKP++G I +DGQ+I+ LNSKSLRRHIG+VQQEPILMSG+IRDNI YGLT
Sbjct: 511 STVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLT 570

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
              T +EIR+V KQCFCHNFIT+F   Y T++GP+GTLLSGGQKQRIAIARAL+KKP +L
Sbjct: 571 EMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRIL 630

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
           ILDEATSALDVESE AINYTFG+LMKKKE+TI+SIAHRLSTIRRSE VIVLG+DGSVVE+
Sbjct: 631 ILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 690

Query: 653 GKFKTLFGNPLSELSQLLNEKSTINE 678
           GKFK L+ +P SELSQLLNEKST ++
Sbjct: 691 GKFKELWDDPTSELSQLLNEKSTPHQ 716

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/738 (60%), Positives = 539/738 (73%), Gaps = 30/738 (4%)

Query: 10  LLGPWTKIQRPSTMQGWMLTRKLSF-RAITIKPNEVKIACTITTKRWSSSKTTAPQVRVP 68
           LL P  +I RP +       R LS+ R + I   ++ +       RW+S  + + +   P
Sbjct: 4   LLRPVPRILRPLSKSQL---RPLSYIRPLNIVRPQISLISIRIGVRWNSQLSPSQEENRP 60

Query: 69  K-----------SRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLD 117
           K             +   D  RL SLAK+DW+LLC A+ LLT+SC IGMS+PKVIG+VLD
Sbjct: 61  KPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLD 120

Query: 118 LLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXX 177
           +L+  I   E  +L + ++     +L PIAFGL++Y+FLG     LL+GTAANF      
Sbjct: 121 VLRKGI---EGKDLQNVNMD----DLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVML 173

Query: 178 XXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 237
                       S V+ KT+HQD+EF+D +KVGDLISRLGSDAYVVSRSMTQKVSDGFKA
Sbjct: 174 RILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 233

Query: 238 LLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEE 297
           L+C         SISPELS  LLFF PP++ S+  FG+ IR  S+ LQEATGQLTRV+EE
Sbjct: 234 LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEE 293

Query: 298 QFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAY 357
           Q SGVKTVQ+FVAEQRE+ RYN  I+ +YNVG+++AFINA+ FT T+ LGDMSF++VL Y
Sbjct: 294 QLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLY 353

Query: 358 GSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMIS 417
           GSYLVL G L+IGDLTA+M+YTE TGS+VFGL++FYSE+MQGVGAASRLF+LTD I  IS
Sbjct: 354 GSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS 413

Query: 418 PTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
           PT G+KYIPGKG+IEFKNVSF+YPTRP +QIFK +N K+ PGSNVCIVGPSGRGKSTIA 
Sbjct: 414 PTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIAL 473

Query: 478 LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA 537
           LLL+YY PT G I VDGQDISK+N K+LRRHIG+VQQEPILMSG+IRDNITYGL   AT 
Sbjct: 474 LLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATK 533

Query: 538 EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597
           EEIR V KQCFCHNFITKFPD Y T++G  G LLSGGQ+QRIAIARAL+KKPN+L+LDEA
Sbjct: 534 EEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEA 593

Query: 598 TSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657
           TSALDVESE AINYTFG+LMK   +TI+SIAHRLSTI+RSE VIVLG DGSV+E GKFK 
Sbjct: 594 TSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKE 653

Query: 658 LFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIR 717
           LF NP SEL +LL EKS+ ++ N +  P   P      NA  + +V+ +  E+IL+    
Sbjct: 654 LFANPNSELCKLLTEKSSRSDGN-DSLPPPPP------NATQDKVVEQI-AEKILERFPE 705

Query: 718 SQDEKDILDKQPFPDKSS 735
           +    D   K+ F D SS
Sbjct: 706 AGQSPDATVKEIFKDVSS 723

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/632 (66%), Positives = 507/632 (80%), Gaps = 12/632 (1%)

Query: 66  RVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISK 125
           R    +   +++ RL+ +  +DWKLL +A+ LLT+SC+IGM++PKVIG+VLD LKN ++ 
Sbjct: 137 RAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTD 196

Query: 126 SEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXX 185
           S          S+E+S+LPPIAFGL+LY FLG    AL+IGT  N+G             
Sbjct: 197 SPS--------SLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVV 248

Query: 186 XXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXX 245
               S VIKKT+HQDAEFFD NKVGDLISRLGSDAYVVSRS+TQKVSDGFKA+LC     
Sbjct: 249 ARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGI 308

Query: 246 XXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTV 305
               SISP+LS+FL+ F P V++S+  FG+ IRD S  LQEATGQLTRVSEEQ +GVKTV
Sbjct: 309 GMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTV 368

Query: 306 QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG 365
           Q+FVAEQ+EI+RYNN I+D+YN+GK SA +N+K  T TS +GDMSFL+VLAYGSYLVLHG
Sbjct: 369 QSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHG 428

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI 425
            L+IGDLTA+M+YT+ T +++FGLS+FYSEIMQGVGAA RLF+LTDRIP I PT G+K+I
Sbjct: 429 SLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFI 488

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           PG G IEF+N+ FAYPTRP +Q+FK+LNFKIEPG++VCIVGPSGRGKSTIA LLL+YY P
Sbjct: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
           ++G I +D QDI KLN KSLR+++GIVQQEP+LMSGSIRDNITYGL  EAT +EIR V+K
Sbjct: 549 SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK 608

Query: 546 QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
           QCFCHNFITKFPD Y+TI+GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVES
Sbjct: 609 QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668

Query: 606 ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665
           E AINYTFGKLMK K VTI+SIAHRLSTIRRSE +IVLGNDGSVVE GKFK L+ +P SE
Sbjct: 669 EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE 728

Query: 666 LSQLLNEKSTINERNPNEKPAETPEQESQKNA 697
           LS+LLNEK    +   N+K A  P Q   +N 
Sbjct: 729 LSKLLNEK----QSRANKKEAPLPPQSDGENG 756

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/678 (62%), Positives = 515/678 (75%), Gaps = 11/678 (1%)

Query: 56  SSSKTTAP-QVRVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGM 114
           S+  +T P ++   +  ++  D+ RL  L KKD+KLL +++ LLT+SCTIGM +PK+IG+
Sbjct: 141 STKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGL 200

Query: 115 VLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXX 174
           +LD LK+  +  +            SS  P I FGL+LYEFLG    AL IG AAN+G  
Sbjct: 201 ILDALKSVATTPDGG----------SSPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRL 250

Query: 175 XXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDG 234
                          S V+K T+HQD+EFFD +KVGDLISRLG+D+Y+VSRS+TQK+SDG
Sbjct: 251 ILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDG 310

Query: 235 FKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRV 294
            K+L+C          +S +LS+ L+ F  PV+LS+  FG+ IR NSR+LQ+ATGQLTRV
Sbjct: 311 VKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRV 370

Query: 295 SEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV 354
           SEEQ +GV+TVQ+FVAEQREIKR+N+ I+++++VGK +AFINAK FT TS +GD+SFL V
Sbjct: 371 SEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTV 430

Query: 355 LAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
           L YGSYLVLHG L+IGDLTA+M+YTE TG+A+FGLS+FYSEIMQG GAASRLFELTDR+P
Sbjct: 431 LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP 490

Query: 415 MISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKST 474
            I PT GK Y PGKGEIEFKNVSFAYPTRP +QIFKSLNFKI+PGSNVCIVGPSG+GKST
Sbjct: 491 TIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKST 550

Query: 475 IASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYE 534
           IA LLL YY PT+G I +DGQDI+KLNSKSLRR I +VQQEP+LMSG+IRDNITYGLT E
Sbjct: 551 IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610

Query: 535 ATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLIL 594
            T EEIR V KQCFCHNFI KFP  Y T +GP+GTLLSGGQKQRIAIARAL+KKPN+LIL
Sbjct: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670

Query: 595 DEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGK 654
           DEATSALDVESE AINYTFG+LMK K +TI+SIAHRLSTIRRSE +IVLGNDGSVVE+GK
Sbjct: 671 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGK 730

Query: 655 FKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQN 714
           FK LF +P SELS+LLNEKS+  +      P  +    S  N ++      +LEE+  Q 
Sbjct: 731 FKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVSSANGSSIHHEGTILEEDHAQE 790

Query: 715 DIRSQDEKDILDKQPFPD 732
           D  S+    I+  Q   D
Sbjct: 791 DHESEAPPTIITTQQLED 808

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/691 (64%), Positives = 514/691 (74%), Gaps = 30/691 (4%)

Query: 19  RPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKTTAPQVRVPKSRNDGNDIK 78
           RP+ +   +L++ + F +   + +   +  T      S+SK  A      KS +D  DI 
Sbjct: 51  RPAPISKSLLSQFVRFNSTKTQQDIPPLPST------SASKQPAKPAYQSKS-DDYKDII 103

Query: 79  RLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSI 138
           RL  LAK+DWKLL  A+ LLT+SC+IGMS+PKVIG+VLD LK   S   D      DL I
Sbjct: 104 RLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKT--SSGSDF----FDLKI 157

Query: 139 ESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIH 198
                 PI F L LYEFL     ALLIG  ANFG                 + VIKKT+H
Sbjct: 158 ------PI-FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLH 210

Query: 199 QDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAF 258
           QDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+C         S+SP+LS  
Sbjct: 211 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSVL 270

Query: 259 LLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRY 318
           LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE  E+ RY
Sbjct: 271 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 330

Query: 319 NNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMY 378
           N  I+D++ VGK +AF NAK FT TS LGD+SFL VLAYGSYLVL   LSIGDLTA+M+Y
Sbjct: 331 NVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 390

Query: 379 TELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSF 438
           TE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G IEFK+VSF
Sbjct: 391 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSF 450

Query: 439 AYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDIS 498
           +YPTRP  QIFKSLNFKI PGS+VCIVGPSGRGKSTIA LLL+YY PT GTI +D QDI+
Sbjct: 451 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 510

Query: 499 KLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPD 558
           K+N KSLRRHIGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHNFITKFP+
Sbjct: 511 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 570

Query: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMK 618
            Y T++GPNGTLLSGGQKQRIAIARAL+KKP VLILDEATSALDVESE AINYTFG+LMK
Sbjct: 571 TYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMK 630

Query: 619 KKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKST--- 675
            K +TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ NP S LSQLLNE++    
Sbjct: 631 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVP 690

Query: 676 ------INERNPNEKPAETPEQESQKNAANE 700
                 + + N  E+P E  E   Q+N  ++
Sbjct: 691 SEQQQQVEKDNEKEEPNED-ENHDQRNEGDD 720

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/603 (70%), Positives = 481/603 (79%), Gaps = 13/603 (2%)

Query: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAEL 131
           +D  DI RL  LAK+DWKLL  A+ LLT+SC+IGMS+PKVIG+VLD LK   S   D   
Sbjct: 100 DDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKT--SSGSDF-- 155

Query: 132 GSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQ 191
              DL I      PI F L LYEFL     ALLIG AANFG                 + 
Sbjct: 156 --FDLKI------PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAN 206

Query: 192 VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
           VIKKT+HQDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+C         S+
Sbjct: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           SP+LS  LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE
Sbjct: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371
             E+ RYN  I+D++ VGK +AF NAK FT TS LGD+SFL VLAYGSYLVL   LSIGD
Sbjct: 327 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386

Query: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEI 431
           LTA+M+YTE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G I
Sbjct: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVI 446

Query: 432 EFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT 491
           EFK+VSF+YPTRP  QIFK+LNFKI PGS+VCIVGPSGRGKSTIA LLL+YY PT GTIT
Sbjct: 447 EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506

Query: 492 VDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHN 551
           +D QDISKLN KSLRRHIGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHN
Sbjct: 507 IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566

Query: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611
           FITKFP+ Y T++GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINY
Sbjct: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626

Query: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
           TFG+LMK K +TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ NP S LSQLLN
Sbjct: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686

Query: 672 EKS 674
           EK+
Sbjct: 687 EKA 689

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/658 (64%), Positives = 511/658 (77%), Gaps = 18/658 (2%)

Query: 68  PKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSE 127
           PKS  + +D+ RL  L K DWKLL +A+ LLT+SC IGM +PKVIG++LD LK   +   
Sbjct: 120 PKS--NFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTATQS 177

Query: 128 DAELGSADLSIESSELPP--IAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXX 185
           + E           E PP  + FGL++YEFLG    ALL G  ANFG             
Sbjct: 178 EGE-----------EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLV 226

Query: 186 XXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXX 245
               S VIK+TIHQDA+F+D +K GDLISRLG+DAY+VSRS+TQK+SDGFK+L+C     
Sbjct: 227 ARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV 286

Query: 246 XXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTV 305
               S+S +LSA L     PV++S+  FG+ IR NSR+LQ+ATGQLTRVSEEQ +GVKTV
Sbjct: 287 GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTV 346

Query: 306 QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG 365
           Q+FVAEQREIKR+N  I+++++VGK SAFINAK FT TS +GD+SFL VL YGSYLVLHG
Sbjct: 347 QSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG 406

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI 425
            L+IGDLTA+M+YTE TG+++FGLS+FYSEIMQG GAASRLFELTD +P I PT GK Y+
Sbjct: 407 SLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYL 466

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           PGKGEIEFKNVSF+YPTRP +QIFK+LNFKIEPGSNVCIVGPSG+GKSTIA LLL YY P
Sbjct: 467 PGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
           T+G I +DGQDI+K+NSKSLRR +GIVQQEP+LMSGSIRDNITYGLTY  T EEIR+V K
Sbjct: 527 TSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAK 586

Query: 546 QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
           QCFCHNFITKFP  Y T +GP+GTLLSGGQKQRIAIARAL+KKPN+LILDEATSALDVES
Sbjct: 587 QCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646

Query: 606 ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665
           E AINYTFG+LMK K +TI+SIAHRLSTIRRSE VIVLGNDGSV+E+GKFK LF +P SE
Sbjct: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSE 706

Query: 666 LSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEI--LQNDIRSQDE 721
           LS+LLNEKS+  ++  ++  +  PE ++         +D  +E+ +  + ND+ S+ +
Sbjct: 707 LSKLLNEKSS-RKKTKSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESK 763

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/603 (70%), Positives = 478/603 (79%), Gaps = 13/603 (2%)

Query: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAEL 131
           +D  DI RL  LAK+DWKLL  A+ LLT+SC+IGMS+PKVIG+VLD LK   S   D   
Sbjct: 100 DDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKT--SSGSDF-- 155

Query: 132 GSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQ 191
              DL I      PI F L LYEFL     ALLIG AANFG                 + 
Sbjct: 156 --FDLKI------PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206

Query: 192 VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
           VIKKT+HQDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+C         S+
Sbjct: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           SP+LS  LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE
Sbjct: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371
             E+ RYN  I+D++ VGK +AF NAK FT TS LGD+SFL VLAYGSYLVL   LSIGD
Sbjct: 327 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386

Query: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEI 431
           LTA+M+YTE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G I
Sbjct: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVI 446

Query: 432 EFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT 491
           EFK+VSF+YPTRP  QIFKSLNFKI PGS+VCIVGPSGRGKSTIA LLL+YY PT GTI 
Sbjct: 447 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506

Query: 492 VDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHN 551
           +D QDI+KLN KSLRR IGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHN
Sbjct: 507 IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566

Query: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611
           FITKFP+ Y T++GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINY
Sbjct: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626

Query: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
           TFG+LMK K +TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ N  S LSQLLN
Sbjct: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686

Query: 672 EKS 674
           E++
Sbjct: 687 ERA 689

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/625 (68%), Positives = 486/625 (77%), Gaps = 22/625 (3%)

Query: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAEL 131
           +D  DI RL  LAK+DWKLL  A+ LLT+SC+IGMS+PKVIG+VLD LK + S S+  EL
Sbjct: 100 DDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTS-SGSDFFEL 158

Query: 132 GSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQ 191
                     ++P   F L LYEFL     ALLIG AANFG                 + 
Sbjct: 159 ----------KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206

Query: 192 VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
           VIKKT+HQDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+C         S+
Sbjct: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           SP+LS  LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE
Sbjct: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371
             E+ RYN  I+D++ VGK +AF NAK FT TS LGD+SFL VLAYGSYLVL   LSIGD
Sbjct: 327 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386

Query: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEI 431
           LTA+M+YTE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G +
Sbjct: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVV 446

Query: 432 EFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT 491
           EFK+VSF+YPTRP  QIFK+LNFKI PGS+VCIVGPSGRGKSTIA LLL+YY P+ GTI 
Sbjct: 447 EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM 506

Query: 492 VDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHN 551
           +D QDI+K+N KSLRRHIGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHN
Sbjct: 507 IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566

Query: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611
           FITKFP+ Y T++G  GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINY
Sbjct: 567 FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626

Query: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
           TFG LMK K +TIISIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ NP S LSQLLN
Sbjct: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686

Query: 672 EKST---------INERNPNEKPAE 687
           E++          I + N NE+  E
Sbjct: 687 ERAAPGPSDQQQQIEKDNENEESTE 711

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/660 (61%), Positives = 495/660 (75%), Gaps = 15/660 (2%)

Query: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSAD 135
           +I RL  LA+ DWKLL +A+ LLT+SC+IGM++PKVIGMVLD+ KNAI+  E  +    D
Sbjct: 126 EIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPK----D 181

Query: 136 LSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKK 195
           L     +LPP+ +GL LY+FL     AL++ T ANFG                 S VIKK
Sbjct: 182 LR----DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKK 237

Query: 196 TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPEL 255
           TIHQDAEFFD NKVGDLISRL SDAYVVSRSMTQ +SDGFKA++C          IS  L
Sbjct: 238 TIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTL 297

Query: 256 SAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREI 315
           +  L  F PP+++ +  +GR IR  SR LQ++TG LT+V+EEQ SGVKTVQ+FVAEQ+EI
Sbjct: 298 ATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEI 357

Query: 316 KRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAY 375
           KRYN+ I+ V++VGK  A  NA  F+ TS LGD SFL+VLAYGS+LVL G LSIGDLTA+
Sbjct: 358 KRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF 417

Query: 376 MMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKN 435
           M+YTE +GSAVFGLS+FYSE+M+G GAASRLFELTD  P I  T G  Y+PGKGEI+F+N
Sbjct: 418 MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFEN 477

Query: 436 VSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQ 495
           VSF+YPTR  +QIF +LNF I+ GSNVC+VGPSGRGKSTIASLLLKYY PT+G IT+DGQ
Sbjct: 478 VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537

Query: 496 DISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITK 555
           DISK+++KSLRRH+G+VQQEPILMSGSIRDNITYG+ Y  T +EIR V+K+CFCHNFITK
Sbjct: 538 DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITK 597

Query: 556 FPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGK 615
           F D Y+T++GP G LLSGGQKQRIAIARAL+KKPN+LILDEATSALDVESE AINYT G+
Sbjct: 598 FSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQ 657

Query: 616 LMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKST 675
           LMK +++TIISIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ +  S+L +LLNEK+ 
Sbjct: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717

Query: 676 INERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKDILDKQPFPDKSS 735
                 N +  E  +   +    N+       EE+  Q  I  Q    +LD   +  KS+
Sbjct: 718 DTTSKMNAETVEKNDPSPKTEKLND-------EEKEEQRRIEEQVLNQVLDDMNYDQKST 770

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/678 (59%), Positives = 492/678 (72%), Gaps = 30/678 (4%)

Query: 49  TITTKRWSSSKTTAPQVRVP--------------KSRNDG-NDIKRLLSLAKKDWKLLCI 93
           T+   R  S KT   Q + P              +S N G  ++ RL  LA  DWKLL  
Sbjct: 99  TLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTF 158

Query: 94  AVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLY 153
           A+GLL +S  IGMS+PKVIGMVLD +KN  S        SA   +   +LPPI   LS+Y
Sbjct: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKNTYS--------SATGPVGLDDLPPIVNDLSMY 210

Query: 154 EFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLI 213
           EFLG    AL+IGT ANFG                 S VI+K IHQDAEFFD NKVGDLI
Sbjct: 211 EFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLI 270

Query: 214 SRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYF 273
           SRL SDAYVVSRSMTQ VSDGFKA++C         +IS  L++ LL F PP+++ ++ +
Sbjct: 271 SRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIY 330

Query: 274 GRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESA 333
           G+ IR  SR LQE+TG LTRVSEEQ SGVKT+Q+FVAE +E++RYN  I+ V+  GK+ A
Sbjct: 331 GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEA 390

Query: 334 FINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFY 393
             NA  F+ T+ LGD+SFL+VLAYGS+LVL GGL++GDLTA+M+YTE TGSAVFGLS+FY
Sbjct: 391 LTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFY 450

Query: 394 SEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLN 453
           SE+M+G GAASRLFE+TD  P I PT GK Y+PG G+I FK+VSF+YPTRPG+QIF  LN
Sbjct: 451 SELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLN 510

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513
           F IEPGSNVCIVGPSGRGKSTI SLLL+YY P++G IT+D QDIS+L+ KSLRRH+G+VQ
Sbjct: 511 FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQ 570

Query: 514 QEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
           QEP+LMSGSI+ N+TYGL  E + +EIR V K+CFCH F+TKFP+ Y TI+GP G  LSG
Sbjct: 571 QEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSG 630

Query: 574 GQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLST 633
           GQKQRIAIARAL+KKP +LILDEATSALDVESE AINYT GKLMK KE+TIISIAHRLST
Sbjct: 631 GQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLST 690

Query: 634 IRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQES 693
           IRRSE VIVLGNDGSVVE+GKFK L+ +  SEL +LLN+K         +KP    + + 
Sbjct: 691 IRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK-------RDKPTPRVQSDP 743

Query: 694 QKNAANESIVDVVLEEEI 711
           +K+   E  +D  + E++
Sbjct: 744 EKDREQEHQIDNQVREQV 761

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/642 (60%), Positives = 487/642 (75%), Gaps = 8/642 (1%)

Query: 69  KSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSED 128
           KS+ +  +I RL+ LA+ DWKLL +A+GLLT+S T+GM++PKVIG+VLD +KNA      
Sbjct: 101 KSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGF-- 158

Query: 129 AELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXX 188
               S  +++E  +LPPI +GL +++FL      L+ GT ANFG                
Sbjct: 159 ----SGPMTLE--DLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARL 212

Query: 189 XSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXX 248
            S VIKK IHQDAEFFD NKVGDLISRL SDAYVVSRSMTQ VSDGFKA++C        
Sbjct: 213 RSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMM 272

Query: 249 XSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAF 308
            +IS  L++ L  F PP+++ ++ +G+ IR  SR+LQE+TG LT+VSEEQ SGVKT+QAF
Sbjct: 273 INISASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAF 332

Query: 309 VAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS 368
           VAE +E+ RYNN I+ V++ GK+ A  NA  F+ T  LGD+SFL+VLAYGS+LVL GGLS
Sbjct: 333 VAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLS 392

Query: 369 IGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGK 428
           +GDLTA+M+YTE TGSAVFGLS+FYSE+M+G GAASRLFE+TD    I P++GK Y+P  
Sbjct: 393 VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSW 452

Query: 429 GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
           GEI+F++VSF+YPTRPG+QIF  LNF IEPGSNVC+VGPSGRGKSTIASLLL+YY P +G
Sbjct: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512

Query: 489 TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCF 548
            I +DGQ+ISKL+ KSLRRH+G+VQQEP+LMSGSIR N+TYG+  E T +EIR V K+CF
Sbjct: 513 RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCF 572

Query: 549 CHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESA 608
           CH FITKFP+ Y+T++GP G  LSGGQKQRIAIARAL+KKP +LILDEATSALDVESE A
Sbjct: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 632

Query: 609 INYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQ 668
           INYT G+LM+ +E+TIISIAHRLSTIRRSE VIVLGNDGSVVE+GKFK L+ N  SEL +
Sbjct: 633 INYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692

Query: 669 LLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEE 710
           LLN+K     ++ +    ET E E       +   D  L+++
Sbjct: 693 LLNDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQK 734

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/681 (59%), Positives = 495/681 (72%), Gaps = 24/681 (3%)

Query: 59  KTTAPQVRVPKSRNDGN--DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVL 116
           KT   +   P S   G   D+KRL  LA+ DWK+L +AV LLTVSCTIGM++PKVIG+VL
Sbjct: 95  KTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVL 154

Query: 117 DLLKNAISKS---------EDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGT 167
           D  KNA+S S         ED++      S+   +LPPI   + LY+F    G ALLIGT
Sbjct: 155 DATKNALSGSNTNNGNGGLEDSK------SLTLDDLPPIVGDIQLYDFFLLFGGALLIGT 208

Query: 168 AANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSM 227
            ANFG                 S VIKKT+H D EF+D NKVGDL+SRLG+DAY+VSRSM
Sbjct: 209 MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSM 268

Query: 228 TQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEA 287
           TQ +SDGFKAL+C          IS  L++ L  F PP+++ +  +G  IR  SR+LQ+A
Sbjct: 269 TQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA 328

Query: 288 TGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLG 347
           +G LT+V+EEQ SG+KTVQ+FVAE +E+ RYNN ++ V+NVGK+ AF NA  F+ T+ LG
Sbjct: 329 SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388

Query: 348 DMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLF 407
           D SFLLVLAYGS+LVL G L+IGDLTA+M+YTE TGSAVFGLS+FYSE+M+G GAA+RLF
Sbjct: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448

Query: 408 ELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGP 467
           EL D  P I  TTGK + P  G++EF++VSF+YPTR  +QIFK LNF IEPGSNVCIVGP
Sbjct: 449 ELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP 508

Query: 468 SGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI 527
           SGRGKSTIASLLL+YY PT+G I VDGQDI+KL+SKSLRR +G+VQQEPILMSG+IR+NI
Sbjct: 509 SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568

Query: 528 TYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLK 587
           TYG++ + + EEIR V K+CFCH FI+KFP+ Y+TI+GP G LLSGGQKQRIAIARALL 
Sbjct: 569 TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628

Query: 588 KPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDG 647
           KP +LILDEATSALDVESE AINYT G+LMK KE+TIISIAHRLSTIRRSE VIVLG DG
Sbjct: 629 KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688

Query: 648 SVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPN--EKPAETPEQESQ--KNAANESIV 703
           SVVE+GKFK L+ N  S L +LL E S            PA T E E Q  +N  ++S  
Sbjct: 689 SVVEMGKFKDLYANHDSALHKLLTEPSEQQHSQHQQYAPPAITQESEPQTEENGKDDSGE 748

Query: 704 DVVLEEE---ILQNDIRSQDE 721
           D   + E     QN+ R Q+E
Sbjct: 749 DQNSDHEENSQDQNEKRLQEE 769

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/630 (63%), Positives = 468/630 (74%), Gaps = 20/630 (3%)

Query: 63  PQVRV-PKSRNDGN--DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLL 119
           P V V PK  ++G   DI RL  L K DWKLL  A+ LLTVSC IGM +PKVIG VLD L
Sbjct: 74  PAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSL 133

Query: 120 KNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXX 179
           K+   K             E SEL  + + +SL  F   +   LL+G  AN+        
Sbjct: 134 KDIQGK-------------EFSEL--MIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRI 178

Query: 180 XXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALL 239
                     + VIK  IHQDA+FFD  KVGDLISR+G+DA++VSRS+TQK+SDG KA+ 
Sbjct: 179 LSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVF 238

Query: 240 CXXXXXXXXXSISPELS-AFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQ 298
                     SIS  LS + L+    P++LS+  FG+ IRDNS+KLQE T  LTRVSEEQ
Sbjct: 239 IGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQ 298

Query: 299 FSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG 358
           F+G+KT+Q+FVAEQ E+ ++N  I+ ++ VGKE+AFINAK FT  S +GD+SFL+VL+YG
Sbjct: 299 FNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYG 358

Query: 359 SYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISP 418
           S+LV    LS+GDLTA+M+YTE TG+A+F LS F+SEIMQG GAASR+FELTD  P I+P
Sbjct: 359 SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP 418

Query: 419 TTGKKYIPGKG-EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
           T G K+IP KG EIEFKNVSF YPTRP   IF++LNFKIE GSNVCIVGPSG+GKSTIA 
Sbjct: 419 TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478

Query: 478 LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA 537
           LLL YY P+ G I +DGQDIS L++KSLRRHIGIVQQEPILMSG+IRDNITYGLTY  T 
Sbjct: 479 LLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK 538

Query: 538 EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597
           EEIR V KQCFCHNFIT+FPD Y T +GP+GTLLSGGQKQRIAIARAL+KKP VLILDEA
Sbjct: 539 EEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEA 598

Query: 598 TSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657
           TSALDVESE AINYTFG+LMK K +TI+SIAHRLSTIRRSE VIVLGNDGSVVE GKFK 
Sbjct: 599 TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658

Query: 658 LFGNPLSELSQLLNEKSTINERNPNEKPAE 687
           LF NP SELS+LL EKS+ N   P  +P E
Sbjct: 659 LFANPASELSKLLREKSSGNNAAPEIQPQE 688

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/657 (56%), Positives = 477/657 (72%), Gaps = 20/657 (3%)

Query: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSAD 135
           ++ RL SLAK DWKLL +A+GLL+VSCTIGM++PKVIG+VLD  KN +  S   E GS D
Sbjct: 99  EVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS--YEKGSQD 156

Query: 136 LSIESSE--------------LPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXX 181
           L   + +              LPPI   LS+ +F+G    AL++G  ANFG         
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 182 XXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCX 241
                   SQVIK+T+H D EFFD NKVGDLISR GSDAYVVSRSMTQ VSDGFKA++C 
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 242 XXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSG 301
                    IS  L++ +L F PP+++ +  +G+ I   SR+LQ+++G LTRV+EEQ +G
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 302 VKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL 361
           ++T+++FVAE++EI+RYN+ I+ ++ VGK  AF NA  F+ T+ LGDMSF++VL YG+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 362 VLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG 421
           VL G LSIGDLTA+M+YTE TGS+VFGLS+FYSE+M+G GAASRLFEL D    +     
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 422 KKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
               P +G+IEF++VSF+YPTRP +QIFK ++F IEPGSNVCIVGPSG+GKSTI SLLL+
Sbjct: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516

Query: 482 YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR 541
           +Y P  G+I +D  DISK  +KSLRRH+G+VQQEP LMSG+IRDNITYGL+Y  T +EIR
Sbjct: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576

Query: 542 RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSAL 601
            V+KQCFCH FITKFPD Y T++GP G  LSGGQ+QRIAIARAL+KKP +LILDEATSAL
Sbjct: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636

Query: 602 DVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
           DVESE AINYT G LM+ KE+TIISIAHRLSTIRRSE +IV+GNDGSVVE+GKF  L+ N
Sbjct: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696

Query: 662 PLSELSQLLNEKS---TINERNPNEKPAETPEQESQKNAANESIVDVV-LEEEILQN 714
             SEL +LLNEK         N ++ P ++P+ +      +    DV  + +++++N
Sbjct: 697 EESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVVKN 753

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/648 (58%), Positives = 483/648 (74%), Gaps = 17/648 (2%)

Query: 75  NDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSA 134
           +++ RLL L K DWKLL  A+GLLT+SC+IGM++PKVIG+VLD  K+A++++E  E G A
Sbjct: 104 HEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETG-A 162

Query: 135 DLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIK 194
            +S+   ++P I    +L + L     ALL+G+AANFG                 +QVIK
Sbjct: 163 PMSL--LDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIK 220

Query: 195 KTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPE 254
           KT+H DAEFFD NKVGDLISRLGSDAY+VSRSMT  +SDG KA LC          IS  
Sbjct: 221 KTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISST 280

Query: 255 LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQRE 314
           L++ ++ F PP+++++  +G+ IR  SR+LQ++TG LTRVSEEQF+G+KT+++FVAE +E
Sbjct: 281 LTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKE 340

Query: 315 IKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTA 374
           ++RYN  ++ ++NV K     +A  F+ T+ LGD+SFLLVLAYGS+LVL G LS+G LTA
Sbjct: 341 MRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTA 400

Query: 375 YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFK 434
           +M+YTE TGS+VFGLS+FYSE+M+G GAASRLFELTD    +  T G+ ++P  G IEFK
Sbjct: 401 FMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFK 460

Query: 435 NVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDG 494
           +VSF+YPTRP SQIFK L   I PGSNVCIVGPSGRGKSTIASLLL++Y   +GTI +DG
Sbjct: 461 DVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG 520

Query: 495 QDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT 554
           QDISK+++KSLR+H+G+VQQEP+LMSG+IRDNITYGL+Y  + +EIR V K+CFCHNFIT
Sbjct: 521 QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT 580

Query: 555 KFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFG 614
           KFPD Y T++GP G LLSGGQ+QRIAIARAL+KKP +LILDEATSALDVESE AINYT G
Sbjct: 581 KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 640

Query: 615 KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
           +LM+ KE+TI+SIAHRLSTIRRSE ++VLGNDGSV+E GKF  L+ +  SEL +LLNE +
Sbjct: 641 RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHA 700

Query: 675 TINERNPNEKPAETPEQESQKNAA-------------NESIVDVVLEE 709
           +     P   PA   E+ S   AA             NE ++  VLE+
Sbjct: 701 S-EPAKPEASPAPAQEEASAPQAADIPRDIEGGNLRLNEEVIKHVLED 747

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/676 (57%), Positives = 484/676 (71%), Gaps = 36/676 (5%)

Query: 48  CTITTKRWSSSKTTAPQVRVPK------SRNDGN---DIKRLLSLAKKDWKLLCIAVGLL 98
           C     R +    T PQ  VP       S ++G+   D+KRL  L KKD KLL +A+ LL
Sbjct: 48  CLTVPSRTNFIPRTLPQFLVPHRTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLL 107

Query: 99  TVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGC 158
           T+SC+IGM++PK+IG +LD L+N      + E  ++   I+   +P       L  FL  
Sbjct: 108 TISCSIGMAIPKIIGTILDTLRN------NYENLTSLSQIKILNIP-------LSTFLMG 154

Query: 159 IGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGS 218
           +G  L+ G  ANFG                 SQV+K  IH+D EFFD  KVGDL+SR+G+
Sbjct: 155 VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGN 214

Query: 219 DAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIR 278
           DA+VVSRS+T KV+DG ++            ++S EL+  L    PP++  +  FG+ IR
Sbjct: 215 DAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIR 274

Query: 279 DNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAK 338
            NS+KLQ+ TG LTRV+EEQF+G++TVQ FVAE+ EIKR+NNV+++++ VGKESAFIN K
Sbjct: 275 MNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGK 334

Query: 339 LFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQ 398
            FT  S +GD+ FL+VL YGSYLV+HG +SIGDLTA+M+YTE TG+A+FGLSSFYSE+MQ
Sbjct: 335 FFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQ 394

Query: 399 GVGAASRLFELTDRIPMISPTTGK-KYIP----GKGEIEFKNVSFAYPTRPGSQIFKSLN 453
           GVGAASR+FE+ D+ P I  TTG+ K+ P    G  EIEFKNVSF YPTRP +QIFK+LN
Sbjct: 395 GVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLN 454

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513
           FK+  GSNVCIVGPSGRGKSTIASLLL +Y   +G I +DGQDI+ LN+KSLRR IGIVQ
Sbjct: 455 FKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQ 514

Query: 514 QEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQ--TILGPNGTLL 571
           QEPILMSG+IRDNITYGLT E + EEIR V KQCFCHNFITKFPD Y      G +GT L
Sbjct: 515 QEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSL 574

Query: 572 SGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRL 631
           SGGQKQRIAIARAL+KKPN+LILDEATSALDVESE AINYTFG++MK K +TI+SIAHRL
Sbjct: 575 SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRL 634

Query: 632 STIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNP---NEKP--- 685
           STIRR E VIVLGNDGSVVE+GKFK L+ NP SELS+LLNEKS+  E  P   N  P   
Sbjct: 635 STIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTKEATPQPVNPPPFID 694

Query: 686 -AETPEQESQKNAANE 700
               PE++ + + A+E
Sbjct: 695 LQTNPEEKKEADNASE 710

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  505 bits (1300), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 277/669 (41%), Positives = 415/669 (62%), Gaps = 24/669 (3%)

Query: 43  EVKIACTITTKRWSSSKTTAPQVRVPK-----SRNDG-NDIKRLLSLAKKDWKLLCIAVG 96
           + +   T  + +  ++K T  Q ++ K     S N G  D+KRL +LAK +   + +A+ 
Sbjct: 56  QTRFNSTNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLALV 115

Query: 97  LLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPP--IAFGLSLYE 154
           L+ +S T+ M +P VIG +LDL  N  + ++D     +   +++ E       +G +  +
Sbjct: 116 LILISSTVSMVVPSVIGKLLDLSSN--TSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHTQ 173

Query: 155 FLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLIS 214
           F   +G   +IG  AN G                 ++ +K  + QDA F D+N+VGDLIS
Sbjct: 174 FFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLIS 233

Query: 215 RLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFG 274
           RL SDA +V++S+T  VSDG +A+L           IS +L++ ++   PP+ + ++ +G
Sbjct: 234 RLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYG 293

Query: 275 RLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAF 334
           + IR+ SR+LQ A G LT+V+EEQ +  KT+QA+  E++EI+RY + ++DV++VG + A 
Sbjct: 294 KKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAI 353

Query: 335 INAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYS 394
            +   F  T  +G+ + L +L  G+ ++  G L++GDL+++MMY   TGS++FGLSSFYS
Sbjct: 354 TSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYS 413

Query: 395 EIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGE-IEFKNVSFAYPTRPGSQIFKSLN 453
           E+M+G GAA+R+FEL DR P+I PT GK  +  KG+ I F++VSF YPTRP  ++F  ++
Sbjct: 414 ELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKIS 473

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513
           FKIEPG ++C VGPSG GKST++ LLL+YY  T G I +   +I  L+ +  R+ +G+VQ
Sbjct: 474 FKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQ 533

Query: 514 QEPILMSGSIRDNITYGLTYEATAE--EIRRVTKQCFCHNFITKFPDQYQTILGPNGTLL 571
           QEP+L +G+I DNI Y +  E  ++  ++    K+  C  F+  FPD   TI+GP GT L
Sbjct: 534 QEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQL 593

Query: 572 SGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKE---VTIISIA 628
           SGGQKQRIAIAR+ L  P++L+LDEATSALD +SE  I  T    +KK+E   +T ISIA
Sbjct: 594 SGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMT----LKKREAEGLTTISIA 649

Query: 629 HRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN----EKSTINERNPNEK 684
           HRLSTI+ S  V+VL  +GSVVE GKF  L  NP SEL+ LL+    E + +      E 
Sbjct: 650 HRLSTIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKEGQEPAYVAADVAAET 709

Query: 685 PAETPEQES 693
           PAE P  ++
Sbjct: 710 PAEAPSTDN 718

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  503 bits (1294), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 269/616 (43%), Positives = 387/616 (62%), Gaps = 6/616 (0%)

Query: 71  RNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAE 130
           R+   D+KRL  LA+ +   + IA+ L+ +S  + M +P VIG +LD+ K   +  E+ +
Sbjct: 94  RSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADEENGK 153

Query: 131 LGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXS 190
             S  L  +  E   I +GL+  +F   +G    +G  AN G                 +
Sbjct: 154 GVSEKLKEKEDEDKKI-YGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVARLRT 212

Query: 191 QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
           + +K  + Q+A F D+NKVGDLISRL +DA +V++S+TQ VSDG +A+L           
Sbjct: 213 RTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGMMSY 272

Query: 251 ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVA 310
           IS +L++ +L   PP+   ++ +GR IR+ SR+LQ + G LT+V+EEQ +  +T+QA+  
Sbjct: 273 ISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGG 332

Query: 311 EQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
           E++EI RY   +++V+++G + A  +   F  T  +G+ + L +L  G+ ++  G L++G
Sbjct: 333 EKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGALTVG 392

Query: 371 DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGE 430
           +L+++MMY   TGS++FGLS+FYSE+M+G GAA+R+FEL+DR P I PT GK  I   G+
Sbjct: 393 ELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITLFGK 452

Query: 431 -IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
            +EFKNVSF YPTRP  QIF+  + KIEPG +VC VGPSG GKST++SLLL+YY    G+
Sbjct: 453 TVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGS 512

Query: 490 ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE--EIRRVTKQC 547
           I V G+DI   + +  RR +G+VQQEP+L +G+I +NI Y +  E   E   I R  +  
Sbjct: 513 ILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAIESA 572

Query: 548 FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESES 607
            C  F+  FPD   T++GP GT LSGGQKQRIA+AR  L  P++LILDEATSALD +SE 
Sbjct: 573 NCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQSED 632

Query: 608 AINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELS 667
            I        +K + T ISIAHRLSTI+ S  V+VLG +G VVE G F+ L  NP S L+
Sbjct: 633 IIAQNLQARNEKGQTT-ISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSSGLN 691

Query: 668 QLL-NEKSTINERNPN 682
            LL  E+S+ NE  PN
Sbjct: 692 ILLTQEESSANEGTPN 707

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  501 bits (1290), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 278/667 (41%), Positives = 407/667 (61%), Gaps = 23/667 (3%)

Query: 13  PWTKIQ-RPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKTTAPQVRVPKSR 71
           P  +IQ RP  +   +L  +   R  T    + K   T+ T + S   + A   +     
Sbjct: 52  PIPRIQTRPPALSHQLLQAR---RLNTSTEQDQKTLQTLKTLKLSPHDSKASGFK----- 103

Query: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNA----ISKSE 127
               DIKRL  LAK +   + +A+  + +S  + M++P VIG +LD  K      +S S 
Sbjct: 104 ----DIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASG 159

Query: 128 DAELGSADLSIESSELPP-IAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXX 186
           +  +GS+D S    +    + +GL+  +F   +G   ++G  AN G              
Sbjct: 160 EG-VGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKLVA 218

Query: 187 XXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXX 246
              ++ +K  + QDA F DNN+VGDLISRL SDA +VS+S+TQ +SDG +A++       
Sbjct: 219 RLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVGFG 278

Query: 247 XXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQ 306
               IS +L+  +    PP+ + +M +G+ IR+ SR+LQ + G LT+V+EEQ S  +TVQ
Sbjct: 279 MMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTVQ 338

Query: 307 AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGG 366
           A+  E++EI+RY   +++V+N+G + A  +   F +T  +G+++ L +L  G+ ++  G 
Sbjct: 339 AYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRSGA 398

Query: 367 LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP 426
           +++GDL+++MMY   TGS++FGLSSFYSE+M+G GAA+R+FEL DR P+I PT G   + 
Sbjct: 399 ITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDPVT 458

Query: 427 GKGE-IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
            +G+ IEF+NV+FAYPTR  ++IF  L+  I+PG +VCIVGPSG GKSTIASLLL+YY  
Sbjct: 459 LQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYDV 518

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR--RV 543
            AG I + GQDI + N +  RR +G+VQQEP+L +G+I DNITY +  E   ++ R  R 
Sbjct: 519 DAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVSRA 578

Query: 544 TKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
             Q  C  F+  FPD  +T++GP G  +SGGQKQRIA+ARA L  P VLILDEATSALD 
Sbjct: 579 IGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSALDS 638

Query: 604 ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
           +SE  +  +  +   ++  T +SIAHRLSTI+ S  VIVL   G V E G F+ L  +P 
Sbjct: 639 QSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISDPD 697

Query: 664 SELSQLL 670
           S L+QLL
Sbjct: 698 SHLTQLL 704

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  496 bits (1277), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 264/606 (43%), Positives = 379/606 (62%), Gaps = 15/606 (2%)

Query: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSAD 135
           +++RL  LA+ + K L  A+ L+ +S  + M++P VIG +LD     ISK ++A  G  D
Sbjct: 82  NVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLD-----ISKEKEAG-GDGD 135

Query: 136 LSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKK 195
              E+       +GL+  +F   +G   +IG  AN G                 ++ +K 
Sbjct: 136 EEQETR-----IYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKA 190

Query: 196 TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPEL 255
            + QDA F D N+VGDLISRL SDA +VS+S+TQ  SDG +A++           IS +L
Sbjct: 191 ALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQL 250

Query: 256 SAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREI 315
           +  +L   PP++L +M +GR IR+ +R+LQ   G LT+V+EEQ +  +T+Q++  E++EI
Sbjct: 251 TGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEI 310

Query: 316 KRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAY 375
           +RY   ++ V+ VG   A  +   F  T  +G+M+ L +L  G+ ++  G +++G+L+++
Sbjct: 311 RRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSF 370

Query: 376 MMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP-GKGEIEFK 434
           MMY   TGS++FGLSSFYSE+M+G GAASR+FEL DR+P+I PT GK  I     EIEFK
Sbjct: 371 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFK 430

Query: 435 NVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDG 494
           NV F+YP+R    +F  LN KI PG +VC+VGPSG GKSTI+SLLL++Y   +G IT+ G
Sbjct: 431 NVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGG 490

Query: 495 QDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR--RVTKQCFCHNF 552
           Q+I   N +  RR +GIVQQEP+L +GSI+DNI Y L     +++ R  R  +   C  F
Sbjct: 491 QNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRF 550

Query: 553 ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYT 612
           I+ FPD   T++GP GT LSGGQKQRIAIARA +  P++LILDEATSALD +SE  I   
Sbjct: 551 ISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQA 610

Query: 613 FGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNE 672
                +  ++T ISIAHR+STI  S  VIVL  +G V E G F  L   P S L++LL++
Sbjct: 611 LRARSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSK 669

Query: 673 KSTINE 678
           +  + +
Sbjct: 670 EHELQD 675

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  495 bits (1274), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 277/683 (40%), Positives = 407/683 (59%), Gaps = 25/683 (3%)

Query: 1   MMLALRATRLLGPWTKIQRPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKT 60
           M L+L   ++  P   +QR           + SF A T     ++     T    +S++ 
Sbjct: 8   MWLSLAVKQVPRPVIGMQRWPPFNHLHQRTRFSFSAST----RIQTRLNSTANPRASTEE 63

Query: 61  TAPQVRVPKSRNDGN-----DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMV 115
              Q R+  S   GN     D++RL  LA+ + K L  A+ L+ +S  + M++P VIG +
Sbjct: 64  KPHQERLELSTATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKL 123

Query: 116 LDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXX 175
           LD+ +      ED E  S D      E   + +GL   +F   +     +G  AN G   
Sbjct: 124 LDVAR------EDVEQESGD------EEEAVLYGLPEKQFYLALSGIFAVGALANMGRIV 171

Query: 176 XXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGF 235
                         ++ +K  + Q+  F D+N+VGDLISRL SDA +VS+S+TQ  SDG 
Sbjct: 172 VLKTTGERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGA 231

Query: 236 KALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS 295
           +A++           IS +L+A +    PP++L + ++GR +R+ SR+LQ   G LT+V+
Sbjct: 232 RAVIQGAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVA 291

Query: 296 EEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVL 355
           EEQ +  +TVQA+  E+REI+RY   +++V++VG + A I+   F  T  +G+ + L +L
Sbjct: 292 EEQLNATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALL 351

Query: 356 AYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPM 415
             G+ ++  GG+S+G+L+++MMY   TGS++F LSSFYSE+M+G GAA R+FEL DR P+
Sbjct: 352 LTGTSMIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPL 411

Query: 416 ISPTTGKKYIPGKGE-IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKST 474
           I PT GK  +   G+ I F +V+FAYPTRP  Q+F  ++  I PG +VCIVGPSG GKST
Sbjct: 412 IHPTIGKDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKST 471

Query: 475 IASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYE 534
           +ASLLL++Y P +G+IT+ G+DI   N    RR +GIVQQEP+L + SI +NITY L   
Sbjct: 472 VASLLLRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLH 531

Query: 535 ATAEEIR--RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
            T +  R  R  +   C  F+  FP+  QT +GP GT LSGGQKQR+A+ARA L+ P +L
Sbjct: 532 LTKDPARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAIL 591

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
           ILDEATSALD +SE  +  T  +  ++ ++T ISIAHR STI+ S  VIVL   G V+E 
Sbjct: 592 ILDEATSALDSKSEDIVASTLLQRCQEAKIT-ISIAHRKSTIQHSTRVIVLDKLGHVLET 650

Query: 653 GKFKTLFGNPLSELSQLLNEKST 675
           G ++ L G+P S LS LL+++ +
Sbjct: 651 GTYQQLIGDPGSSLSGLLSKEHS 673

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  496 bits (1276), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/674 (41%), Positives = 409/674 (60%), Gaps = 41/674 (6%)

Query: 45  KIACTITTKR-WSSSKTTAPQVRVPK--------------SRNDG-NDIKRLLSLAKKDW 88
           K A TI ++  W+S+K+    +  P+              S++ G  DI+RL SLA+ + 
Sbjct: 49  KQAVTIRSQLCWNSTKSNHNNILKPENDIVPDIKGQMLRDSKSSGFKDIQRLFSLARPEL 108

Query: 89  KLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAF 148
           + + +A+  + +S ++ M++P +IG +LD  K    ++E+ +          + +P I F
Sbjct: 109 RYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEED--------SKTIVPDITF 160

Query: 149 -GLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNN 207
            GL+  +F   +G   L+G  AN G                 ++ +K  + QDA F D N
Sbjct: 161 FGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALDQDATFLDAN 220

Query: 208 KVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVM 267
           +VGDLISRL SDA +VS+++TQ VSDG +A++           +S +L+  ++   PP+ 
Sbjct: 221 RVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGVMMLMVPPLG 280

Query: 268 LSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN 327
           + ++ +GR IR+ S++LQE+ G L++V+EEQ +  KT+QA+V E+ EI RY   +++V+ 
Sbjct: 281 IMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRYATEVRNVFR 340

Query: 328 VGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVF 387
           +G + A  +   F  T  +G+++ + +L  G+ ++  G L++G+L+++MMY   TGS++F
Sbjct: 341 IGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMYAVYTGSSLF 400

Query: 388 GLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG--KKYIPGKGEIEFKNVSFAYPTRPG 445
           GLSSFYSE+M+G GAASR+FEL DR P+I  T G   K + GK  I+F+NVSF YP+RP 
Sbjct: 401 GLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGK-SIKFENVSFTYPSRPN 459

Query: 446 SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSL 505
            +IF +LN +I PG +VCIVG SG GKSTIASLLL+YY    G+I +   DI   + +  
Sbjct: 460 HKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKY 519

Query: 506 RRHIGIVQQEPILMSGSIRDNITYG----LTYEATAEEIRRVTKQCFCHNFITKFPDQYQ 561
           RR IG VQQEP L +GSI DNI Y     LT E   E ++   KQ  C+ F+ KFPD  Q
Sbjct: 520 RRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCNIFLGKFPDGLQ 579

Query: 562 TILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKE 621
           T++GP G  LSGGQKQRIA+ARA L  P +LILDE+TSALD  SE  +  T  +    + 
Sbjct: 580 TLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVAKTL-QARSARG 638

Query: 622 VTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNP 681
           +T ISIAHRLSTI+ S  VIV+G  GSVVE G F  L  NP SEL+ LL+++        
Sbjct: 639 LTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLLSQQ-------- 690

Query: 682 NEKPAETPEQESQK 695
           NE   E P QE Q+
Sbjct: 691 NEHIDEDPSQEKQE 704

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  491 bits (1265), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/645 (41%), Positives = 399/645 (61%), Gaps = 30/645 (4%)

Query: 49  TITTKRWSSS--------KTTAPQVRVPK-----SRNDG-NDIKRLLSLAKKDWKLLCIA 94
           T+  +RW+SS         +  P + V K     S+++G  DIKRL  LAK + K + +A
Sbjct: 54  TLEIRRWNSSIVDVKKKRSSPPPSIEVQKLSNEVSKSNGMKDIKRLFKLAKPEAKYILLA 113

Query: 95  VGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYE 154
           +  + +S ++ M++P +IG +LDL K        A+    D    + +   + FGL+  +
Sbjct: 114 LLFIVISSSVSMTIPTIIGKLLDLAK--------ADNDDEDGDNNAKKEKLMIFGLTKPQ 165

Query: 155 FLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLIS 214
           F   +G   L G  AN                   ++ +K  ++QDA F D N+VGDLIS
Sbjct: 166 FYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFLDTNRVGDLIS 225

Query: 215 RLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFG 274
           RL SDA +V++++TQ VSDG +A++           IS +L+  ++   PP+ + ++ +G
Sbjct: 226 RLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMIMVPPLGVMALVYG 285

Query: 275 RLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAF 334
           R IR  SR+LQ + G LT+V+EEQ +  +T+QA+  E  EI RY   ++ V++VG + A 
Sbjct: 286 RKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRKVFDVGLKEAV 345

Query: 335 INAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYS 394
            +   F  T  +G+++ + +L  G+ ++ +G L++GDL+++MMY   TGS++FGLS FYS
Sbjct: 346 TSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGSSLFGLSGFYS 405

Query: 395 EIMQGVGAASRLFELTDRIPMISPTTG--KKYIPGKGEIEFKNVSFAYPTRPGSQIFKSL 452
           E+M+G GAA+R+FEL DR P+I PT G   K + GK  IEF+NVSFAYPTRP   I  +L
Sbjct: 406 ELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGK-SIEFQNVSFAYPTRPTHSILNNL 464

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           +  I+PG +VCIVGPSG GKST++SLLL+YY  + G+I +DGQ+I + N +  RR +G+V
Sbjct: 465 SISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLRKYRRLLGVV 524

Query: 513 QQEPILMSGSIRDNITYGL----TYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
           QQEP+L +G+I DNI Y +    T  A + +++R  +Q  C  F+  FP+   T++GP G
Sbjct: 525 QQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEGVNTLVGPRG 584

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
           T LSGGQKQRIA+ARA L  P +LILDEATSALD +SE  +     + ++   +T ISIA
Sbjct: 585 TQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVELG-LTTISIA 643

Query: 629 HRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEK 673
           HRLSTI+ S  VIVL   GSVVE G F+ L     SEL+ LL+++
Sbjct: 644 HRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQ 688

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  491 bits (1264), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 259/601 (43%), Positives = 378/601 (62%), Gaps = 17/601 (2%)

Query: 75  NDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSA 134
            DIKRL  LAK + + + IA+ L+ +S  + M++P VIG +LD+ +    + E       
Sbjct: 84  QDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQPE------- 136

Query: 135 DLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIK 194
                 +E   + FGL+  +F   +G   ++G  AN G                 ++ +K
Sbjct: 137 ------TEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMK 190

Query: 195 KTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPE 254
             + QDA F D+N+VGDLISRL SDA +VS+S+TQ +SDG +A++           IS +
Sbjct: 191 AALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWK 250

Query: 255 LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQRE 314
           L+  ++   PP+ + ++ +G+ IR+ SR+LQ + G+LT+VSEEQ S  KT+QA+  E++E
Sbjct: 251 LTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKE 310

Query: 315 IKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTA 374
           I RY + ++ V++VG + A  +   F +T  +G+++ L +L  G+ ++  G +++GDL++
Sbjct: 311 IHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSS 370

Query: 375 YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGE-IEF 433
           +MMY   TGS++FGLSSFYSE+M+G GAA+R+FEL DR P+I PT GK  +  + + I F
Sbjct: 371 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHF 430

Query: 434 KNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
            +V F+YPTRP   IF+ LNF + PG +VCIVGPSG GKST+ASLLL+YY   +G I + 
Sbjct: 431 NHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLG 490

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR--RVTKQCFCHN 551
             +I   N +  RR +G+VQQEP+L SG+I DNITY +  E   +E R  R   Q  C  
Sbjct: 491 NDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTK 550

Query: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611
           F+  FPD  QT +GP GT LSGGQKQRIA+ARA L  P++LILDEATSALD +SE  +  
Sbjct: 551 FLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQ 610

Query: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
           +  +   + + T ISIAHR+STI+ S  VIVL   G+V E G F  L   P S L++LL+
Sbjct: 611 SLQQRSARGKTT-ISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLS 669

Query: 672 E 672
           +
Sbjct: 670 K 670

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  489 bits (1260), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 270/655 (41%), Positives = 397/655 (60%), Gaps = 33/655 (5%)

Query: 38  TIKPNEVKIACTITTK-RWSSSK------------TTAPQVRVPKSRNDGN---DIKRLL 81
           T+ P   KI  T+  + RW+S++            T   + ++  S  +G+   DIKRL 
Sbjct: 41  TVAP---KIQLTVERQVRWNSTQRAPVNVNSNASVTAVKEAKLSPSDLNGSGFKDIKRLF 97

Query: 82  SLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESS 141
            LAK +   + +A+ L+ +S  + M++P ++G +LD+ K+                    
Sbjct: 98  RLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDR----------KDADDTTED 147

Query: 142 ELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDA 201
           +  P  FG++  +F   + A  L+G AAN G                 ++ +K  + QDA
Sbjct: 148 DEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAALDQDA 207

Query: 202 EFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLF 261
            F D N+VGDLIS L SDA +V++S+TQ VSDG +A++           IS +L++ ++ 
Sbjct: 208 TFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMIL 267

Query: 262 FTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNV 321
             PP+ + ++ +GR IR+ SR+LQ + G LT+VSEEQ   VKT+Q++V E++EI RY   
Sbjct: 268 MIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATE 327

Query: 322 IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTEL 381
           +++V+N+G + A  +   F  T  +G++S L +L  G+ ++ +G +++GDL+++MMY   
Sbjct: 328 VRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVY 387

Query: 382 TGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP-GKGEIEFKNVSFAY 440
           TGS++FGLSSFYSE+M+G GAA+R+FEL DR P+I PT G+  +      I F+NVSF Y
Sbjct: 388 TGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRFENVSFTY 447

Query: 441 PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKL 500
           PTR   +IF  L+  +EPG +VCIVGPSG GKST+ASLLL+YY    G I +   +I+  
Sbjct: 448 PTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSF 507

Query: 501 NSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE--IRRVTKQCFCHNFITKFPD 558
           N +  RR +GIVQQEP L +G+I DNI Y +  E    +  I     Q  C  F+  FPD
Sbjct: 508 NVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANCSKFLANFPD 567

Query: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMK 618
             QT++GP G  LSGGQKQRIA+ARA L  P++LILDEATSALD +SE  +  T  ++  
Sbjct: 568 GLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQTL-RVRV 626

Query: 619 KKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEK 673
           ++ +T ISIAHRLSTI+    V+VLG  G VVE G F+ L  NPLSELS LL+++
Sbjct: 627 QRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSILLSQQ 681

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  484 bits (1245), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/621 (43%), Positives = 390/621 (62%), Gaps = 19/621 (3%)

Query: 59  KTTAPQVRV--PKSRNDG-NDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMV 115
           K+T P +++    S++ G  DIKRL  L+K + K + +A+ L+ +S ++ M++P VIG +
Sbjct: 68  KSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKL 127

Query: 116 LDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXX 175
           LDL     S  ED E GS     +S++L    +G +  +F   +GA  +IG  AN     
Sbjct: 128 LDLASE--SDGEDEE-GS-----KSNKL----YGFTKKQFFTALGAVFIIGAVANASRII 175

Query: 176 XXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGF 235
                         ++ +K  + QDA F D N+VGDLISRL SDA +V++S+TQ VSDG 
Sbjct: 176 ILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGT 235

Query: 236 KALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS 295
           +A++           +S +L+  ++   PP+   ++ +GR IR+ SR+LQ + G LT+V+
Sbjct: 236 RAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVA 295

Query: 296 EEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVL 355
           EEQ +  +T+QA+  E+ E++RY   +++V+++G + A  +   F  T  +G+ + L +L
Sbjct: 296 EEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLL 355

Query: 356 AYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPM 415
             G+ ++  G +++G+L+++MMY   TGS++FGLSSFYSE+M+G GAA+R+FEL DR P+
Sbjct: 356 LVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPL 415

Query: 416 ISPTTGKKYIP-GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKST 474
           I PT GK  +   +  I FKNVSF YPTRP  QIFK LN  I+PG +VC VGPSG GKST
Sbjct: 416 IRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKST 475

Query: 475 IASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYE 534
           IASLLL+YY   +G+I    +DI   N +  RR IG VQQEP+L +G+I DNI Y +  E
Sbjct: 476 IASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPE 535

Query: 535 ATAEE--IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
              ++  IRR   +  C  F+  FPD  QT++G  G  LSGGQKQRIA+ARA L  P VL
Sbjct: 536 IAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVL 595

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
           ILDEATSALD +SE  +     + +++   T ISIAHRLSTI+ S  VIVLG  GSVVE 
Sbjct: 596 ILDEATSALDSQSEEIVAKNLQRRVERG-FTTISIAHRLSTIKHSTRVIVLGKHGSVVET 654

Query: 653 GKFKTLFGNPLSELSQLLNEK 673
           G F+ L   P SEL+ LL E+
Sbjct: 655 GSFRDLIAIPNSELNALLAEQ 675

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  481 bits (1239), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/656 (41%), Positives = 396/656 (60%), Gaps = 15/656 (2%)

Query: 54  RWSSSKTTAPQVRVPKSRNDGN---DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPK 110
           RW  S  + P   +     + +   DIKRL  LA+ + K +  A+ L+ +S ++ M +P 
Sbjct: 61  RWQHSNASKPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPG 120

Query: 111 VIGMVLDLLK-NAISKSE-DAELGSADLSIESS-----ELPPIAFGLSLYEFLGCIGAAL 163
           VIG ++D+ K +  S SE D + G A    + S     +   +  GL+L +F G + +  
Sbjct: 121 VIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLF 180

Query: 164 LIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVV 223
           ++G AAN G                 ++ +K  + QDA F DNNKVGDLISRL SDA +V
Sbjct: 181 VVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIV 240

Query: 224 SRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRK 283
           S+S+TQ +SDG ++L+           IS +L+  ++   PP+ + ++ +GR IR+ SR 
Sbjct: 241 SKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRT 300

Query: 284 LQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTIT 343
           LQ + G LT+ +EEQ S  +T+QA+  E++ I+ Y   ++ VY VG + A  +   F +T
Sbjct: 301 LQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLT 360

Query: 344 SSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAA 403
             +G+ + L +L  G+ ++  G +++GDL+++M+Y   TGS++FG+SSFYSE+M+G GAA
Sbjct: 361 GLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAA 420

Query: 404 SRLFELTDRIPMISPTTGKKYIP-GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNV 462
           +R+FEL DR P I PT G+  +   +  +EFK V FAYPTR    IF+ L+ +I+PG +V
Sbjct: 421 ARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHV 480

Query: 463 CIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGS 522
           CIVGPSG GKST+ASLLL++Y   AG I + GQ+I+  N +  RR +GIVQQEP+L +G+
Sbjct: 481 CIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGT 540

Query: 523 IRDNITYGLTYEATAEEIRRVTK---QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRI 579
           I +NI Y +      EE  RV +   Q  C  F++ FPD  QT++GP GT LSGGQKQRI
Sbjct: 541 ILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRI 600

Query: 580 AIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEI 639
           A+ARA L  P++LILDEATSALD  SE  I  T      + + T ISIAHR+STI+ S  
Sbjct: 601 ALARAFLLDPDLLILDEATSALDSRSEEVIARTLHSRTTRGKTT-ISIAHRVSTIQHSTR 659

Query: 640 VIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQK 695
           VIVLG +G VVE G F  L  N  S+L++LL ++    +          PE   Q+
Sbjct: 660 VIVLGRNGGVVETGTFDELASNTDSQLNKLLRKEEEPVQPGEITNAPHRPEGSDQR 715

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  476 bits (1224), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 279/693 (40%), Positives = 410/693 (59%), Gaps = 39/693 (5%)

Query: 3   LALRATRLLGPWTKIQRPSTMQGWMLTRKLSFRAIT---IKPNEV---KIACTITTKRWS 56
           + +R  RL      ++   T  G + + K SF+ I    ++ N +   K A    + R  
Sbjct: 1   MIVRMIRLCNGPKMLRSQFTWVGALYSTKPSFKTIVCPKVRLNSIISHKKALLSQSIRLQ 60

Query: 57  SS-----KTTAPQVRV--PKSRNDG-NDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSL 108
           SS      +T P +++    S++ G  DIKRL  L++ + K + +A+ L+ +S ++ M++
Sbjct: 61  SSIAEGKASTKPTLKLSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAV 120

Query: 109 PKVIGMVLDL-----LKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAAL 163
           P VIG +LD+      +    K+ D++L                +GL+  +F   +G   
Sbjct: 121 PSVIGKLLDVASESDDEEDEEKARDSKL----------------YGLTKKQFFTALGLVF 164

Query: 164 LIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVV 223
           +IG  AN                   ++ +K  + QDA F D N+VGDLISRL SDA +V
Sbjct: 165 VIGAVANASRIIILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIV 224

Query: 224 SRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRK 283
           ++S+TQ VSDG +A++           +S +L+  ++   PP+   ++ +G+ IR+ SR+
Sbjct: 225 AKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQ 284

Query: 284 LQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTIT 343
           LQ + G LT+V+EEQ +  +T+QA+  E+ E+ RY   +++V+++G + A  +   F  T
Sbjct: 285 LQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGST 344

Query: 344 SSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAA 403
             +G+ + L +L  G+ ++  G ++IG+L+++MMY   TGS++FGLSSFYSE+M+G GAA
Sbjct: 345 GLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAA 404

Query: 404 SRLFELTDRIPMISPTTGKKYIP-GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNV 462
           +R+FEL DR P+I PT GK  I      + FKNVSF YPTRP  QIFK LN  I+PG +V
Sbjct: 405 ARVFELNDRKPLIHPTIGKDPISLAHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHV 464

Query: 463 CIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGS 522
           C VGPSG GKSTIASLLL+YY   +G+I  D +D+   N +  RR IG VQQEP+L +G+
Sbjct: 465 CAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGT 524

Query: 523 IRDNITYGLTYEATAEEIR--RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIA 580
           I DNI Y +  E    E R  R  +Q  C  F+  FPD  QT++G  G  LSGGQKQRIA
Sbjct: 525 ILDNILYCIPSEIAEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIA 584

Query: 581 IARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIV 640
           +ARA L  P +LILDEATSALD +SE  +     K +++  +T ISIAHRLSTI+ S  +
Sbjct: 585 LARAFLLDPALLILDEATSALDSQSEEIVAKNLQKRVERG-LTTISIAHRLSTIKHSTRI 643

Query: 641 IVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEK 673
           IVLG  GSVVE G F+ L   P SEL+ LL E+
Sbjct: 644 IVLGKHGSVVETGSFRDLIAIPDSELNALLAEQ 676

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  475 bits (1222), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 265/648 (40%), Positives = 394/648 (60%), Gaps = 13/648 (2%)

Query: 54  RWSSSKTTAPQVRV-PKSRNDGN--DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPK 110
           RW+ +++  P   + P+  N  +  DIKRL  LA+ + + +  A+ L+ +S ++ M +P 
Sbjct: 61  RWNHAESRQPSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPG 120

Query: 111 VIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAAN 170
           VIG ++D  K+    S+  E  +   +          FGL++ +F G + +  ++G AAN
Sbjct: 121 VIGKLMDAAKDDQQASKLVE--NDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAAN 178

Query: 171 FGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQK 230
            G                 ++ +K ++ QDA F DNNKVGDLISRL SDA +VS+S+TQ 
Sbjct: 179 MGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQN 238

Query: 231 VSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQ 290
           +SDG ++L+           IS +L+  ++   PP+   ++ +G+ IR+ SR LQ + G 
Sbjct: 239 MSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGG 298

Query: 291 LTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMS 350
           LT+ +EEQ S  +T+QA+  E+  I +Y   ++ VY VG + A  +   F +T  +G+++
Sbjct: 299 LTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVA 358

Query: 351 FLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT 410
            L +L  G+ ++  G +++GDL+++M+Y   TGS++FG+SSFYSE+M+G GAA+R+FEL 
Sbjct: 359 VLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELN 418

Query: 411 DRIPMISPTTGKKYIPGKGE-IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSG 469
           DR P I PT G   +   G+ +EF+NV FAYPTR    IF++L F+I  G +VCIVGPSG
Sbjct: 419 DRRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSG 478

Query: 470 RGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITY 529
            GKST+ASLLL++Y    G IT+ GQ I+  N +  RR +G+VQQEP+L +G+I DNI Y
Sbjct: 479 GGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVY 538

Query: 530 GLTYEATAEEIR--RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLK 587
            +      +E R  R   Q  C  F++ FPD  QT++GP GT LSGGQKQRIA+ARA L 
Sbjct: 539 SVPQSLLNDENRVARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLL 598

Query: 588 KPNVLILDEATSALDVESESAINYT-FGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGND 646
            P++LILDEATSALD  SE  +    + +  + K  T ISIAHR+STI+ S  VIVLG  
Sbjct: 599 DPDLLILDEATSALDSRSEEVVARALYSRSTRGK--TTISIAHRVSTIQHSSRVIVLGRS 656

Query: 647 GSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQ 694
           G VVE G F  L  +P S+L+ LL ++   +     +  +  PE  SQ
Sbjct: 657 GYVVETGTFDELISDPDSQLNLLLRKEEEPSSEETTD--SHVPENTSQ 702

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  474 bits (1220), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/662 (41%), Positives = 399/662 (60%), Gaps = 25/662 (3%)

Query: 19  RPSTMQGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKT-TAPQVRV--PKSRNDG- 74
           +P T Q   LT  + +R   +    +++  ++     S  KT T P +++    S++ G 
Sbjct: 33  KPPTYQNMGLTLIIPYRKQFLS-QSIRLQSSV-----SEGKTFTKPTLKLSDANSKSSGF 86

Query: 75  NDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSA 134
            DIKRL  L+K + K + +A+ L+ +S ++ M++P VIG +LDL      + ++ +  S 
Sbjct: 87  KDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEKEEKAKSN 146

Query: 135 DLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIK 194
            L           +GL+  +F   +G   +IG  AN                   ++ +K
Sbjct: 147 KL-----------YGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMK 195

Query: 195 KTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPE 254
             + QDA F D N+VGDLISRL SDA +V++S+TQ VSDG +A++           +S +
Sbjct: 196 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 255

Query: 255 LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQRE 314
           L+  ++   PP+   ++ +GR IR+ SR+LQ + G LT+V+EEQ +  +T+QA+  E+ E
Sbjct: 256 LTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 315

Query: 315 IKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTA 374
           ++RY   +++V+++G + A  +   F  T  +G+ + L +L  G+ ++  G +++G+L++
Sbjct: 316 VRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSS 375

Query: 375 YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP-GKGEIEF 433
           +MMY   TGS++FGLSSFYSE+M+G GAA+R+FEL DR P+I PT GK  +   +  I F
Sbjct: 376 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVF 435

Query: 434 KNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           KNVSF YPTRP  QIFK LN  I PG +VC VGPSG GKSTIASLLL+YY   +G+I   
Sbjct: 436 KNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFG 495

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR--RVTKQCFCHN 551
            +DI   N +  RR IG VQQEP+L +G+I DNI Y +  E   +E R  R   Q  C  
Sbjct: 496 DEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTK 555

Query: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611
           F+  FPD  QT +G  G  LSGGQKQRIA+ARA L  P VLILDEATSALD +SE  +  
Sbjct: 556 FLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAK 615

Query: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
              + +++  +T ISIAHRLSTI+ S  V+VLG  GSVVE G F+ L   P SEL+ LL 
Sbjct: 616 NLQRRVERG-LTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLA 674

Query: 672 EK 673
           E+
Sbjct: 675 EQ 676

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  472 bits (1214), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/644 (42%), Positives = 390/644 (60%), Gaps = 23/644 (3%)

Query: 50  ITTKRWSSSKTTAPQVRVPKSRNDG-NDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSL 108
           I  K+ +S  +   ++    S++ G  DIKRL  L++ +   + +A+ L+ +S ++ M++
Sbjct: 60  IDGKKTASPDSPTLKLSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAV 119

Query: 109 PKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTA 168
           P VIG +LDL  +   + +  E     L           +GLS  +F   +GA  LIG  
Sbjct: 120 PSVIGKLLDLASDDDDEEDAKETKDNKL-----------YGLSKRQFFTALGAVFLIGAI 168

Query: 169 ANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMT 228
           AN                   ++ +K  + QDA F D N+VGDLISRL SDA +V++S+T
Sbjct: 169 ANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVT 228

Query: 229 QKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEAT 288
           Q VSDG +A++           +S +L+  ++   PP+   ++ +GR IR+ SR+LQ + 
Sbjct: 229 QNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSV 288

Query: 289 GQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGD 348
           G LT+V+EEQ +  +T+QA+  E+ E++RY   +++V++VG + A  +   F  T  +G+
Sbjct: 289 GGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGN 348

Query: 349 MSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE 408
            + L +L  G+ ++  G +++G+LT++MMY   TGS++FGLSSFYSE+M+G GAA+R+FE
Sbjct: 349 AAMLSLLLVGTNMIQSGAMTVGELTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFE 408

Query: 409 LTDRIPMISPTTGKKYIP-GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGP 467
           L DR P+I PT GK  +      I FK+VSF YPTRP  QIFK LN  I+PG +VC VGP
Sbjct: 409 LNDRKPLIRPTIGKDPVSLAHKPIVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGP 468

Query: 468 SGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI 527
           SG GKSTIASLLL+YY  +AG+I    +DI   N +  RR +G VQQEP+L +G+I DNI
Sbjct: 469 SGSGKSTIASLLLRYYDTSAGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNI 528

Query: 528 TYGLTYEATAEEIR--RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARAL 585
            Y +  E   +E R  R   Q  C  F+  FPD  QT++G  G  LSGGQKQRIA+ARA 
Sbjct: 529 LYCIPPEIAEQEDRVARAIGQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAF 588

Query: 586 LKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
           L  P VLILDEATSALD +SE  +     + +K+  +T ISIAHRLSTI+ S  VIVLG 
Sbjct: 589 LLDPAVLILDEATSALDSQSEEVVAKNLQRRVKRG-LTTISIAHRLSTIKHSTRVIVLGK 647

Query: 646 DGSVVEIGKFKTLFGNPLSELSQLLNEKS-------TINERNPN 682
            GSVVE G F+ L   P SEL+ LL E+        T+  +N N
Sbjct: 648 HGSVVETGSFQDLISIPGSELNALLAEQQDDEGKDETVTSKNNN 691

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  471 bits (1213), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/701 (38%), Positives = 406/701 (57%), Gaps = 42/701 (5%)

Query: 24  QGWMLTRKLSFRAITIKPNEVKIACTITTKRWSSSKTTAPQVR--------VPKSRNDGN 75
           Q +   RKL+ R     P   K   ++   RW+SS    P              S N+ N
Sbjct: 31  QSFNRLRKLAIRT----PMPSKPLGSLMQARWNSSNAKQPNTTNTDKTGQIAELSSNEKN 86

Query: 76  -----DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAE 130
                DI RLL LA+ +   +  A+ L+ +S T+ M LP VIG +LDL K++     + +
Sbjct: 87  SSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQ 146

Query: 131 LGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXS 190
                   +  +     +G +  +F   +G   + G  AN G                 +
Sbjct: 147 ESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRT 206

Query: 191 QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
           + +K  + QD+ F D N+VGDLISRL SD+ +V++S+TQ VSDG +A++           
Sbjct: 207 RTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTY 266

Query: 251 ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVA 310
           IS +L+  +    PP+   ++ +G+ IR+ S++LQ + G LT+V+EEQ    KT+Q++V 
Sbjct: 267 ISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVG 326

Query: 311 EQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
           E++EI+RY   ++ V+++G + A  +   F  T  +G++S L +L  G+ ++  G +++G
Sbjct: 327 EKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVG 386

Query: 371 DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGK-----KYI 425
           DL+++MMY   TG ++FGLS+FYSE+M+G GAA+R+FEL DR P I+PT GK     + +
Sbjct: 387 DLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNL 446

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           P    I FK+VSF YPTR   +IF  LN  I+PG ++CI GPSG GKSTIASLL++YY  
Sbjct: 447 P----ISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDV 502

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
             G I++   D+   N +  RR IG+V QEP+L +G+I +NI Y +   + A++ RRV+ 
Sbjct: 503 DQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVP-PSVAQDERRVSA 561

Query: 546 ---QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
              +  C  F++ FPD  +T++GP G  LSGGQKQR+A+ARA L  P +L+LDEATSALD
Sbjct: 562 AIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALD 621

Query: 603 VESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNP 662
            +SE  +  T  + +++  +T ISIAHR+STI  S  V+VLG DG VVE G F+ L   P
Sbjct: 622 SQSEEIVARTLQERVRRG-LTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRP 680

Query: 663 LSELSQLL----NEKSTINERNPNEKPAETPEQESQKNAAN 699
            SEL+ LL    +E+  I E NP+E       +E Q N  N
Sbjct: 681 NSELNYLLSLQQDEREEIKE-NPSEP------REIQPNTRN 714

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  456 bits (1172), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 253/604 (41%), Positives = 373/604 (61%), Gaps = 10/604 (1%)

Query: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDL---LKNAISKSEDAE-- 130
           DI  L  LAK +   +  ++GL+ ++  + M +P VIG +LD+   ++ A +K E+ E  
Sbjct: 98  DIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKDENDESS 157

Query: 131 -LGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXX 189
                +   E+     + +G +   F   +G   ++G  AN G                 
Sbjct: 158 KEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIVARLR 217

Query: 190 SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
           ++ +K  + QD +F D+NKVGDLISRL SD+ +VS ++T+ VSDG +A++          
Sbjct: 218 TRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMMS 277

Query: 250 SISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFV 309
            IS +LS  +LF  PP+ + +M +GR IR+ S+KLQE+ G LT++SEEQ +G +T+Q++V
Sbjct: 278 FISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRTIQSYV 337

Query: 310 AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
            E+ EI +Y   ++ VY+VG   A  +   F +T  +G+ + L +L  G  ++ +G LSI
Sbjct: 338 GEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLSI 397

Query: 370 GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKG 429
           G L+++MMY   TGS++FGLSSFYSEIM+G GAASR+FE+   +P I+ T G   I  + 
Sbjct: 398 GGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDPISFQD 457

Query: 430 E-IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
           + IEF+++ FAYPTR G  IF+ LN KI PG +VCI+GPSG GKSTI+SLLL+YY P AG
Sbjct: 458 KPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYDPLAG 517

Query: 489 TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT--AEEIRRVTKQ 546
           TI++ G+DI + + +  R+ +G+V QEP+L +G+I +NI Y +  E     E +    + 
Sbjct: 518 TISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSNAIES 577

Query: 547 CFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESE 606
             C+ F+   P   +T +GP GT LSGGQKQR+A+ARA L +P +L+LDEATSALD  SE
Sbjct: 578 SNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALDPRSE 637

Query: 607 SAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSEL 666
           S +  T  K    K  T ISIAHR+STI+ S  V+VL   G VVE G ++ L G   S L
Sbjct: 638 SIVAQTL-KQRCAKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELLGIKDSAL 696

Query: 667 SQLL 670
           ++LL
Sbjct: 697 NKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  437 bits (1125), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/601 (42%), Positives = 366/601 (60%), Gaps = 37/601 (6%)

Query: 77  IKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADL 136
           +K+LL LAK + K +  AVGL+ VS  + MSLP VIG ++D      + + DA       
Sbjct: 34  VKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDH-----ASTPDA------- 81

Query: 137 SIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKT 196
                   PI +GL+  +FL  +G+  ++G  AN G                 ++ +K  
Sbjct: 82  --------PI-YGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSM 132

Query: 197 IHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELS 256
           + QDA F D ++VGDLISRL SDA +VS+S+T  +SDG +A L           IS +L+
Sbjct: 133 LSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLT 192

Query: 257 AFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIK 316
             +    PP+ + +M +G  I+  SR+LQ+  GQL++ SEEQ + +KTVQA+  E++E++
Sbjct: 193 TVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQ 252

Query: 317 RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYM 376
           RY+N ++ V+N+G + A  +A  F  T  +G+++ + +L  G+       +++G+L+++M
Sbjct: 253 RYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFM 309

Query: 377 MYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG---KKYIPGKGEIEF 433
           MY   TGS+VFGL+ FYSE+M+G GAA R+ EL +    ISPT G    K + G   I F
Sbjct: 310 MYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGL-PITF 368

Query: 434 KNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
            NVSFAY    G  +   +NF+I PG +VC VG SG GKSTI+SLLL+YY+  +G I++ 
Sbjct: 369 NNVSFAYSN--GKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIG 426

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
             DIS  N +  RR +G+VQQEP+L +G+I DNITYGL ++ +  ++    K   C  FI
Sbjct: 427 NYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFI 485

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTF 613
            +      T++GP G  LSGGQ+QRIA+AR  L+ P++LILDEATSALD +SE  IN   
Sbjct: 486 KESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINK-- 543

Query: 614 GKLMKKKE--VTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
            +L +++E  +T ISIAHRLSTIR S  VIV+  DG VVE G F  L     SEL++LL 
Sbjct: 544 -ELQRRQEAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLK 601

Query: 672 E 672
           E
Sbjct: 602 E 602

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  204 bits (518), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 142/410 (34%), Positives = 210/410 (51%), Gaps = 30/410 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R    A  +   V+ +     + V+ F  E+    +Y+N + +  N    V +  AF+N+
Sbjct: 292 RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNS 351

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    TS+L  M ++     G   V+ G LS+GDL        L    VF LS      
Sbjct: 352 GQNLIFTSALTAMMYM-----GCTGVMSGDLSVGDLV-------LINQLVFQLSVPLNFL 399

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKG--EIEFKNVSFAYPTRPGSQ 447
            S Y E+ Q +     LF+L      I  +     +P     EI+F+NV+F Y   P  +
Sbjct: 400 GSVYRELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRK 457

Query: 448 IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRR 507
           I ++ NF +  G    IVGPSG GKSTI  L+ ++Y P  G I +DG+DI +L+ KSLRR
Sbjct: 458 ILENANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRR 517

Query: 508 HIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
            IG+V Q+  L + +I +N+ +G    AT ++IR+   +      I   P   +TI+G  
Sbjct: 518 AIGVVPQDTPLFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGER 576

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
           G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T  +       T I I
Sbjct: 577 GLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYI 636

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
           AHRL TI  ++ ++VL N G V E GK   L   P S  S+L N +  ++
Sbjct: 637 AHRLRTIADADKIVVLEN-GRVKEEGKHAELLSKPTSLYSELWNIQENLD 685

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  203 bits (516), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 141/410 (34%), Positives = 210/410 (51%), Gaps = 30/410 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R    A  +   V+ +     + V+ F  E+    +Y+  +    +    V +  AF+NA
Sbjct: 305 RSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNA 364

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            + F  TS+L  M ++     G+  V+ G L++GDL        L    VF LS      
Sbjct: 365 GQNFIFTSALTAMMYM-----GASGVMEGALTVGDLV-------LINQLVFQLSVPLNFL 412

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGK--GEIEFKNVSFAYPTRPGSQ 447
            S Y E+ Q +     LF+L     +I  T     +P     EI+F+NV+F Y  +P   
Sbjct: 413 GSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRN 470

Query: 448 IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRR 507
           I K+  F I PG    IVGPSG GKSTI  L+ ++Y P  G I +DG+DI +L+   LRR
Sbjct: 471 ILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRR 530

Query: 508 HIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
            +G+V Q+  L + +I +N+ +G    AT  EI    ++    + I K P   +TI+G  
Sbjct: 531 IVGVVPQDTPLFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGER 589

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
           G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E ++  T  +       T + I
Sbjct: 590 GLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYI 649

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
           AHRL TI  ++ +IVL N G+V E G    L  NP S  S+L N +  ++
Sbjct: 650 AHRLRTIADADKIIVLEN-GAVREEGTHNALLANPNSLYSELWNIQENLD 698

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  202 bits (513), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 144/409 (35%), Positives = 208/409 (50%), Gaps = 30/409 (7%)

Query: 286 EATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA-KLF 340
           +A  +   V+ +     + V+ F  EQ    +Y+  +    +    V +  AF+N+ +  
Sbjct: 316 KADNKAASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNL 375

Query: 341 TITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS-------SFY 393
             TS+L  M ++     G   V+ G LS+GDL        L    VF LS       S Y
Sbjct: 376 IFTSALTAMMYM-----GCTGVMSGELSVGDLV-------LINQLVFQLSVPLNFLGSVY 423

Query: 394 SEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGK--GEIEFKNVSFAYPTRPGSQIFKS 451
            E+ Q +     LF+L      I  +     +P     EI FKNVSF Y   P   I K+
Sbjct: 424 RELKQSLIDMESLFQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKN 481

Query: 452 LNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGI 511
            +F I  GS   IVGPSG GKSTI  L+ ++Y P  G I +DG+D+ +L+ +SLRR IG+
Sbjct: 482 ASFTIPTGSKTAIVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGV 541

Query: 512 VQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLL 571
           V Q+  L + SI DN+ +G   +AT +EI R   +      I + P    TI+G  G ++
Sbjct: 542 VPQDTPLFNESIWDNVKFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMI 600

Query: 572 SGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRL 631
           SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T  +       T + IAHRL
Sbjct: 601 SGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRL 660

Query: 632 STIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERN 680
            TI  ++ +IVL   G V E GK   L   P S  ++L N +  +++ N
Sbjct: 661 RTIADADKIIVL-EHGRVKEEGKHAELLATPKSLYAELWNVQENLDDLN 708

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  198 bits (503), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 146/422 (34%), Positives = 212/422 (50%), Gaps = 34/422 (8%)

Query: 286 EATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA-KLF 340
           +A  +   V+ +     + V+ F  EQ    +Y+N +    +    V +  AF+NA + F
Sbjct: 288 KADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNF 347

Query: 341 TITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS-------SFY 393
             TS+L  M ++     G   V+ G LS+GDL        L    VF LS       S Y
Sbjct: 348 IFTSALTAMMYM-----GCTGVISGTLSVGDLV-------LINQLVFQLSVPLNFLGSVY 395

Query: 394 SEIMQGVGAASRLFELTDRIPMIS----PTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIF 449
            E+ Q +     LF+L      I     P       P K  I F+NVSF Y   P   I 
Sbjct: 396 RELKQSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMIL 451

Query: 450 KSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHI 509
           K+ +F +  G    IVGPSG GKSTI  L+ ++Y P  G I VDG+D+ +L+ +SLRR I
Sbjct: 452 KNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAI 511

Query: 510 GIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGT 569
           G+V Q+  L + SI +N+ +G    A+ EEIR   ++    + + + P    TI+G  G 
Sbjct: 512 GVVPQDTPLFNDSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGL 570

Query: 570 LLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T          T + IAH
Sbjct: 571 MISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAH 630

Query: 630 RLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETP 689
           RL TI  ++ +IV+   G V E GK   L   P S  ++L N +  ++  N   +  ET 
Sbjct: 631 RLRTIADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQREETQ 689

Query: 690 EQ 691
           E+
Sbjct: 690 EK 691

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  193 bits (490), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 206/411 (50%), Gaps = 31/411 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R   +A  +   ++ +     + V+ F  E     +YN+ + D  N    + K  AF+N+
Sbjct: 302 RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS 361

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    T++L  M +L     G   V+ G L++GDL        L    VF LS      
Sbjct: 362 GQNLIFTTALTGMMYL-----GCTGVIGGNLTVGDLV-------LINQLVFQLSVPLNFL 409

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI---PGKGEIEFKNVSFAYPTRPGS 446
            S Y E+ Q +     LF+L      I      K I    G  EI F+NV+F Y      
Sbjct: 410 GSVYRELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADR 467

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
           +I K+ +F I  G    IVGPSG GKSTI  L+ ++Y P  G I ++G D+ ++   SLR
Sbjct: 468 KILKNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLR 527

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
           + IG+V Q+  L + SI +N+ +G   +A   EI  V ++    + I K P  Y+TI+G 
Sbjct: 528 KLIGVVPQDTPLFNDSIWENVKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGE 586

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIIS 626
            G ++SGG+KQR+AIAR LLK  +V+  DEATSALD  +E A+  T     K    T I 
Sbjct: 587 RGLMISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIY 646

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
           IAHRL TI  ++ +IVL  DG+V E G    L     S   +L N +  ++
Sbjct: 647 IAHRLRTIADADKIIVL-EDGTVREEGTHNELLAKSTSLYKELWNVQENLD 696

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  189 bits (481), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 206/418 (49%), Gaps = 31/418 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDV----YNVGKESAFINA 337
           R+  +A  +   ++ +     + V+ F  EQ    +YN  +K        V +  AF+N+
Sbjct: 302 RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNS 361

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    TS+L  M ++     G   +L G LS+GDL        L    VF LS      
Sbjct: 362 GQNLIFTSALTAMMYM-----GCTGILGGNLSVGDLV-------LINQLVFQLSVPLNFL 409

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP---GKGEIEFKNVSFAYPTRPGS 446
            S Y ++ Q +     LF+L      I        +    G   IEFKNV+F Y   P  
Sbjct: 410 GSVYRDLKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNR 467

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
           +I ++ +F I  G    +VGPSG GKSTI  L+ ++Y P  G + V+G D+   +  SLR
Sbjct: 468 KILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLR 527

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
           R IG+V Q+  L + +I +N+ +G    AT E+I    ++      I K P +Y+TI+G 
Sbjct: 528 RAIGVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGE 586

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIIS 626
            G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E  +  T      K   T + 
Sbjct: 587 RGLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVY 646

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEK 684
           IAHRL T+  S+ +IVL  +GS+ E G    L   P S    L N +  ++  N + K
Sbjct: 647 IAHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWNIQENLDMINDSLK 703

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  189 bits (480), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 141/428 (32%), Positives = 211/428 (49%), Gaps = 32/428 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R    A  +   ++ +     + V+ F  E     +YNN +    +    V +  AF+N+
Sbjct: 275 RSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNS 334

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    TS+L  M ++     G   +L G L++GDL        L    VF LS      
Sbjct: 335 GQNLIFTSALTAMMYM-----GCTGILGGNLTVGDLV-------LINQLVFQLSVPLNFL 382

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKG---EIEFKNVSFAYPTRPGS 446
            S Y E+ Q +     LF+L     +I      K +P  G   EI F+NV+F Y   P  
Sbjct: 383 GSVYRELKQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDR 440

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            I K+ +F I  G  + IVGPSG GKSTI  L+ ++Y P  G I ++G D+ +++  SLR
Sbjct: 441 TILKNASFVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLR 500

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
           + IG+V Q+  L + +I +N+ +G   +AT EE+    ++      I+K      TI+G 
Sbjct: 501 KVIGVVPQDTPLFNDTIWENVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGE 559

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIIS 626
            G ++SGG+KQR+AIAR LLK  +++  DEATSALD  +E  +  T     K    T I 
Sbjct: 560 RGLMISGGEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIY 619

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPA 686
           IAHRL TI  ++ +IVL  DGSV E G    L     S    L + +  + E    E   
Sbjct: 620 IAHRLRTIADADKIIVL-EDGSVKEEGTHTELLARDHSLYKDLWDIQENL-EVIEEELGL 677

Query: 687 ETPEQESQ 694
           ++ E +SQ
Sbjct: 678 DSSEADSQ 685

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 210/413 (50%), Gaps = 38/413 (9%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R    A  +   V+ +     + V+ F  E+    +YN+ + +  +    V +  AF+N+
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNS 345

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    T++L  M ++     G   V+ G L++GDL        L    VF LS      
Sbjct: 346 GQNLIFTTALTAMMYM-----GCTGVIGGDLTVGDLV-------LINQLVFQLSVPLNFL 393

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMIS----PTTGKKYIPGKGEIEFKNVSFAYPTRPG 445
            S Y ++ Q +     LF+L      I     P    +++P   EI F+NV+F Y   P 
Sbjct: 394 GSVYRDLKQSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPY--EITFENVTFGY--HPD 449

Query: 446 SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSL 505
            +I K+ +F I  G    IVG SG GKSTI  L+ ++Y P +G I ++G+DI + +  +L
Sbjct: 450 RKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDAL 509

Query: 506 RRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILG 565
           RR IG+V Q+  L + +I +N+ +G   +AT EE++   ++      I K P  ++TI+G
Sbjct: 510 RRVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVG 568

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTII 625
             G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T          T +
Sbjct: 569 ERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSV 628

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINE 678
            IAHRL TI  ++ +IVL N G+V E GK   L   P S    L  E  TI E
Sbjct: 629 YIAHRLRTIADADKIIVLDN-GTVKEDGKHIELLATPGS----LYRELWTIQE 676

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  186 bits (471), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 134/406 (33%), Positives = 208/406 (51%), Gaps = 32/406 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R+  +A  +   ++ +     + V+ F  E+   ++Y+  +    +    V +  AF+N+
Sbjct: 305 RQANKADNKGASIALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNS 364

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    TS+L  M ++     G   ++ G L++GDL        L    VF LS      
Sbjct: 365 GQNLIFTSALTVMMYM-----GCTGIIGGNLTVGDLV-------LINQLVFQLSVPLNFL 412

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGE----IEFKNVSFAYPTRPG 445
            S Y E+ Q +     LF+L     +I        +  KG     I F+NV+F Y  +  
Sbjct: 413 GSVYRELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYDKQ-- 470

Query: 446 SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSL 505
            +I K+ +F+IE G    IVGPSG GKSTI  LL ++Y P  G I V+G D  + +  SL
Sbjct: 471 RKILKNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSL 530

Query: 506 RRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILG 565
           R+ IG+V Q+  L + +I +N+ +G    A+ +EI +V  +      + K P   +TI+G
Sbjct: 531 RKVIGVVPQDTPLFNDTIWENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVG 589

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTII 625
             G ++SGG+KQR+AIAR LLK  +++  DEATSALD  +E A+  T  +  KK   T +
Sbjct: 590 ERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSV 649

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
            IAHRL TI  ++ +IVL  +G+V E GK   L     S   +L N
Sbjct: 650 YIAHRLRTIADADKIIVL-QEGTVREEGKHSELLARSGSLYKELWN 694

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  185 bits (470), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 140/413 (33%), Positives = 205/413 (49%), Gaps = 38/413 (9%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYN----NVIKDVYNVGKESAFINA 337
           R    A  +   V+ +     + V+ F  E+    +YN    N       V +  AF+N+
Sbjct: 288 RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNS 347

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    TS+L  M ++     G   V+ G L++GDL        L    VF LS      
Sbjct: 348 GQNLIFTSALTAMMYM-----GCTGVIGGDLTVGDLV-------LINQLVFQLSVPLNFL 395

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMIS----PTTGKKYIPGKGEIEFKNVSFAYPTRPG 445
            S Y E+ Q +     LF+L      I     P    +++P   +I F+NV+F Y   P 
Sbjct: 396 GSVYRELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPY--DITFQNVTFGY--HPD 451

Query: 446 SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSL 505
            +I K+ +F I  GS   IVG SG GKSTI  L+ ++Y P +G I ++G+DI + +  +L
Sbjct: 452 RKILKNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDAL 511

Query: 506 RRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILG 565
           R+ IG+V Q+  L + +I +N+ +G   +AT EE+  V ++      I K P  + TI+G
Sbjct: 512 RKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVG 570

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTII 625
             G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T          T +
Sbjct: 571 ERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSV 630

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINE 678
            IAHRL TI  ++ +IV  N G V E GK   L   P S    L  E  TI E
Sbjct: 631 YIAHRLRTIADADKIIVFDN-GKVREEGKHLELLATPGS----LYRELWTIQE 678

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  185 bits (469), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 131/411 (31%), Positives = 208/411 (50%), Gaps = 31/411 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R   +A  +   V+ +     + V+ F  E     +Y+N +    +    + +  AF+NA
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            + F  TS+L  M ++     G   V+ G L++GDL        L    VF LS      
Sbjct: 341 GQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLV-------LINQLVFQLSVPLNFL 388

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP---GKGEIEFKNVSFAYPTRPGS 446
            S Y E+ Q +     LF L +    I        +P   G  EI+F+NV+F Y TR   
Sbjct: 389 GSVYRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--R 446

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
           +I ++ +F I  G    IVGPSG GKSTI  L+ ++Y P +G + V+G+D+ + +  S R
Sbjct: 447 KILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFR 506

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
           + IG+V Q+  L + +I +N+ +G   +AT +E+    ++      I K P    TI+G 
Sbjct: 507 KVIGVVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGE 565

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIIS 626
            G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E ++  T  +   +   T + 
Sbjct: 566 RGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVY 625

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
           +AHRL TI  ++ ++VL  +G V E G    L   P S   QL + +  ++
Sbjct: 626 VAHRLRTIADADKILVL-EEGCVREEGSHTELLSRPNSLYKQLWDIQENLD 675

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  184 bits (467), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 119/333 (35%), Positives = 180/333 (54%), Gaps = 21/333 (6%)

Query: 362 VLHGGLSIGDLTAYMMYTELTGSAVFGLS-------SFYSEIMQGVGAASRLFELTDRIP 414
           V+ G L++GDL        L    +F LS       S Y E+ Q +     LF L     
Sbjct: 373 VMEGSLTVGDLV-------LINQLIFQLSLPLNFLGSVYRELKQSLIDMESLFRLQKNKI 425

Query: 415 MISPTTGKKYIPGK--GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGK 472
            I      + +P K   +I F+NV+F Y   P  +I K+  F I  G    IVGPSG GK
Sbjct: 426 TIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKKTAIVGPSGSGK 483

Query: 473 STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
           STI  L+ ++Y+P  G I +DG+DI +++  SLR+ IG+V Q+  L + +I +N+ +G  
Sbjct: 484 STILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFNDTIWENVKFG-R 542

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
            +A+ ++I    ++      I   P    TI+G  G ++SGG+KQR+AI+R LLK   ++
Sbjct: 543 IDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAISRVLLKDCPLM 602

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
             DEATSALD  +E ++  T  +  + +  T + IAHRL TI  ++ +IVL N+  V E 
Sbjct: 603 FFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKIIVL-NNSRVHEE 661

Query: 653 GKFKTLFGNPLSELSQLLN-EKSTINERNPNEK 684
           G  KTL   P S  S+L N ++S   +++  EK
Sbjct: 662 GDHKTLLKTPGSLYSELWNIQESMTVDKSKTEK 694

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  184 bits (467), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/361 (35%), Positives = 189/361 (52%), Gaps = 27/361 (7%)

Query: 328 VGKESAFINA-KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAV 386
           V +  A++N+ +    TS+L  M ++     G   V+ G L++GDL        L    V
Sbjct: 334 VSQSLAYLNSGQNLIFTSALTAMMYM-----GCTGVIGGDLTVGDLV-------LINQLV 381

Query: 387 FGLS-------SFYSEIMQGVGAASRLFELTDRIPMISPTTGK---KYIPGKGEIEFKNV 436
           F LS       S Y E+ Q +     LF+L      I   T     K   G  EI F+NV
Sbjct: 382 FQLSVPLNFLGSVYRELKQSLIDMESLFQLRKNEIKIENGTNPIVLKASDGPFEITFENV 441

Query: 437 SFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQD 496
           +F Y ++   +I  + +F I  G    +VGPSG GKSTI  L+ ++Y P  G I ++G D
Sbjct: 442 TFGYDSK--RKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVD 499

Query: 497 ISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKF 556
           + + +  SLRR +G+V Q+  L + +I +N+ +G   +AT EE+  V ++      I K 
Sbjct: 500 VKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKL 558

Query: 557 PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKL 616
           P  Y+TI+G  G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T    
Sbjct: 559 PQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRAN 618

Query: 617 MKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
            +    T + IAHRL TI  ++ +IVL  DG+V E G    L   P S  + L N +  +
Sbjct: 619 FESGSRTSVYIAHRLRTIADADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWNIQENL 677

Query: 677 N 677
           +
Sbjct: 678 D 678

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  184 bits (466), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 147/471 (31%), Positives = 233/471 (49%), Gaps = 39/471 (8%)

Query: 220 AYVVSRSMTQKVSDGFK-ALLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIR 278
           +YV+S  +   +  GF+ +++C         S +      +L ++   + ++ +  +  R
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGILTYQFGASFAGITFTTMLLYSIFTIRTTAWRTQFRR 316

Query: 279 DNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVI----KDVYNVGKESAF 334
           D ++    A  +   V+ +     + V+ F  E     +Y++ +         V +  AF
Sbjct: 317 DANK----ADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAF 372

Query: 335 INA-KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS--- 390
           +N+ +    TS+L  M +L     G   V+ G L++GDL        L    VF LS   
Sbjct: 373 LNSGQNLIFTSALTMMMYL-----GCTGVIEGNLTVGDLV-------LINQLVFQLSVPL 420

Query: 391 ----SFYSEIMQGVGAASRLFEL-TDRIPMISPTTGKKYI-----PGKGEIEFKNVSFAY 440
               S Y E+ Q +     LF+L  + I + +  TG   I      G  EI+F+NV+F Y
Sbjct: 421 NFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGY 480

Query: 441 PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKL 500
            T    +I K+ +F I  G    +VGPSG GKSTI  L+ ++Y P  G + ++G ++ + 
Sbjct: 481 DT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRY 538

Query: 501 NSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQY 560
           +  SLRR +G+V Q+  L + +I +N+ +G    A  EEI++V ++      I K P + 
Sbjct: 539 DIDSLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQRE 597

Query: 561 QTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKK 620
           +TI+G  G ++SGG+KQR+AIAR LLK  N++  DEATSALD  +E A+  T        
Sbjct: 598 KTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSG 657

Query: 621 EVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
             T I IAHRL TI  ++ +IVL  DG V E G    L     S  S L N
Sbjct: 658 TRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  182 bits (461), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 136/413 (32%), Positives = 208/413 (50%), Gaps = 38/413 (9%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R   +A  +   V+ +     + V+ F  E+    +YN+ +    +    V +  AF+N+
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNS 344

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    T++L  M ++     G   V+ G L++GDL        L    VF LS      
Sbjct: 345 GQNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLV-------LINQLVFQLSVPLNFL 392

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMIS----PTTGKKYIPGKGEIEFKNVSFAYPTRPG 445
            S Y ++ Q +     LF+L      I     P    +++P   +I F+NV+F Y   P 
Sbjct: 393 GSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPY--DITFENVTFGY--HPD 448

Query: 446 SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSL 505
            +I K+ +F I  G    IVG SG GKSTI  L+ ++Y P +G I ++G+DI + +  +L
Sbjct: 449 RKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINAL 508

Query: 506 RRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILG 565
           R+ IG+V Q+  L + +I +N+ +G   +AT EE+  V ++      I K P  + TI+G
Sbjct: 509 RKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDTIVG 567

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTII 625
             G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T          T +
Sbjct: 568 ERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSV 627

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINE 678
            IAHRL TI  ++ +IVL N G V E GK   L   P    + L  E  TI E
Sbjct: 628 YIAHRLRTIADADKIIVLDN-GRVREEGKHLELLATP----NSLYRELWTIQE 675

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 135/405 (33%), Positives = 203/405 (50%), Gaps = 31/405 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R    A  +   ++ +     + V+ F  EQ    +Y + + D  N    V +  AF+N+
Sbjct: 298 RAANRADNKGASIALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNS 357

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    TS+L  + +L     G   V+ G L++GDL        L    VF LS      
Sbjct: 358 GQNLIFTSALTAIMYL-----GCTGVIGGNLTVGDLV-------LINQLVFQLSVPLNFL 405

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGK---GEIEFKNVSFAYPTRPGS 446
            S Y E+ Q +     LF+L      I        +P +    EI+F+NV+F Y      
Sbjct: 406 GSVYRELKQSLIDMESLFKLRKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYDKE--R 463

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
           +I K+ +F I  G    +VGPSG GKSTI  L+ ++Y P  G I ++G DI +++  SLR
Sbjct: 464 KILKNASFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLR 523

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
           + IG+V Q+  L + +I +N+ +G   EAT  EI +  ++      I K P   +TI+G 
Sbjct: 524 KVIGVVPQDTPLFNDTIWENVKFG-RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGE 582

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIIS 626
            G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E ++  T  +       T + 
Sbjct: 583 RGLMISGGEKQRLAIARVLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVY 642

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
           IAHRL TI  ++ +IVL  DG V E G  + L     S  S+L N
Sbjct: 643 IAHRLRTIADADKIIVL-KDGQVEEEGTHRQLIAKKESLYSELWN 686

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  181 bits (458), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/411 (33%), Positives = 205/411 (49%), Gaps = 34/411 (8%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R   +A  +   V+ +     + V+ F  E+    +YN  + +  +    V +  AF+N+
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS 344

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    T++L  M ++     G   V+ G L++GDL        L    VF LS      
Sbjct: 345 GQNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLV-------LINQLVFQLSVPLNFL 392

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGK--GEIEFKNVSFAYPTRPGSQ 447
            S Y ++ Q +     LF+L      I        +P     +I F+NV+F Y   P  +
Sbjct: 393 GSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRK 450

Query: 448 IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRR 507
           I K+ +F I  G    IVG SG GKSTI  L+ ++Y P +G I ++G+DI + +  +LR+
Sbjct: 451 ILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRK 510

Query: 508 HIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
            IG+V Q+  L + +I +N+ +G   +AT EE+  V ++      I K P  + TI+G  
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGER 569

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
           G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+  T          T + I
Sbjct: 570 GLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYI 629

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINE 678
           AHRL TI  ++ +IVL N G V E GK   L   P S    L  E  TI E
Sbjct: 630 AHRLRTIADADKIIVLDN-GRVREEGKHLELLAMPGS----LYRELWTIQE 675

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 193/368 (52%), Gaps = 30/368 (8%)

Query: 316 KRYNNVIK---DVYNVGKESAFINA-KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371
           K +N++IK       V +  AF+N+ +    T++L  M ++     G   V+ G L++GD
Sbjct: 348 KYHNSLIKYRDSQVKVAQSLAFLNSGQSLIFTTALTGMMYM-----GCTGVIGGDLTVGD 402

Query: 372 LTAYMMYTELTGSAVFGLS-------SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKY 424
           L        L    VF LS       S Y E+ Q +     LF+L      I   +  K 
Sbjct: 403 LV-------LINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKS 455

Query: 425 IP---GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
           I    G  EI+F+NV+F Y  +   +I K+ +F I  G    I GPSG GKST+  L+ +
Sbjct: 456 ISKSDGPFEIKFENVTFGYDGQ--RKILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFR 513

Query: 482 YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR 541
           +Y P  G + V+G D+ + +   LR+ IG+V Q+  L + +I +N+ +G   EA+ EEI 
Sbjct: 514 FYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWENVKFG-RIEASDEEIT 572

Query: 542 RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSAL 601
           RV  +    + I K P    TI+G  G ++SGG+KQR+AIAR LLK  +++  DEATSAL
Sbjct: 573 RVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSAL 632

Query: 602 DVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
           D  +E ++  T  +     E T + IAHRL TI  ++ +IVL  +G+V E G  + L   
Sbjct: 633 DTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-EEGTVREEGTHQELLAR 691

Query: 662 PLSELSQL 669
             S   +L
Sbjct: 692 ENSLYKEL 699

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  183 bits (465), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/426 (30%), Positives = 214/426 (50%), Gaps = 24/426 (5%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P +++ S+ +G ++++     +     L  +  E  +GVKT++    +  
Sbjct: 851  KLSLVCISMFPLIVIFSIIYGTVLKNYETTYKTKVANLENLEYEIITGVKTIKCLQLQNH 910

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
              K Y+ +  ++  + ++ A +      IT+++      ++  YG  LV+ G  S   + 
Sbjct: 911  FKKCYHKLKDEMGQIARKRAIVTGLGIAITTAIATTIQSILYYYGLKLVMDGEYSTRTMF 970

Query: 374  ---AYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTT---------- 420
                 +++T +T ++   L S   +I +G  AAS ++ + +        T          
Sbjct: 971  QTFTLLLFTVMTCNS---LISQIPDISRGQRAASWIYRIIEESEDTKEQTITDGRFDEIH 1027

Query: 421  -GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
             G+K    +  +   N+ FAYPT     I+ +L+  +  G  V IVG SG GKST+  LL
Sbjct: 1028 CGEKVDKTQPLVSIHNLEFAYPTALDVNIYDNLSLDLNVGQTVAIVGESGSGKSTLVYLL 1087

Query: 480  LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
             K Y+     I +DG D+++ ++++LRR I +V+Q+P+L  G++R+N+ YGL +     +
Sbjct: 1088 TKLYQVADNCIDIDGTDVNEWDNETLRRQISVVEQKPVLFPGTVRENLIYGLYFSPLEID 1147

Query: 540  IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
            I  + K    ++FI   P+  +T    + +L+SGGQ QR+ IARALL+KP +LILDE TS
Sbjct: 1148 IIDILKYVGVYDFIESLPEGLET--SVDTSLISGGQAQRLCIARALLRKPKILILDECTS 1205

Query: 600  ALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            ALD  S   IN    K      +  ISI H    +R    V VL  DG + E G F  LF
Sbjct: 1206 ALDANSSKIINDIVAK--GPPSLLTISITHNEQMMRSCNTVAVL-KDGKICETGPFNKLF 1262

Query: 660  --GNPL 663
              GN L
Sbjct: 1263 KPGNEL 1268

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 118/481 (24%), Positives = 222/481 (46%), Gaps = 28/481 (5%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L  TP +++ +  F R I+  +      +G    +     +  + ++    +
Sbjct: 173 SWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLSCTQ 232

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
            +EI+ +  +      +     FI   L+ + +++  + FL +        +G+  +  G
Sbjct: 233 LKEIESFEEL-----TLKCNDYFIKLSLY-VAANISTLRFLSLAMFVQGFWFGNTEIRKG 286

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE-LTDRIPMISPTTGKKY 424
            L+I D+        + GS +     +   + +G  A  ++   L D    I  +  K+ 
Sbjct: 287 NLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDESALKQI 346

Query: 425 IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
              K +I F++VSF+YP+RP   +   ++     G    IVG SG GKST+++LLLK Y 
Sbjct: 347 DISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYD 406

Query: 485 PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYE-----ATAEE 539
              G I++    I +++ + L ++I +V+Q   L + ++ +NI  G   E        ++
Sbjct: 407 EYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKK 466

Query: 540 IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
           ++   K     + I    +   TILG  G  LSGGQ+QR+A+ARA ++   VLILDEA S
Sbjct: 467 LKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVS 526

Query: 600 ALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
           ALD+     +     K  + +  T I + H LS I   + + V+  +G ++E G    L 
Sbjct: 527 ALDIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLYVV-EEGRIIESGFQGQLM 583

Query: 660 GNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAA------NESIVDVVLEEEILQ 713
            +P S   + +N    ++++  N     +   E + ++A      ++ I  +  E +IL+
Sbjct: 584 YDPDSAFCR-MNILQNVHDKYENNDRFSSVTLEDEMHSALDWVYKDDLITPITGENQILK 642

Query: 714 N 714
           N
Sbjct: 643 N 643

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  183 bits (465), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 146/506 (28%), Positives = 253/506 (50%), Gaps = 32/506 (6%)

Query: 190  SQVIKKTIHQDAEFF--DNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXX 247
            ++V++K   ++ ++F  +NNK  ++ + + +D   + RS+  +      + +        
Sbjct: 797  NEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDL-RSLVSEFLSAMTSFVTVSTIGLI 855

Query: 248  XXSISP-ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQ 306
               +S  +LS   +   P +++ S  +G +++      + +  QL     +  + +KT++
Sbjct: 856  WALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIK 915

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGG 366
               AE      Y+++   +  +  + A       ++T+ +      ++  YG  LV+   
Sbjct: 916  CLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHE 975

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD-------------RI 413
             +  ++         T  +   L S   +I +G  AAS ++ + D             R 
Sbjct: 976  YTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIYRILDEKHNTLEVENNNART 1035

Query: 414  PMISPTT--GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
              I+  T  GK+  P    +  +N++FAYP+ P + ++K++NF +  G  + I+G SG G
Sbjct: 1036 VGIAGHTYHGKEKKP---IVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTG 1092

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGL 531
            KST+  LL K Y    G I +DG D++  N  SLR+ I +V+Q+P+L +G+IRDN+TYGL
Sbjct: 1093 KSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGL 1152

Query: 532  TYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNV 591
              E    E+    K    H+F+   P    T +  + TLLSGGQ QR+ IARALL+K  +
Sbjct: 1153 QDEILEIEMYDALKYVGIHDFVISSPQGLDTRI--DTTLLSGGQAQRLCIARALLRKSKI 1210

Query: 592  LILDEATSALDVESESAINYTFGKLMKKKEVTIIS--IAHRLSTIRRSEIVIVLGNDGSV 649
            LILDE TSALD  S S IN    +++KK    +++  I H    +R    + VL  DG V
Sbjct: 1211 LILDECTSALDSVSSSIIN----EIVKKGPPALLTMVITHSEQMMRSCNSIAVL-KDGKV 1265

Query: 650  VEIGKFKTLFGNPLSELSQLLNEKST 675
            VE G F TL+ N   EL Q+++ +S+
Sbjct: 1266 VERGNFDTLYNNR-GELFQIVSNQSS 1290

 Score =  173 bits (438), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 144/527 (27%), Positives = 247/527 (46%), Gaps = 33/527 (6%)

Query: 190 SQVIKKTIHQD-AEFFDNNK--VGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXX 246
           SQ+++  + +   E++DNN+  +GD  +++      +  S  +  +  F+ L+       
Sbjct: 109 SQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQNLVAICALLG 167

Query: 247 XXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQ 306
                S  L+  +L  +P +   ++ F R+I   S K    T +  ++     +  + V+
Sbjct: 168 TSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVR 227

Query: 307 AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGG 366
            +  ++ E K++  +I +      +S F  A    I   L    F+    +GS ++  G 
Sbjct: 228 LYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFWFGSAMIKKGK 287

Query: 367 LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL----TDRIPMISPTTGK 422
           L+I D+        + GS +         + +G  A  ++  L    + R P+ + T   
Sbjct: 288 LNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNPL-NKTVAH 346

Query: 423 KYIP---GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
           ++ P      ++ F NVSF+YP+RP   + K+++     G    IVG SG GKST+++LL
Sbjct: 347 QF-PLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLL 405

Query: 480 LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT-----YE 534
           L++Y    G+I+++G +I  ++ K L  +I +V+Q   L + ++R NI  G T      +
Sbjct: 406 LRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNAD 465

Query: 535 ATAEEIRRVTKQCFCH-----NFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKP 589
            +  E R + K   C       FI   PD  +T++G  G  LSGGQ+QR+AIARA ++  
Sbjct: 466 CSTNENRHLIKDA-CQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDT 524

Query: 590 NVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSV 649
            +L LDEA SALD+   + +        K K  T I + H LS I  S+  + L  +G V
Sbjct: 525 PILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQI-ESDDYLYLMKEGEV 581

Query: 650 VEIGKFKTLFGNPLSELS---QLLNEKS---TINERNPNEKPAETPE 690
           VE G    L  +P +  S    L N+ S   TI +    EK   T E
Sbjct: 582 VESGTQSELLADPTTTFSTWYHLQNDYSDAKTIVDTETEEKSIHTVE 628

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  183 bits (464), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 125/419 (29%), Positives = 211/419 (50%), Gaps = 18/419 (4%)

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVA 310
            I  +LS   +   P +++ S  +G  ++    + + A   L  +  E  +G+KT++    
Sbjct: 833  IGWKLSLVCISMFPLIVIFSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQL 892

Query: 311  EQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS-- 368
            E   +++Y  +   +  +    A        +  +L      ++  Y   LV+ G  +  
Sbjct: 893  ETNFLRQYKRLESHMRVIASRRAITTGLGVAVIEALAMSIQAILFYYALKLVIDGQYTTK 952

Query: 369  -IGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD-RIPMISPTTGKKYI- 425
             + +    +++T +T +    L S   +I +G  AA+R+ ++ D ++    P   KK   
Sbjct: 953  KMFETLTLLLFTIMTCNI---LISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTT 1009

Query: 426  -----PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
                      I  +NV+FAYP+ P   IF SL  ++  G    +VG SG GKST+ +LL 
Sbjct: 1010 SGSVSESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLT 1069

Query: 481  KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI 540
            + Y+PT+GT+ V+ +D+++ N + LRR + +V+Q P + SG++R+N+ YGL ++    E+
Sbjct: 1070 QLYRPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEM 1129

Query: 541  RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
              V +    H+FI+K P    T +  +  LLSGGQ QR+ IARA+LK+P +LILDE TSA
Sbjct: 1130 YDVLRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSA 1187

Query: 601  LDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            LD  S   IN    +         ISI H +  ++  + +I L N G V   G F  L 
Sbjct: 1188 LDPFSSHVINNIVRRGCPAP--LTISITHNVDMMKACDEIIFLKN-GRVAGTGSFDALL 1243

 Score =  144 bits (364), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 131/466 (28%), Positives = 230/466 (49%), Gaps = 14/466 (3%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+   L   P +++   +F R ++  +    E T + +++ +   +  + ++    E
Sbjct: 158 SWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTE 217

Query: 312 QREIKRYNNVIKDVYN-VGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
            REIK + N +++  N   K   + +  L T+   L    F+    +GS ++  G ++IG
Sbjct: 218 LREIKSFKNCVQNCTNNFVKMCQYSSINLATL-KFLSLAMFVQAFWFGSTMIRKGKMNIG 276

Query: 371 DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE-LTDRIPMISPTTGKKYIPG-- 427
           D+        L GS + G       I +G  A + + + L D     +     + +P   
Sbjct: 277 DVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPE 336

Query: 428 -KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            KG+I F+NV F+YP+RP   + +S++     G    ++G SG GKS++++LLLK+Y+  
Sbjct: 337 LKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENY 396

Query: 487 AGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI----RR 542
            G I+VDG++I  ++   L ++I +V+Q   + +G++++NI  G+   A  EEI    + 
Sbjct: 397 TGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGID-GADEEEILTKLKL 455

Query: 543 VTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
           V +     NFI    D   T++G  G  LSGGQ+Q++AIARAL+K P +LILDE+ SALD
Sbjct: 456 VCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALMKDPQILILDESLSALD 515

Query: 603 VESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNP 662
           V     I         +KE T I + H L+ I  ++   ++   G  +E G  +TL  +P
Sbjct: 516 VLQRGLILRAIRT--HRKEKTTIILTHELNQIGSNDFCYLI-ESGQCIEHGLEETLVNDP 572

Query: 663 LSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLE 708
            +      +   T +  +   +        + K  A ES +D  +E
Sbjct: 573 STRFHSWKHLHDTYDHYDCFSQYTYVETPTTPKKFAAESRIDYEVE 618

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  177 bits (450), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/463 (28%), Positives = 221/463 (47%), Gaps = 27/463 (5%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L   P ++L ++ F  +I   +      TG+  ++     +  + V+ +  +
Sbjct: 173 SWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNWSMNSAQLVKLYCTQ 232

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371
             EI  +  ++    ++  +S F  +   +I   L    F+    +G+ +V  G LSI D
Sbjct: 233 AYEIHSFKELVGQCNDLFIKSCFYVSANTSILRFLSLSMFVQGFWFGAIMVKKGKLSIKD 292

Query: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL---TDRIPMISPTTGKKYIPGK 428
           +        + GS +         + +G  A  ++ +    + R P + P          
Sbjct: 293 VITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQRSPSLEPPYEPSVPISN 352

Query: 429 GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
           GEI F+N+SFAYPTRP   + K ++   +PG +  I+G SG GKST+A+LLLK+Y    G
Sbjct: 353 GEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKSTLANLLLKFYNDYQG 412

Query: 489 TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT-----YEATAEEI-RR 542
           +I +   ++ K+N   L  +I +V+Q   L + ++R+N+  G++      E    EI +R
Sbjct: 413 SIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNSNQKVEQDDIEISQR 472

Query: 543 VTKQC---FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
           +   C        I + PD   TI+G  G  LSGGQ+QR+AIARA +K  +VLILDEA S
Sbjct: 473 LKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAYIKDSSVLILDEAVS 532

Query: 600 ALDVESESAI-----NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGK 654
           ALD+     I     N+  GK       T I + H LS +   + + V   DG V E G 
Sbjct: 533 ALDIIHRELIMKAIKNWRSGK-------TTIILTHDLSQLDYDDFLYVF-EDGEVKESGY 584

Query: 655 FKTLFGNPLSELSQLLN-EKSTINERNPNEKP-AETPEQESQK 695
            + L  +  +  S+L + +       +P+E    ETP  E ++
Sbjct: 585 QQALLQDEKTIFSKLYDIQMRKHMSYSPSESTIVETPGDEKKR 627

 Score =  162 bits (411), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 129/435 (29%), Positives = 207/435 (47%), Gaps = 27/435 (6%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P ++L S  +G  ++      + A  +L     E  + +KT++   A + 
Sbjct: 868  KLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKY 927

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
             IK Y  +  ++  +  + +       +IT+++      ++  YG  LV  G  S   + 
Sbjct: 928  FIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMF 987

Query: 374  AYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD-------------RIPMISPTT 420
                    T  +   L S   +I +G  AAS L+ + D             R   I  + 
Sbjct: 988  ETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIIISG 1047

Query: 421  GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGS-NVCIVGPSGRGKSTIASLL 479
                +P    I  KN+ F+YP+    +I+K++   +      + IVG SG GKST+  LL
Sbjct: 1048 NTNSVP---LISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLL 1104

Query: 480  LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
             K YK  A +I +DG D+++ ++  LR+ I +V+Q P L  G++RDN+ YG   + +  E
Sbjct: 1105 TKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIE 1164

Query: 540  IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
            I  V K    + FI   P    + +  +  L+SGGQ QR+ IARALL+KP +LILDE TS
Sbjct: 1165 IYDVLKYLGIYEFIENLPMGLDSRI--DTKLVSGGQAQRLCIARALLRKPTILILDECTS 1222

Query: 600  ALDVESESAINYTFGKLMKKKEVTIISIA--HRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657
            ALD  S   IN     L+K    T+++I   H    +     + V+  DG + E G F  
Sbjct: 1223 ALDAASAHLIN----NLVKNGLPTVLTIVITHSKQMMEACNSLAVI-KDGRLAEQGNFAE 1277

Query: 658  LFGNPLSELSQLLNE 672
            L  N  SEL +++NE
Sbjct: 1278 LMKNN-SELRRIINE 1291

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  174 bits (442), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 206/411 (50%), Gaps = 31/411 (7%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFINA 337
           R+  +A  +   V+ +     + V+ F  E+   ++Y   +    +    V +  AF+N+
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNS 339

Query: 338 -KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    T++L  M ++     G   ++ G L++GDL        L    VF LS      
Sbjct: 340 GQNLIFTTALTAMMYM-----GCTGIIGGSLTVGDLV-------LINQLVFQLSVPLNFL 387

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP---GKGEIEFKNVSFAYPTRPGS 446
            S Y E+ Q +     LF L +   +I   +  K +P   G  +I F+NV+F Y   P  
Sbjct: 388 GSVYRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRR 445

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
           +I ++ +F I  G    +VGPSG GKST+  L+ ++Y P  G I V+G DI + +  SLR
Sbjct: 446 KILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLR 505

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
           R IG+V Q+  L + +I +N+ +G   +A  +E+ R  ++      + + P    TI+G 
Sbjct: 506 RAIGVVPQDTPLFNDTIWENVKFG-RIDADDQEVTRSIEKAHLAPLVYRLPGGLNTIVGE 564

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIIS 626
            G ++SGG+KQR+AIAR LLK  +++  DEATSALD  +E A+  T      +   T + 
Sbjct: 565 RGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVY 624

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
           IAHRL TI  ++ +IVL  +G   E G    L     S   +L N +  ++
Sbjct: 625 IAHRLRTIADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWNIQENLD 674

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  175 bits (444), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 210/431 (48%), Gaps = 31/431 (7%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P ++L S  +G +++      +     L     E   G+KT++    EQ 
Sbjct: 848  KLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEIMLGIKTIRCLQLEQH 907

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
             I+RY+ +   + ++G++ A        IT++L      ++  YG  LV      IG+ T
Sbjct: 908  FIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAILFYYGLKLVF-----IGEYT 962

Query: 374  AYMMYTELTGSAVFGLSSFYS------EIMQGVGAASRLFEL---TDRIPMISPTTGK-K 423
               M+   T   +F + +  S      ++ +G  AASR+F +   +DR    S   G+ +
Sbjct: 963  TMKMFKTFT-LLLFTIMTCTSLINQIPDVTRGQRAASRIFRILDESDRFLEDSDEHGRTR 1021

Query: 424  YIPG----KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
             IP     K  I   N+ F YP+   S +F  LN +I     V +V  SG GKST+  LL
Sbjct: 1022 GIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAVVAESGSGKSTLLYLL 1081

Query: 480  LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
             + YK    +I +DG DI++    SLR  I IV+Q+P L  GSIR N+ YG   E    +
Sbjct: 1082 TRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIRKNLIYGNKLEIMDMD 1141

Query: 540  IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
            I  V KQ    +F+T  P+   T    + +LLSGGQ QRI IARALL+K  +LILDE TS
Sbjct: 1142 IYDVLKQVGIFDFVTSLPNGIDT--NVDTSLLSGGQAQRICIARALLRKSKILILDECTS 1199

Query: 600  ALDVESESAINYTFGKLMKK--KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657
            ALD ES     +    L+K     V  I+I H    +R    VIVL  DG   + G F  
Sbjct: 1200 ALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIVL-QDGETAQQGTFDE 1254

Query: 658  LF--GNPLSEL 666
            L+  GN L  +
Sbjct: 1255 LYKPGNELHRI 1265

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 147/609 (24%), Positives = 278/609 (45%), Gaps = 51/609 (8%)

Query: 90  LLCIAVGLLTVSCTIGMSLPKVI-GMVLDLLKNAISKSEDAELGSADLSIESSELPPIAF 148
           +L + V + T++  +  S+  ++ G V DLL N ++  +D  L  + L+++S  L  +  
Sbjct: 23  ILSLFVFIFTIASGLIPSISSILTGKVFDLLANILTMEKDELL--SQLTVKSMSLMALGA 80

Query: 149 GLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEFFDNNK 208
                 +L  I A + IG   +F                    ++   + +  E+FD N 
Sbjct: 81  ATIPVMWLS-ISAWMSIGETQSF---------------RIRRTILLSYLKKPMEWFDEND 124

Query: 209 --VGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPPV 266
             +GD +        V S S  +  +  F+  +            S  L+  +L  +P +
Sbjct: 125 QLLGDFVQMHRCVEEVRSGS-AEASAITFQNFVAIIALVCTSFYYSWSLTLIILCSSPLL 183

Query: 267 MLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVY 326
           ++ + +F R+I + ++   + TG   +      +  + V+ +  +  EIK++  ++    
Sbjct: 184 IVLAAFFSRMIENFTKLENDETGIAAQSLTWSMNAAQLVKLYCTQDFEIKKFKEIV---- 239

Query: 327 NVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHGGLSIGDLTAYMMYTE 380
            +     FINA  F ++++   + FL +        +GS ++    +S+  +        
Sbjct: 240 -IRCNDYFINA-WFYVSANTSILRFLSLAMFVQGFWFGSTMIKKNKMSVDQVITCFSSCL 297

Query: 381 LTGSAVFGLSSFYSEIM----QGVGAASRLFELTDRIPMISPTTGKKYIPGKG---EIEF 433
           + GS    L++   +I+      VG       L D+  M +    +  I        I F
Sbjct: 298 MLGSI---LNTTLPQIVLLQKAHVGLNRVQDFLEDKSEMATDRDRQTSINLDNVPISISF 354

Query: 434 KNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
             +SF YP+RP   + K+++   +P     IVG SG GKST+++LLLK+Y    G I V+
Sbjct: 355 DAISFCYPSRPDDMVLKNISMNFDPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVN 414

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI-RRVTKQC---FC 549
           G ++  ++   + +++ +V+Q+  L + ++R+N+  GL++ + AE++  R+ + C     
Sbjct: 415 GVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNNLLIGLSHISAAEDVDSRLQEACRFALL 474

Query: 550 HNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI 609
            N I K P    T +G  G  LSGGQ+QR+A+ARA L+   V+ILDEA SALD  +   +
Sbjct: 475 DNVIEKLPSGLDTKVGSGGVSLSGGQQQRVALARAYLRDTPVVILDEAISALDARNRRQL 534

Query: 610 NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQL 669
                   + K  T I + H L+ I  S+ + ++ N G + E G    L  N  S   + 
Sbjct: 535 MENIRIWTRSK--TAIILTHELNQILPSDFLYLMEN-GQIKEEGYQNELIENVESTFCKF 591

Query: 670 LNEKSTINE 678
            + +++  E
Sbjct: 592 FHLQNSNRE 600

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 237/491 (48%), Gaps = 24/491 (4%)

Query: 193  IKKTIHQDAEFF--DNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            I+K   QD  +F  D NK  ++ + + +D   + RS+  +       L+           
Sbjct: 830  IRKITAQDLHWFSLDMNKSSEISALVLNDLRDL-RSLVSEFLSSISTLIIVSSVGIVWAF 888

Query: 251  ISP-ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFV 309
            IS  +LS   +   P  +L S ++G L++      +    +L     E F G+ T++   
Sbjct: 889  ISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLHEIFRGITTIRYLK 948

Query: 310  AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS- 368
             E + +++Y N+ K +    K+ A         +++L      ++  YG  LV  G  S 
Sbjct: 949  LEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTLAVQAILFYYGIKLVTTGSYST 1008

Query: 369  --IGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP 426
              + +    +++T +T  ++ G      +I +G  AA+ +F + D     +    KK   
Sbjct: 1009 EKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRIIDNQSPAAKDEKKKIAS 1065

Query: 427  GKGE----IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
             K      I  KN+SF+YP+ P + I+K L   +  G  + +VG SG GKST+  L+   
Sbjct: 1066 YKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVGESGSGKSTLTLLISAL 1125

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
            Y+   G+I +DG DI++ ++  LR  I +V+Q+P    G++ +N+ YG++   T  +++ 
Sbjct: 1126 YEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKE 1185

Query: 543  VTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
                    +F+   P+   T +  + +L+SGGQ QR++IARA+L+KP +L LDE TSALD
Sbjct: 1186 ALCLAGVQDFVFSLPEGLDTRI--DTSLISGGQAQRLSIARAMLRKPKILFLDECTSALD 1243

Query: 603  VESESAINYTFGKLMKKK--EVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG 660
              +  AI      L+KK    +T I I H    +R  E + VL N G V E G F  L+ 
Sbjct: 1244 TSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERIAVLQN-GKVAEDGSFDDLYA 1298

Query: 661  NPLSELSQLLN 671
                E  +++N
Sbjct: 1299 QR-GEFFRIMN 1308

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 121/437 (27%), Positives = 198/437 (45%), Gaps = 27/437 (6%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  ++   P +++ S+   +LI   +R     + +  ++    F   + ++ F  +
Sbjct: 177 SWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQ 236

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVL-----AYGSYLVLHGG 366
           Q EI+++   +K          FI   LF+  S      F L +      +G+ ++  G 
Sbjct: 237 QFEIEKFELSVKKC-----TKYFIRISLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGV 291

Query: 367 LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT--------DRIPMISP 418
           L+ GD+        L G+ +         + +G  A  ++   T         R  +IS 
Sbjct: 292 LTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISD 351

Query: 419 TTGKKYIPGK-----GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKS 473
                +I        GEI FKNVSF+YPTRP   + K+++          IVG SG GKS
Sbjct: 352 AFILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKS 411

Query: 474 TIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY 533
           TI  LLLK Y    G I VDG DI  + +  L  +I +V+Q   L + +I++NI  G   
Sbjct: 412 TIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKG 471

Query: 534 EATAEE-IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
           +A  +  +R   +       I   P+   T+LG  G  LSGGQKQR+A+ARA ++   +L
Sbjct: 472 KAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPIL 531

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
           ILDEA S +D+     +     K   +K +T + + H L+ I   + +  +  +G + E 
Sbjct: 532 ILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQISDEDYLYFM-EEGQIRES 588

Query: 653 GKFKTLFGNPLSELSQL 669
           G    L  N  S  ++L
Sbjct: 589 GFKCNLEKNENSHFNRL 605

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  172 bits (435), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 135/433 (31%), Positives = 208/433 (48%), Gaps = 41/433 (9%)

Query: 282 RKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYN----VGKESAFIN- 336
           R   +A  +   V+ +     + V+ F  E+    +Y+  +    +    V +  AF+N 
Sbjct: 284 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNT 343

Query: 337 AKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLS------ 390
            +    T++L  M ++         V+ G L++GDL        L    VF LS      
Sbjct: 344 GQNLIFTTALTAMMYMACNG-----VMQGSLTVGDLV-------LINQLVFQLSVPLNFL 391

Query: 391 -SFYSEIMQGVGAASRLFELTDRIPMI--SPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQ 447
            S Y ++ Q +     LF+L      I  SP      I    +I F+NV+F Y   P  +
Sbjct: 392 GSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERR 449

Query: 448 IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRR 507
           I  +++F I  G    IVGPSG GKSTI  L+ ++Y+P  G I V G DI  L+  SLR+
Sbjct: 450 ILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRK 509

Query: 508 HIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
            IG+V Q+  L + +I +N+ +G    ++ +EI R  ++      +   P    T++G  
Sbjct: 510 AIGVVPQDTPLFNDTIWENVKFG-NISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGER 568

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
           G ++SGG+KQR+AIAR LLK   ++  DEATSALD  +E A+ +T  +       T + +
Sbjct: 569 GLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYV 628

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQL--LNEKSTINERNPNEKP 685
           AHRL TI  ++ +IVL   GSV E G   +L  +  S    L  + E  T+ ER      
Sbjct: 629 AHRLRTIADADKIIVL-EQGSVREEGTHSSLLASQGSLYRGLWDIQENLTLPER------ 681

Query: 686 AETPEQESQKNAA 698
              PEQ +    A
Sbjct: 682 ---PEQSTGSQHA 691

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  174 bits (440), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 218/424 (51%), Gaps = 29/424 (6%)

Query: 264  PPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIK 323
            P +++ S  +G  ++      + A  QL     E    +KT++    +     RY+   +
Sbjct: 863  PLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQ 922

Query: 324  DVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS---IGDLTAYMMYTE 380
             + ++G+  + I      IT +L      ++  YG  LV+ G  +   + ++   +++T 
Sbjct: 923  RMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTI 982

Query: 381  LTGSAVFG----------LSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGE 430
            +T + +             +++   I++   A     ++ +R   IS T+ K  +     
Sbjct: 983  MTCTNLINQIPEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNTSEKDTM----- 1037

Query: 431  IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
            +  K+++FAYP  P   +++ LN  ++  ++V +VG SG GKSTI SLL K Y      I
Sbjct: 1038 VLVKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHI 1097

Query: 491  TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE-EIRRVTKQCFC 549
             VDG D+S+ ++ SLR  I +V+Q   L++G+IR+N+TYGL  E T E ++  + K    
Sbjct: 1098 YVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSI 1157

Query: 550  HNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI 609
            ++F+++ P+   TI+  +  LLSGGQ QR+ IARAL+K   +LILDE TSALD  S + I
Sbjct: 1158 YDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPHRILILDECTSALDALSTNII 1215

Query: 610  NYTFGKLMKK--KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELS 667
                  +++K      II+I H    +R  E V++L N G++VE G F  L     SE  
Sbjct: 1216 ----IDIVRKGIPNTLIIAITHDEHMMRSCESVLLLKN-GAIVEQGSFVELMQQD-SEFK 1269

Query: 668  QLLN 671
            + LN
Sbjct: 1270 KCLN 1273

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/444 (27%), Positives = 204/444 (45%), Gaps = 33/444 (7%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L  TP +   ++YF +L    +    + T     +          V+ + A+
Sbjct: 162 SWSLTLIILCSTPIITAIAIYFAKLTNKYTDLENKETSYAAELLTWSMRFNDMVKFYTAQ 221

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSS-----LGDMSFLLVLAYGSYLVLHGG 366
             EI +++  +         S FI A L++  +S     L    F+    +G+ ++    
Sbjct: 222 NEEISKFDTSVTRC-----NSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRRNK 276

Query: 367 LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL---FELTDRIPMISPTTGKK 423
           L I D+        + G+ V    S  + I +G  A  +L    EL  +  M +      
Sbjct: 277 LDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAALK--- 333

Query: 424 YIPGKGE---IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
             P KG    I F N+SF YP R  +   ++++ ++E G    I+G SG GKST+A LLL
Sbjct: 334 -CPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLL 392

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYG-------LTY 533
           ++Y+  +G+ITVD   I  LN + L  +I +V+Q   L + ++R+NI  G          
Sbjct: 393 RFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARM 452

Query: 534 EATAEEIRRVTKQC---FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPN 590
           E+  E  R++ K C     +  +    D   T++G  G  LSGGQ+QR+A+ARA L+   
Sbjct: 453 ESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTP 512

Query: 591 VLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVV 650
           ++I DE+ SALDV     +        + K  T I + H LS I  ++ + ++ + G V 
Sbjct: 513 IMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-GRVC 569

Query: 651 EIGKFKTLFGNPLSELSQLLNEKS 674
           E G  + L  +  S  S+    ++
Sbjct: 570 EYGYQEDLLKSETSYFSRFYQHQA 593

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 135/441 (30%), Positives = 218/441 (49%), Gaps = 34/441 (7%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P +++ S  +G +++      + +  QL     +  + +KT++   AE  
Sbjct: 864  KLSLVCISMFPLIVIFSAIYGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFH 923

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVL---HGGLSIG 370
                Y+++ K +  +  + A       ++T+ +      ++  YG  LVL   +    + 
Sbjct: 924  FQLSYHDLKKKMEQIAYKRAIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMF 983

Query: 371  DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD-------------RIPMIS 417
            +    +++T ++ +++ G      +I +G  AAS ++ + D             R   IS
Sbjct: 984  ETFTLLLFTIMSCTSLVGQ---IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDIS 1040

Query: 418  PTT--GKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTI 475
                 G + IP    I  +N+SFAYP+ P   IFK ++  +     + IVG SG GKST+
Sbjct: 1041 GAEYYGDRNIP---IISIRNLSFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTL 1097

Query: 476  ASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEA 535
            A LL + Y   A +I +DG D++  N  SLR+ I +V+Q+P    GSIRDN+TYG   E 
Sbjct: 1098 ALLLTRLYNCEANSIIIDGTDVNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEM 1157

Query: 536  TAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILD 595
               EI  V K    ++F+   P    T +  N  LLSGGQ QR+ IARALL+K  +LILD
Sbjct: 1158 LEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILD 1215

Query: 596  EATSALDVESESAINYTFGKLMKKKEVTIIS--IAHRLSTIRRSEIVIVLGNDGSVVEIG 653
            E TSALD  S   IN     +++K    +++  I H    +R    + VL + G VVE G
Sbjct: 1216 ECTSALDSVSSRIIN----DIVRKGPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEG 1270

Query: 654  KFKTLFGNPLSELSQLLNEKS 674
             F  L+ N   EL +++  KS
Sbjct: 1271 NFDNLY-NKEGELFRIVCNKS 1290

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 121/470 (25%), Positives = 216/470 (45%), Gaps = 36/470 (7%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L  +P + + ++ F RLI   ++K    T    ++     +  + V+ +  +
Sbjct: 174 SWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQ 233

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
             E +++  +I     +   + FI + L+ + ++ G + FL +        +GS ++  G
Sbjct: 234 PLERQKFQEII-----LSCNTFFIKSCLY-VAANAGILRFLTLTMFVQGFWFGSTMIRKG 287

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI 425
            L+I D+        + GS +         + +G  A  ++  L +     + +  ++++
Sbjct: 288 KLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHL 347

Query: 426 P-----GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
                    ++ F+NVSFAYP+RP   + +++N K   G    IVG SG GKSTI++LLL
Sbjct: 348 QPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLL 407

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE- 539
            +Y    G+I ++G++   +  K L  +I +V+Q   L + +++ NI  G T      + 
Sbjct: 408 NFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADT 467

Query: 540 --------IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNV 591
                   I+   +       I   PD  +T++G  G  LSGGQ+QR+AIARA ++   +
Sbjct: 468 NTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPI 527

Query: 592 LILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVE 651
           L LDEA SALD+   + +        K K  T I + H LS I   + + V+  +G VVE
Sbjct: 528 LFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQIESDDHLYVM-QEGRVVE 584

Query: 652 IGKFKTLFGNPLSELSQLL-------NEKSTINERNPNEKPAETPEQESQ 694
            G    L  +  +  S+         + K+ IN     E    T    SQ
Sbjct: 585 SGIQSELLADSATTFSKWYYLQNDFSDAKTIINTETEEESIYTTESFNSQ 634

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  171 bits (434), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 210/416 (50%), Gaps = 18/416 (4%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P +++ SM +G L++    + +    +L  V  E  +G+KT++    E  
Sbjct: 851  KLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDH 910

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSY-LVLHGGLSIGDL 372
               ++N + +    +G+  A +      +++ L  MS   +L Y +  LV+HG  +   +
Sbjct: 911  FKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGL-TMSIQGILYYYAIKLVIHGEYTTKKM 969

Query: 373  TAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRI--PMISPTTGKKYIPGKGE 430
                     T      L +   +I +G  AAS+++ + + I       T G + +P    
Sbjct: 970  FETFTLLLFTIMTCNNLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVEN 1029

Query: 431  -----IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
                 I F ++SFAYPT P  +I K L+ +I  G  + IVG SG GKST+ +++ + Y+ 
Sbjct: 1030 PTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYEC 1089

Query: 486  TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
             + ++ VD  D++      LR  I +V+Q+P L  G+IR+N+ YG        ++  + K
Sbjct: 1090 PSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLK 1149

Query: 546  QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
                ++F    P+  +T +  +  LLSGGQ QR+ IARALL++P +LILDE TSALD  S
Sbjct: 1150 YVGIYDFFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMS 1207

Query: 606  ESAINYTFGKLMKKKEVTI--ISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
               IN    +++++   T+  ISI H    +R    V VL + G +VE+G  + L 
Sbjct: 1208 SHIIN----EIIREGPPTMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLL 1258

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 163/609 (26%), Positives = 266/609 (43%), Gaps = 76/609 (12%)

Query: 84  AKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSEL 143
            KKD  LL         S  +  +L  + G V +LL      S+       +L + S  +
Sbjct: 13  GKKDVILLGFVSASTIASGLVPAALSILTGRVFNLLNEYTQWSDPIH----ELRLRSMVI 68

Query: 144 PPIAFGLSLYEFLGCIGAALLIGTAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEF 203
             +  G S+     CI + +L+G   NF                  +Q+I   + +  ++
Sbjct: 69  LALGAG-SIVIIWICISSWMLLGERQNF---------------RVRTQLIDSYLQKPMKW 112

Query: 204 FDNNKV--GDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLF 261
           +D+N    GDL ++       +  S  +  +  +K L+            S  L+   + 
Sbjct: 113 YDDNDTLTGDL-TQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTLVTMC 171

Query: 262 FTPPVMLSSMYFGRLIRDNSRKLQEATG-------------QLTRVSEEQFSGVKTVQAF 308
             P ++L +++F RLI   S K    T              QL R+S  Q   V+  Q  
Sbjct: 172 GAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLA 231

Query: 309 VAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS 368
           V      K   N +K        +A +  K  T+T       F+    +GS ++    L 
Sbjct: 232 VK-----KCSKNFMKMCLYASANTAIL--KFLTLTI------FVQAFWFGSTMIRKHKLR 278

Query: 369 IGDLTAYMMYTELTGSAVFGLSSFYSEIMQ----GVGAASRLFELTDRIPMISPTTGKKY 424
           I D+        L G+ + G +     I+Q    GV   +   +  + +        + Y
Sbjct: 279 IEDVITCFQSCVLLGATING-TLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFY 337

Query: 425 IPG--KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
           + G    +IE +NV F YP+RP     K+++  +  G    +VG SG GKS++ +LLLK 
Sbjct: 338 LDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKL 397

Query: 483 YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
           Y    G+I++DG DI  ++ KS+ ++I +V+Q   L + ++R+NI +G   + T E +R 
Sbjct: 398 YDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFG--SKETDELVRD 455

Query: 543 VTKQCFCH-----NFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597
            + +  C      NFI   P+   T++G  G   SGGQ+QRIAIARA ++   +L+LDEA
Sbjct: 456 ESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEA 515

Query: 598 TSALDVESESAINYTFGKLMK-----KKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
            SALD+          G LM      + E T I + H LS I   +++ +L  DG VVE 
Sbjct: 516 VSALDIIHR-------GLLMNAIRNWRSEKTTIILTHDLSEIGPDDMIYLL-EDGEVVEQ 567

Query: 653 GKFKTLFGN 661
           G+ + L  N
Sbjct: 568 GQQRNLLLN 576

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 138/510 (27%), Positives = 244/510 (47%), Gaps = 32/510 (6%)

Query: 190  SQVIKKTIHQDAEFF--DNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXX 247
            +++++K   ++  +F  +NNK  ++ + + +D   + RS+  +      + +        
Sbjct: 798  NEIMEKVTRKNINWFSGENNKAAEISALVMNDLRDL-RSLVSEFLSAMTSFITVSTIGLV 856

Query: 248  XXSISP-ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQ 306
               IS  +LS   +   P +++ S+ +G  ++      + +  QL     +  + +KT++
Sbjct: 857  WALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIK 916

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGG 366
               AE      Y+++   +  +  + A       ++T+ +      ++  YG  LV+   
Sbjct: 917  CLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHE 976

Query: 367  LSIGDLTA---YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLF----------ELTDRI 413
             +   + A    +++T ++ + + G      +I +G  AAS ++          E+ D  
Sbjct: 977  YTSKKMFATFTLLLFTIMSCTTLVGQ---IPDISRGQRAASWIYRILDEAECTLEIEDNN 1033

Query: 414  PMISPTTGKKYIPGKGE--IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
              +   +G  Y     +  +  +N++FAYP+ P   I+K ++  +  G  V IVG SG G
Sbjct: 1034 GRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKRMDLNMFCGQTVGIVGESGSG 1093

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGL 531
            KST+  LL   Y    G I +DG D++  N  SLRR I +V+Q+P L  GSIRDN+TYG 
Sbjct: 1094 KSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISVVEQKPSLFDGSIRDNLTYGC 1153

Query: 532  TYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNV 591
              +    E+    K    ++F+   P    T +  N  LLSGGQ QR+ IARALL+K  +
Sbjct: 1154 LGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN--LLSGGQAQRLCIARALLRKSKI 1211

Query: 592  LILDEATSALDVESESAINYTFGKLMKKKEVTIIS--IAHRLSTIRRSEIVIVLGNDGSV 649
            LILDE TSALD  S   IN     ++KK    +++  I H    +R    V+V   DG +
Sbjct: 1212 LILDECTSALDSVSSRIIN----DIVKKGPPALLTMVITHNEEMMRCCSSVVVF-KDGKI 1266

Query: 650  VEIGKFKTLFGNPLSELSQLLNEKSTINER 679
            VE G F TL+ N   EL ++++    +  +
Sbjct: 1267 VEEGSFDTLY-NDHKELFRIISPAEVVERK 1295

 Score =  166 bits (421), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 119/422 (28%), Positives = 207/422 (49%), Gaps = 29/422 (6%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L  +P + L ++ F R+I   ++K    TG+  ++     +  + V+ +  +
Sbjct: 174 SWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLTWSMNAAQLVRLYCTQ 233

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
             E K++  ++ +       + F     F + ++ G + FL +        +GS ++  G
Sbjct: 234 PLERKKFEEIVSNC------NTFFIKSCFYLAANAGVLRFLTLTMFVQGFWFGSTMIRKG 287

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPT-TGKKY 424
            L+I D+        + G+ +         + +G  A  ++  L +  P  + + T + Y
Sbjct: 288 RLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGPKRNTSNTIELY 347

Query: 425 IP----GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
            P      G++ F+NVSFAYP+RP   I ++   K   G    IVG SG GKSTI++LLL
Sbjct: 348 QPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSGSGKSTISNLLL 407

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE- 539
           K+Y    G+I+++G++I  +  KSL  +I +V+Q   L + ++++NI  G T      + 
Sbjct: 408 KFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNILLGSTGSIRNADS 467

Query: 540 --------IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNV 591
                   I+   +       I   PD  +TI+G  G  LSGGQ+QR+AIARA ++   +
Sbjct: 468 NTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRVAIARAFIRDTPI 527

Query: 592 LILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVE 651
           L LDEA SALD+   + +        K K  T I + H+LS I   + + ++  DG V+E
Sbjct: 528 LFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQLSQIEADDYLYLM-QDGKVIE 584

Query: 652 IG 653
            G
Sbjct: 585 SG 586

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON}
           Anc_1.527 YKL209C
          Length = 1296

 Score =  169 bits (429), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 130/447 (29%), Positives = 215/447 (48%), Gaps = 27/447 (6%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS-GVKTVQAFVA 310
           S  L+  +L  TP + + S+ F  +I+    K        T VS + F+  ++ +Q    
Sbjct: 179 SWSLTLIILCSTPIICIFSICFSIMIQ----KFANLENNETTVSAQIFTETIQNIQLIKL 234

Query: 311 EQREIKRYNNVIKDVYNVGKESAFINAKLF-----TITSSLGDMSFLLVLAYGSYLVLHG 365
              ++K+       +    K   FI   L+     +I  +L  + F+    +GS ++  G
Sbjct: 235 NNLQLKKLMKFQTSISKCNK--FFIQMCLYVSLNTSILRTLTLLMFVQGFWFGSTMIRKG 292

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI 425
            L I ++        L GS +         + +G  A  ++ +  D              
Sbjct: 293 HLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDFLDEADDPLEINSAPIT 352

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
                I F+N+SFAYP+RP   I   +N   +  +   IVG SG GKST+++LLLK+Y+ 
Sbjct: 353 LINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYET 412

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT-----YEATAEEI 540
             G I +D  +I  LN K+L  +I IV+Q+  L + +IR+NI +G++     Y +    +
Sbjct: 413 YKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNL 472

Query: 541 -RRVTKQC---FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             R+   C      +F+   P+   T++G  G  LSGGQ+QR+A+ARA ++ P +LILDE
Sbjct: 473 NERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDE 532

Query: 597 ATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFK 656
           A SALDV     +     KL +  + TII + H L+ I   + + V+ + G ++E GK K
Sbjct: 533 AVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRK 589

Query: 657 TLFGNPLSELSQLLNEKSTINERNPNE 683
            L  +P +E  +L+   +  N  N NE
Sbjct: 590 ELITDPNTEFHKLV---AIQNNNNLNE 613

 Score =  167 bits (422), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 126/417 (30%), Positives = 202/417 (48%), Gaps = 14/417 (3%)

Query: 264  PPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIK 323
            P +++ S  +G +++ +    + +   L  +  +  S +KT+++   E      Y     
Sbjct: 882  PLIIIFSAIYGAVLQKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAET 941

Query: 324  DVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTG 383
             + NV  + +       +IT+++      ++  YG  L++ G  ++  +         T 
Sbjct: 942  KLKNVATKRSIYTGLGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTV 1001

Query: 384  SAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGE--------IEFKN 435
                 L +   ++ +G  AAS ++ +  +            I             ++ KN
Sbjct: 1002 MTCNSLVNQIPDMSRGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKN 1061

Query: 436  VSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQ 495
            ++FAY + P  ++   L  K+ PG  + I G SG GK+T+ SLL+K+Y      I  +G+
Sbjct: 1062 LTFAYESTPSIKVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGK 1121

Query: 496  DISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITK 555
            DI     +SLR  I IV+Q+P ++SGSIRDN+        +  E+  V K     +FI  
Sbjct: 1122 DILNYEFESLRDAIVIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIET 1181

Query: 556  FPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGK 615
             P    TI+  + TLLSGGQ QRI IARALL+KP +LILDE TSALD  S   IN    K
Sbjct: 1182 LPSGIDTII--DTTLLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSK 1239

Query: 616  LMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNE 672
             +    VTIISI H  S +   + V VL N G +VE+G + +L     S L +LL++
Sbjct: 1240 ELNG--VTIISITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL-ATSSSHLGKLLSK 1292

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/421 (28%), Positives = 204/421 (48%), Gaps = 23/421 (5%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P +++ SM +G ++++     + A   L  +  E  + +KT++       
Sbjct: 825  KLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDH 884

Query: 314  EIKRYNNVIKDVYNVGKESAFIN----AKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
             +  Y+ + K +  + K+   +     + L TIT+ +  + +     YG  LVL G  + 
Sbjct: 885  FLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTITTCIQSILYY----YGLKLVLTGEYTS 940

Query: 370  GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGK----KYI 425
              +         T +    L S   ++ +G  AAS +  + D         G+    + I
Sbjct: 941  KTMFQTFTLVLFTVTTCNSLVSQIPDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETI 1000

Query: 426  PGKGE----IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
              + +    IE +N++F YP  PG  +++ LN KI  G  + +VG SG GKST+  LL K
Sbjct: 1001 EHENDSDPLIEIENLNFHYPNTPGVNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTK 1060

Query: 482  YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYE--ATAEE 539
             Y      I ++G DI+  +   LR  I +V+Q+P L  G+IR+NITYG++ +   +  E
Sbjct: 1061 LYDVQDNRILINGTDINDWSYDILRAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETE 1120

Query: 540  IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
            ++ + +    H F+   P    T++     LLSGGQ QR+ I R LL+KP VLILDE TS
Sbjct: 1121 VQELLQLVDMHEFVEALPKALDTVVDIG--LLSGGQAQRLCIVRTLLRKPKVLILDECTS 1178

Query: 600  ALDVESESAINYTFGKLMKK--KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657
            +LD ++   +      L  K   ++  I I H    ++    ++VL + G VVE G+F  
Sbjct: 1179 SLDAQTTQIVIALIKDLNTKLGWDILTIVITHNRQMMQCCSRLVVL-DVGRVVEDGQFDD 1237

Query: 658  L 658
            L
Sbjct: 1238 L 1238

 Score =  160 bits (404), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 117/423 (27%), Positives = 207/423 (48%), Gaps = 24/423 (5%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S +L+  +L  +P +++ +  F R I+  +    + T     +        +TV+    +
Sbjct: 166 SWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAADLLMWTMDSSQTVKLSCTQ 225

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
            +EIK++  ++           FI   LFT  +++G + FL +        +GS ++  G
Sbjct: 226 SKEIKKFETLVSKC-----NDYFIRTSLFT-AANIGILRFLTLSMFVQGFWFGSTMIRKG 279

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMI--SPTTGKK 423
            L+I D+        + GS +         I +G  A +++ +  +  P +     T   
Sbjct: 280 KLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAKIQKFINESPELPSKTLTSSG 339

Query: 424 YIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYY 483
            +    +I   N++FAYP+RP   + K+++ KI+      IVG SG GKSTI +L++K+Y
Sbjct: 340 LVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGKSGSGKSTITNLIMKFY 399

Query: 484 KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRV 543
           +   G I V  +DI  +    L ++I +V+Q   L + ++++NI  G  Y  T++ I   
Sbjct: 400 EDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNILLGSKY--TSQTINDG 457

Query: 544 TKQCFC-----HNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEAT 598
                C      + I+  PD  +T LG +G  LSGGQ+QR+A+ARA L+  ++LILDEA 
Sbjct: 458 LLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVALARAFLRDTDILILDEAV 517

Query: 599 SALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
           SALD+     +     K+ + K  T I + H L+ I  ++ + +  N+  + E G  KTL
Sbjct: 518 SALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDNDYIYLFENN-EIKENGFKKTL 574

Query: 659 FGN 661
             +
Sbjct: 575 MND 577

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 142/241 (58%), Gaps = 4/241 (1%)

Query: 429 GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
           G+IEF++VSFAYPTRP   + K+++ KI+ G+   IVG SG GKST+ASLLLK Y    G
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 489 TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCF 548
            I     +I  L+   L  +I +V+Q   L +G+++DN+T    Y A+  E+++  +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTIVNKY-ASCTEVKQACQFAL 473

Query: 549 CHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESA 608
            +  +   P+   T+LG +G  LSGGQ+QR+A+ARA L+   VLILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 609 INYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQ 668
           I        K K  T I + H  + I+  E V ++ ++G+VVE G    L  NP S  +Q
Sbjct: 534 IVEAIRHWRKGK--TTIILTHEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENPDSYFAQ 590

Query: 669 L 669
           L
Sbjct: 591 L 591

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 124/415 (29%), Positives = 208/415 (50%), Gaps = 15/415 (3%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQL-TRVSEEQFSGVKTVQAFVAEQ 312
            +LS   +   P  +L S  +G L++      +    +L TRV E   S +KT++    +Q
Sbjct: 848  KLSLVCISLFPAFILFSGIYGSLLQVYETAYKTEIAELETRVHELVIS-MKTIKLLQLQQ 906

Query: 313  REIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDL 372
                 +   +  V  V K+ +        +T++L  +   ++  +G  LV+ G  S+  +
Sbjct: 907  HFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQM 966

Query: 373  TAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMIS-----PTTGKKYIPG 427
                     +      L +   EI +G  AA+ +F++ +    +      P+  + +   
Sbjct: 967  FETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFST 1026

Query: 428  KGE---IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
             G    I+  N+SFA+ + P ++IF SL+ +I     V IVG SG GKST++ LL + Y 
Sbjct: 1027 AGNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYP 1086

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
              +G + + G DI+K +  +LRR I IV+Q+P    G++R+N+ YGL    +  E+R V 
Sbjct: 1087 VPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVL 1146

Query: 545  KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
            K     +F+   P+   T +  +  L+SGGQ QR++IAR LL++P ++ILDE TSALD  
Sbjct: 1147 KSVDLLSFVQTLPNDLNTRV--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAA 1204

Query: 605  SESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            +  AI      ++K   VT+I I H    ++  + V+VL   G V E G +  LF
Sbjct: 1205 NSFAIAELIRTVLKN--VTVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELF 1256

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  164 bits (415), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 118/430 (27%), Positives = 209/430 (48%), Gaps = 17/430 (3%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P  +L +  +G L++      + A   +          +KT++    E+R
Sbjct: 876  KLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEER 935

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
             IK Y  +       G++ A        ++++L  ++  ++L YG  LV+ G  S   + 
Sbjct: 936  VIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMF 995

Query: 374  AYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTT--GKKYIPGKGE- 430
              +     T      L +   EI +G  AA+ LF + D     +     G+  +  +G  
Sbjct: 996  QTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCS 1055

Query: 431  ----IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
                I  K++ F+Y       +++ LN  ++ G  V +VG SG GKST+  L+ + Y+  
Sbjct: 1056 NEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVP 1115

Query: 487  AGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQ 546
            +G+I  DG D+++    +LR+ I +V+Q P L  GSI DN+TYGL+      EIR + + 
Sbjct: 1116 SGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLEL 1175

Query: 547  CFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESE 606
                +F+   P   Q+ +  +  +LSGGQ QR+AI RALL+KP +L+LDE TSALD +  
Sbjct: 1176 VGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQH- 1232

Query: 607  SAINYTFGKLMKK--KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLS 664
                +   + +++  +  T + + H    +R    ++   N G+++E G F+ L+     
Sbjct: 1233 ---GFIMSEFVRQGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIEDGSFERLYSQK-G 1287

Query: 665  ELSQLLNEKS 674
            EL ++L+  S
Sbjct: 1288 ELFKILSSCS 1297

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 118/433 (27%), Positives = 201/433 (46%), Gaps = 24/433 (5%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  ++  +P V+  +++F R +   +++    T              K V+    +
Sbjct: 172 SWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWSLDAAKMVRLLGTQ 231

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371
            RE+ R+   ++       + +  ++  +++   L    F+    YG+  +  G L  GD
Sbjct: 232 DRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYGNSRINIGKLKPGD 291

Query: 372 LTAYMMYTELTGSAVFGLSSFYSEIM---QGVGAASRLFELTDRIPMISPTTGK-----K 423
           +        L  S    L+S   +I+   +G     ++    +          K     +
Sbjct: 292 VVTCFSSCVLLAST---LNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQKNKVEISFR 348

Query: 424 YIP---GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
            +P    +  I F+NV FAYPTRP   + K ++     G    ++G SG GKSTI +LLL
Sbjct: 349 RLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLL 408

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE- 539
            +Y   +GTI V+GQD+ ++N   L R+I +V+Q   L + ++ +N+T G   EA  ++ 
Sbjct: 409 GFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVTIG---EAGVDDD 465

Query: 540 ---IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
              +++  +     N I       +T +G +G  LSGG++QR+A+ARA  +   +LILDE
Sbjct: 466 EIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYFRNAPILILDE 525

Query: 597 ATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFK 656
           A SA D   +S +     K    K  T I + H LS I  ++ V V+ +DG + E G   
Sbjct: 526 ALSAQDRIHKSLLMEAIRKWRADK--TTIILTHELSDILDTDYVYVM-SDGQIREHGYKS 582

Query: 657 TLFGNPLSELSQL 669
            L  NP SE S L
Sbjct: 583 GLLSNPKSEFSNL 595

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  164 bits (414), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 190/395 (48%), Gaps = 14/395 (3%)

Query: 273  FGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKES 332
            +G  ++ +  + + A  QL  +  E   GVKT++    E     RY  + K +    +  
Sbjct: 881  YGMFVQKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRR 940

Query: 333  AFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSF 392
            + +      ITS L  +   ++  YG  LV+ G      L         T  +  GL S 
Sbjct: 941  SILYGSGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSA 1000

Query: 393  YSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEF--------KNVSFAYPTRP 444
                 +G  A + +F + +  P+  P      +       F        + ++FAYP   
Sbjct: 1001 LPSSSRGQRAGTFVFGMLEE-PLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAK 1059

Query: 445  GSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKS 504
              QI+K+ N +I  G+ V IVG SG GKST+  L+   Y     ++ +DG DI      +
Sbjct: 1060 DVQIYKNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSA 1119

Query: 505  LRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTIL 564
            LR+ I +V+Q+P   +G+IR+N+ YGL    T  EI  V  +    NF+   P+  +T +
Sbjct: 1120 LRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRV 1179

Query: 565  GPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTI 624
              N  L+SGGQ QR++I RALL++P +LILDE TSALD  + +AI       +   ++T+
Sbjct: 1180 DTN--LVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITV 1235

Query: 625  ISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            I I H    ++  + ++VL N G+V E G F  LF
Sbjct: 1236 IVITHSKQMMKMCDRIVVLKN-GAVAEDGSFDDLF 1269

 Score =  125 bits (315), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 132/256 (51%), Gaps = 4/256 (1%)

Query: 430 EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
           EI F  VSF YP RP ++    ++    P     IVG SG GKST+ +LLLK+Y    G 
Sbjct: 358 EIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGI 417

Query: 490 ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT-YEATAEEIRRVTKQCF 548
           ITV+  ++  ++   L ++I +V+Q   L +G++ +NIT        TA  ++R  +   
Sbjct: 418 ITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFENITLSAKPVNKTAGAVKRACQMAL 477

Query: 549 CHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESA 608
               +   P+   T +G  G  +SGGQ+QR+A+ARA+L+   VLILDEA SALD+     
Sbjct: 478 LEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDL 537

Query: 609 INYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQ 668
           +          K  T I + H LS +   + + ++ + G V+E G    L  NP S    
Sbjct: 538 LMEVIRSWRADK--TTIILTHELSHVLDDDYLYMMEH-GQVIEQGYKSELLSNPNSRFRA 594

Query: 669 LLNEKSTINERNPNEK 684
           L   +++ NER   E+
Sbjct: 595 LNRLQNSKNERALEER 610

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  162 bits (410), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 131/441 (29%), Positives = 216/441 (48%), Gaps = 33/441 (7%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P  +L S  +G L+++   + +    +L     +    +KT++    E +
Sbjct: 875  KLSLVCISLIPMFVLFSGIYGGLLQNYEARYKTCIAELENELYKAIRCMKTIKCLQMENK 934

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFL---LVLAYGSYLVLHGGLSIG 370
              + Y   + +V + G          F + SS   ++F+   ++L +G  LV+ G  + G
Sbjct: 935  VARSYE--MLEVTSKGAARKRAMGTGFGVASS-NALTFITQSILLYFGMKLVITGEYTPG 991

Query: 371  DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL------------TDRIPMISP 418
             +   +     T      L S   EI +G  AA+ LF+L             +R   I  
Sbjct: 992  KMLETLTLLLFTIMTCMTLMSQVPEISRGQRAATYLFKLFGNEHEEGASVLKERHAPIIK 1051

Query: 419  TTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASL 478
            T  K+ +     I  K++ F+Y       ++K+L+ K++ G  V ++G SG GKST+ SL
Sbjct: 1052 TCSKQTL-----ISIKHLKFSYSNINNPMVYKNLSLKVDRGEIVGLIGTSGSGKSTLWSL 1106

Query: 479  LLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE 538
            L + Y    G+I++DG DI++ + K+LR  I +V+Q+P+  SGSI +N+TYGL  + + E
Sbjct: 1107 LTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDE 1166

Query: 539  EIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEAT 598
            E+  +        F+   P +  +++  +  LLSGGQ QR+AI RALL+KP +L+LDE T
Sbjct: 1167 EVNELLLTLGMLEFVNSTPKRLHSVI--DTQLLSGGQVQRLAIVRALLRKPQLLVLDECT 1224

Query: 599  SALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            SALD    S I   F K       T++ + H    +R    ++   N G +VE G    L
Sbjct: 1225 SALDAR-HSFIMSEFVKHHLYHTTTLV-VTHSEQMMRSCHRILTF-NKGEIVEEGSIDNL 1281

Query: 659  FGNPLSELSQLLNEKSTINER 679
            F N   EL ++L    T N R
Sbjct: 1282 F-NQKGELYRIL----TCNSR 1297

 Score =  154 bits (389), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 129/450 (28%), Positives = 215/450 (47%), Gaps = 31/450 (6%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  ++  +P V+  ++Y  R +    +     T     +     +  K V+    +
Sbjct: 176 SWSLTLVIMANSPLVIGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQ 235

Query: 312 QREIKRYN-NVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
             EI ++  +V+K   N  K S F +   ++I   L    F+    YG+  +  G L  G
Sbjct: 236 DYEIAKFRASVLKCRMNFNKMSLFSSLN-YSILRFLTLCMFVQGFWYGNVRIKSGNLKPG 294

Query: 371 DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL--FELTDRIPMISPTTGKKYIP-- 426
           D+        L  S +         + +G     ++  F  +D +          ++P  
Sbjct: 295 DVMTCFSSCILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLL 354

Query: 427 -GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
             + +I F+NVSFAYP+R    + K+LN K+  G    IVG SG GKSTI++LLLK Y+P
Sbjct: 355 WEQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRP 414

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR---R 542
            +G I V+  DI ++N + L R I +V+Q   L   SI++NI      + T++E R   R
Sbjct: 415 CSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNI------QLTSDEHRDDGR 468

Query: 543 VTKQC---FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
           +++ C        I        TI+G +G  LSGG++QR+A+ARA ++   +LILDEA S
Sbjct: 469 LSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALS 528

Query: 600 ALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
           A D   +  +     +  +K   TII + H L+ I   + V+++  DG+V+E G+   L 
Sbjct: 529 AQDRMHKDLLMEAI-RFWRKGRTTII-LTHELNDILEDDFVLLM-EDGNVIERGQKSDLL 585

Query: 660 GNPLSELS---------QLLNEKSTINERN 680
            +  S+ S         ++ +E STI + N
Sbjct: 586 SDSTSKFSLLHAFQLCDEIEDEASTITDSN 615

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 142/527 (26%), Positives = 247/527 (46%), Gaps = 77/527 (14%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            + ++ K IH    FFD   +G +++R   D   V + +T  ++  F + +          
Sbjct: 1196 AMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILIS 1255

Query: 250  SISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVK 303
             I+P+      FF   +++S MY+  G      SR+L+           + FS    GV 
Sbjct: 1256 WITPQ------FFVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVT 1309

Query: 304  TVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVL 363
            T++AF  E R +K      ++++ + +     N   F +  +   +SF + +  GS++V 
Sbjct: 1310 TIRAFGDEMRFLK------ENLFKIDEN----NKPFFYLWVANRWLSFRIDMI-GSFVVF 1358

Query: 364  HGGL----SIGDLTAYMMYTELTGSAVF-----GLSSFYSEIMQGVGAASRL-------- 406
              G+     I ++ + M    LT +  F      L  FYSE+   + +  R+        
Sbjct: 1359 GAGVFILADIKNIDSGMAGISLTYAISFTEGALWLVRFYSEVEMNMNSVERIKEYMSVEQ 1418

Query: 407  --FELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCI 464
              +++ D I    PT      P +G+IE  ++S  Y      ++ K+++F +EP S V +
Sbjct: 1419 EPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAANL-PRVIKNVSFTVEPNSKVGV 1473

Query: 465  VGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIR 524
            VG +G GKSTI + L ++  P +G I +D  DI+ +    LRR I I+ Q+P L +G+++
Sbjct: 1474 VGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFAGTLK 1533

Query: 525  DNITYGLTYE-------------ATAEEIR----RVTKQCFCH-NFITKFPDQYQTILGP 566
             N+     Y               + EE+      V+ Q   H N   +F D    I   
Sbjct: 1534 FNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSNEITEG 1593

Query: 567  NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYT----FGKLMKKKEV 622
             G  LS GQ+Q I +AR+LL+ P +L+LDEAT+++D ES++ +  T    FG        
Sbjct: 1594 GGN-LSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGN------S 1646

Query: 623  TIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQL 669
            TI++IAHRL ++   + ++V+ + G V+E     +L  N  SE  ++
Sbjct: 1647 TILTIAHRLRSVIDYDKILVM-DAGEVIEYDHPYSLLLNRNSEFYKM 1692

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 132/289 (45%), Gaps = 26/289 (8%)

Query: 430  EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
            ++ F N + ++ T       ++LN   + G    ++G +G GK+++   LL       G 
Sbjct: 758  KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 490  ITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQ 546
            I V   + +     NS      I    Q   L++ ++R+NI +  +++       +V + 
Sbjct: 818  IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFDEN--RYHKVVEA 875

Query: 547  CFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESE 606
            C              T +G  G  LSGGQKQRI++ARAL      L+LD+  SA+D  + 
Sbjct: 876  CGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSHTA 935

Query: 607  SAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
            S I  N   G LM  +  T I ++H ++ T+R +E+V++L  DG V + G    LF   L
Sbjct: 936  SWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVIL-EDGRVKDQGDPLNLFDKGL 992

Query: 664  ---------------SELSQLLNEKSTINERNPNEKPAETPEQESQKNA 697
                           + ++ + N K+  N ++ +  P +  E+E + +A
Sbjct: 993  LGEDELVKSSILSRNASMATIGNAKNATNGKSASNGPNKKTEREERSDA 1041

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  160 bits (406), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 121/438 (27%), Positives = 210/438 (47%), Gaps = 31/438 (7%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L  +P +   ++ F R++   S+K  E T +  ++     +  + V+ +  +
Sbjct: 199 SWSLTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQ 258

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
             E K++  +I     +   + FI + LF + ++ G + FL +        +GS ++  G
Sbjct: 259 PLERKKFQRII-----LSCNTFFIKSCLF-VAANAGILRFLTLTMFVQGFWFGSTMIKQG 312

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG---K 422
            L+I D+        L GS +         + +G  A  ++  L +  P  +P       
Sbjct: 313 KLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELH 372

Query: 423 KYIP---GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
           +Y P      ++ F NVSF+YP+RP   + ++ + K   G    IVG SG GKST++SLL
Sbjct: 373 QY-PLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLL 431

Query: 480 LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
           LK+Y    G+I+++G++I  +  K L ++I +V+Q   L + ++R NI  G T  A   +
Sbjct: 432 LKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNAD 491

Query: 540 ---------IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPN 590
                    I+   +       I   PD  +T++G  G  LSGGQ+QR+A+ARA ++   
Sbjct: 492 YSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTP 551

Query: 591 VLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVV 650
           +L LDEA SALD+   + +        K K  T I + H L  +  S+  + L  +G V+
Sbjct: 552 ILFLDEAVSALDIIHRNLLMKAIRHWRKGK--TTIILTHELGQV-ESDDHLYLMQEGKVI 608

Query: 651 EIGKFKTLFGNPLSELSQ 668
           E G    L  +  S  S+
Sbjct: 609 ESGTQSELLADSTSTFSK 626

 Score =  157 bits (396), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 127/435 (29%), Positives = 216/435 (49%), Gaps = 22/435 (5%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   +   P +++ S  +G +++ +    + +  QL     +  + +KT++   AE  
Sbjct: 889  KLSLVCISMFPLIIIFSAIYGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFH 948

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
                Y+ +   +  +  + A       ++T+ +      ++  YG  LV+    +   + 
Sbjct: 949  FQLSYHKLKTKMEQIASKRAIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMF 1008

Query: 374  AYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD--RIPMISPTTGKKYIPGKGE- 430
                    T  +   L S   +I +G  AAS ++ + D  ++ +       + I   GE 
Sbjct: 1009 TTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGET 1068

Query: 431  ---------IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
                     +  +N++FAYP+ P   I+K++N  +  G  + IVG SG GKST+  LL +
Sbjct: 1069 YHEKQTTPMLSIQNLTFAYPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTR 1128

Query: 482  YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR 541
             Y    G+I +DG D++  N   LRR I +V+Q+P+L +G+IRDN+TYG   E    EI 
Sbjct: 1129 LYDCEVGSIKLDGTDVNDWNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIY 1188

Query: 542  RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSAL 601
               K    ++F+   P    T +  N  LLSGGQ QR+ IARAL++KP +LILDE TSAL
Sbjct: 1189 DALKYVGIYDFVASLPLGLGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSAL 1246

Query: 602  DVESESAINYTFGKLMKKKEVTIIS--IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            D  S   I     +++KK    +++  I H    +R  + + V   DG V+E G F TL+
Sbjct: 1247 DSMSSHVIK----EIVKKGPPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY 1301

Query: 660  GNPLSELSQLLNEKS 674
             N   E+ ++++EK+
Sbjct: 1302 NN-CGEMFRIVSEKN 1315

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  160 bits (404), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 140/491 (28%), Positives = 232/491 (47%), Gaps = 34/491 (6%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  +     FF+   VG +I+R  SD   V  ++    +  F+++L           IS 
Sbjct: 1036 KTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVIL---ISY 1092

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTVQAFV 309
             +  FL+     +++  +Y+       SR+L+     +T  +  +  E   G   + AF 
Sbjct: 1093 NMPWFLIV-NAVLLIIYIYYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAFK 1151

Query: 310  AEQR-EIKRYNNV---IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG 365
               R +   +NNV   I   +N    + +++ +L TI + +   + LL L   S +    
Sbjct: 1152 HFDRFDFINFNNVQFNINCSFNFRSTNRWLSVRLQTIGAFIVLATALLAL---STINSER 1208

Query: 366  GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP----MISPTTG 421
             LS G +   M Y     S++  +     +I   + +  R++E  +  P    +I     
Sbjct: 1209 RLSPGMVGLLMSYALQVTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRP 1268

Query: 422  KKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
            KK  P +GEI FKN S  Y T+ G    K +N  I+P   + +VG +G GKST++  L +
Sbjct: 1269 KKTWPSEGEIIFKNYSTKYKTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFR 1327

Query: 482  YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI-------TYGLTYE 534
              + T GTI +DG DISK+  K LR H+GI+ Q+     G++R N+       T  L   
Sbjct: 1328 LLEATEGTIEIDGLDISKMGLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWAS 1387

Query: 535  ATAEEIRRVTKQCFCHNFITKFPDQYQTIL----GPNGTLLSGGQKQRIAIARALLKKPN 590
                 ++    + F     ++ P   + +L      NG  LS GQ+Q + ++RALL    
Sbjct: 1388 IELSHLKPHIVEMFRKEDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSK 1447

Query: 591  VLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVV 650
            VL+LDEAT+A+D+E++  I  T    +K+K  TI++IAHR+ T+  S+ +IVL + G V 
Sbjct: 1448 VLVLDEATAAVDMETDKIIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-DAGQVK 1504

Query: 651  EIGKFKTLFGN 661
            E    + L  N
Sbjct: 1505 EFDTPENLLSN 1515

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 127/247 (51%), Gaps = 23/247 (9%)

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH--IGI 511
           F+ + G   CIVG  G GKST+   +L       G +      +  L  K L R   +  
Sbjct: 644 FQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAY 696

Query: 512 VQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLL 571
             QEP +M+ SI+DNIT+G  Y+ T        K C     +   P++  T++G  G  L
Sbjct: 697 CPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGISL 754

Query: 572 SGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKEVTIISI 627
           SGGQK RI++ARA+  + ++ +LD+  SA+D E S++ +     K   L++ K  T++  
Sbjct: 755 SGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNK--TVVLT 812

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL-SELSQLLNEKSTINERNPNEKPA 686
            + +S + RS+ + +L   GS+VE G F  +  +P  S+L ++++E       N N  P+
Sbjct: 813 TNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDEFGG----NMNYPPS 867

Query: 687 ETPEQES 693
           E+ +  S
Sbjct: 868 ESADNHS 874

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 120/435 (27%), Positives = 216/435 (49%), Gaps = 28/435 (6%)

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +LS   L   P ++  S  +G +++      + +   L     E  +G+KT+++  AE  
Sbjct: 861  KLSLVCLSMFPLIIAFSAVYGTMLQKYETTYKTSVAALENQEYEIMTGIKTIRSLQAESH 920

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS---IG 370
             IK Y+ +  ++  +  + +       ++T+ +      ++  YG  LV  G  S   + 
Sbjct: 921  FIKNYSGLEHNMRAIAHKRSIATGFGISVTNMITICIQSILYYYGIKLVFEGEYSSKKMF 980

Query: 371  DLTAYMMYTELTGSAVFGL----------SSFYSEIM-QGVGAASRLFELTDRIPMISPT 419
            +    +++T +T +++             ++F   I+ +G+ +    FE   +  +++P 
Sbjct: 981  ETFTLLLFTIMTCTSLVNQIPDISRGQRSATFLYRILDEGLASDESEFETHRKAEIVAPK 1040

Query: 420  TGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGS-NVCIVGPSGRGKSTIASL 478
               K  P    I+ +N++FAYP+     +++ LN ++      + +VG SG GKST+  L
Sbjct: 1041 QESKSNP---LIKIQNLTFAYPSETNVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYL 1097

Query: 479  LLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE 538
            L K Y+    +I +DG D++     +LR  I +V+Q+P L  G++R+N++YG++ +    
Sbjct: 1098 LTKLYQVAPHSIYLDGTDVNDWGLMNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDM 1157

Query: 539  EIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEAT 598
            E+  + K    + F+   P    T +  +  LLSGGQ QRI IARALL+KP +LILDE T
Sbjct: 1158 ELFDMLKYVGIYEFVESLPFGLDTRI--DTKLLSGGQAQRICIARALLRKPKILILDECT 1215

Query: 599  SALDVESESAINYTFGKLMKK--KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFK 656
            SALD  S + I      ++K     +  I I H    +R    + VL N G ++E G FK
Sbjct: 1216 SALDALSANII----IDIVKNGPPALLTIVITHSEKMMRACNTIAVLKN-GKIIEKGGFK 1270

Query: 657  TLFGNPLSELSQLLN 671
             L  N   EL ++++
Sbjct: 1271 ELV-NGNGELKKIID 1284

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 120/466 (25%), Positives = 221/466 (47%), Gaps = 38/466 (8%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L   P ++  +++F  +I   +      TG+  +++      ++ V+ +  +
Sbjct: 175 SWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQ 234

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
            RE++ +  +  +  ++     FI   L+ ++++   + FL +        +G+ +V  G
Sbjct: 235 FREVRNFRELTSNCNDL-----FIKCCLY-VSANTALLRFLSLSMFIQGFWFGATMVRKG 288

Query: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE-LTDRI------PMISP 418
            L I ++        + GS +         + +G  A  ++   L+  +      P+  P
Sbjct: 289 KLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFLSTSVDHGADEPIYEP 348

Query: 419 TTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASL 478
            T  +       I F N++F+YP+RP   + K+++   EP     I+G SG GKST+++L
Sbjct: 349 ETPAELCT----IAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNL 404

Query: 479 LLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT------ 532
           LLK+Y    GTITV G D+ ++N   L  ++ +V+Q   L + ++R+NI  G++      
Sbjct: 405 LLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLED 464

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
           +E+  ++++           +   P    TI+G  G  LSGGQ+QR+AIARA ++   +L
Sbjct: 465 HESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPIL 524

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
           ILDEA SALD+     +     +    K  T I + H LS I   +   V+  +G V E 
Sbjct: 525 ILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI-QEGEVKEN 581

Query: 653 GKFKTLFGNPLSELSQLLNEKSTINERN----PNEKPAETPEQESQ 694
           G  K L     S  + +LN ++  N R+     +    ETP +E+ 
Sbjct: 582 GYQKDLKQKKTSVFNHMLNLQT--NNRDSYAISDRTALETPIKENN 625

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 136/473 (28%), Positives = 224/473 (47%), Gaps = 13/473 (2%)

Query: 206  NNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFTPP 265
            NNK   L + L +D   +   +T+ +S     +L          +I  +LS   +   P 
Sbjct: 760  NNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPL 819

Query: 266  VMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDV 325
            V++ +  +G ++     + + +   L  +  E   G+KT+Q+   +Q   K++N  IK +
Sbjct: 820  VVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLL 879

Query: 326  YNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSA 385
               G   A        +T+ L  +   ++  YG  LVL G  +   L   +     T   
Sbjct: 880  EKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVT 939

Query: 386  VFGLSSFYSEIMQGVGAASRLFELT--DRIPMISP-----TTGKKYIPGKGEIEFKNVSF 438
            V  L +   +I +G  + S + ++   D    I P     TT   + P +  IE  N+SF
Sbjct: 940  VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSF 999

Query: 439  AYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDIS 498
             Y      +   ++N ++       IVG SG GKST+ +L+   Y  + G+I +   DI+
Sbjct: 1000 TYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDIN 1059

Query: 499  KLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPD 558
            K ++K L + + ++QQ P+L   +IR+N+ YGLT     E +  V +     +FI    +
Sbjct: 1060 KWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNN 1119

Query: 559  QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMK 618
               + L  + +LLSGGQ QR+ +AR +L+ P VLILDE TSALDV S   IN   G    
Sbjct: 1120 GLDSKL--DDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS-RS 1176

Query: 619  KKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671
               VTII ++H+  TI+  + +  L  DG+V  +G ++ L  N   E  +LLN
Sbjct: 1177 LAPVTII-VSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMENNW-EFRKLLN 1226

 Score =  147 bits (371), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 110/396 (27%), Positives = 180/396 (45%), Gaps = 17/396 (4%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +   TP +++ ++ F + I   + K    +             ++ V+    +
Sbjct: 172 SWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAWMLKNIEFVRLHNGD 231

Query: 312 QREIKRYNNVIKDV--YNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
             EI  Y + I     Y + K S FI+A +  +      M F+    +GS ++  G L+I
Sbjct: 232 DFEISMYTHYIAQANEYYI-KASLFISANISILRLLSLLM-FVQGFWFGSSMIKQGKLNI 289

Query: 370 GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP-----MISPTTGKKY 424
             +        + GS +         + +G  A  RL ++ DR P      I   +G   
Sbjct: 290 DSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDL 349

Query: 425 IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
           +P    I F NVSF YP R   ++F  +NF I+P     ++GPSG GKST+  L+L +Y 
Sbjct: 350 LP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYD 405

Query: 485 PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI--TYGLTYEATAEEIRR 542
              G+I +   DI  +N   +  +I +V Q P L + +IR+NI      T   +  E+  
Sbjct: 406 NYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMEC 465

Query: 543 VTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
           + K     N I + PD   T +G  G  LSGGQ Q++A+ARA  +  ++L+LDE  SA+D
Sbjct: 466 ICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVD 525

Query: 603 VESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSE 638
           +     +     +    K   II+  H L  IR ++
Sbjct: 526 MRQRIVLMENIKRWRNGKTTVIIT--HDLEFIRNTD 559

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 141/510 (27%), Positives = 245/510 (48%), Gaps = 73/510 (14%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            +++ K +H    F D+  +G +++R   D   V + +T  +   F  L+           
Sbjct: 1145 KLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTIILITF 1204

Query: 251  ISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKT 304
            I+P+      F    V++  +Y+  G    + SR+L+         + +   E  +GV T
Sbjct: 1205 ITPQ------FLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGVAT 1258

Query: 305  VQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAY 357
            ++AF  E R I         ++N+ K     N   F +  +   ++F       L++   
Sbjct: 1259 IRAFGDEIRFI---------MHNLEKIDE-NNKPFFYLWVANRWLAFRIDMIGALIIFGS 1308

Query: 358  GSYLVLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDR 412
            G +++L+      G++   LT  + +TE        L  FYS +   + +  RL E  D 
Sbjct: 1309 GVFILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMD- 1363

Query: 413  IPMISP------TTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVG 466
            +P   P      TT   + P +G+IE K++S  Y      ++ K ++F IEP + V IVG
Sbjct: 1364 VPQ-EPYNEGTITTSTNW-PTEGKIEVKDLSLRYAENL-PRVIKEVSFDIEPHNMVGIVG 1420

Query: 467  PSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDN 526
             +G GKSTI + L ++ +P  G+I +DG DI+ ++ ++LRR I I+ Q+P L +G+IR N
Sbjct: 1421 RTGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSN 1480

Query: 527  IT-YGLTYEATAEEIRRVTKQC-----------------FCHNFITKFPDQYQTILGPNG 568
            +  +G   +   EEI RV  +                     + + KF +    I    G
Sbjct: 1481 LDPFG---KYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLNLENEI-TEGG 1536

Query: 569  TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
              LS GQKQ + +ARALL+ P V++LDEAT+++D  S++ I  T   +  K   T+++IA
Sbjct: 1537 NNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIA 1594

Query: 629  HRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            HRL ++   + ++V+ + G V+E  +  TL
Sbjct: 1595 HRLRSVIDYDKILVM-DAGEVIEYDQPYTL 1623

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 131/269 (48%), Gaps = 23/269 (8%)

Query: 423 KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
           K  P   ++ F+N + A+         K L+   + G    ++GP+G GK+++   LL  
Sbjct: 705 KVAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGE 764

Query: 483 YKPTAGTITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
            +  +G I V   D +    ++S  +   I    Q   L++ ++R+NI +   Y    + 
Sbjct: 765 MQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNILFYSPY--NEDR 822

Query: 540 IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
            + V   C        F    QT +G  G  LSGGQKQRI++ARAL      L+LD+  S
Sbjct: 823 YKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLS 882

Query: 600 ALDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFK 656
           A+D  + + I  N   G LM+ +  T + ++H ++ T++ +E+V++L N G +       
Sbjct: 883 AVDSHTAAWIYDNCITGPLMEGR--TCVLVSHNIALTLKNAELVVMLEN-GRI------- 932

Query: 657 TLFGNPLSELSQ-LLNE----KSTINERN 680
           T  G+P+S L   +L E    KS+I  RN
Sbjct: 933 TNRGDPISLLKDGILGEDELVKSSILSRN 961

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  157 bits (397), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 144/499 (28%), Positives = 238/499 (47%), Gaps = 67/499 (13%)

Query: 197  IHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELS 256
            +H    FFD   VG +++R   D   V + +   +      L+           I+P   
Sbjct: 1083 LHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPR-- 1140

Query: 257  AFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTVQAFVA 310
                F T  V++  +YF  G+     SR+L+           + FS    GV T++AF  
Sbjct: 1141 ----FLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGD 1196

Query: 311  EQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLH-----G 365
            E+R I    N I D  N       +  K F+    +  +   +VLA GS+++L+      
Sbjct: 1197 ERRFILENMNKI-DQNNRAFFYLSVTVKWFSFRVDM--IGAFIVLASGSFILLNIANIDS 1253

Query: 366  GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD------------RI 413
            GL+   LT  +++T+        L   YS     + +  RL E +             RI
Sbjct: 1254 GLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLKEYSSIEQENYLGHDEGRI 1309

Query: 414  PMISPTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGK 472
             +++  +     P  GEIE +N+S  Y P  P   + ++++FK++P S + IVG +G GK
Sbjct: 1310 LLLNEPSW----PKDGEIEIENLSLRYAPNLP--PVIRNVSFKVDPQSKIGIVGRTGAGK 1363

Query: 473  STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
            STI + L +  +P  G I +DGQDISK++  +LRR I I+ Q+PIL +G+I+ N+     
Sbjct: 1364 STIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDE 1423

Query: 533  YEA-------------TAEEIRRV--TKQCF--CHNFITKFPDQYQTILGPNGTLLSGGQ 575
            Y+              ++ E   V  +++ F   HN   KF + +  I    G  LS G+
Sbjct: 1424 YDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHN---KFLNLHTEI-AEGGLNLSQGE 1479

Query: 576  KQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIR 635
            +Q + IAR+LL++P +++LDEATS++D +S+  I         K   TI++IAHRL ++ 
Sbjct: 1480 RQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKS--TILTIAHRLRSVI 1537

Query: 636  RSEIVIVLGNDGSVVEIGK 654
              + +IV+ + G V E  +
Sbjct: 1538 DYDRIIVM-DAGEVKEYDR 1555

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 119/437 (27%), Positives = 191/437 (43%), Gaps = 42/437 (9%)

Query: 283 KLQEATGQLT--RVSE--EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAK 338
           K Q+ T + T  R+S+  E    ++ V+ F  E+  I    N IK +      S    + 
Sbjct: 514 KFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNII----NEIKSIRQKELRSLLKKSL 569

Query: 339 LFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFG-----LSSFY 393
           ++++TS L  ++  LV   G    +   +   DL A + +T L+   +       LS+  
Sbjct: 570 VWSVTSFLWFVTPTLVT--GVTFAICTFVQHEDLNAPLAFTTLSLFTLLKTPLDQLSNML 627

Query: 394 SEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGS-QIFK-- 450
           S I Q   +  R+ +   R+            P K +IEFKN +  +         FK  
Sbjct: 628 SFINQSKVSLKRISDFL-RMDDTEKYNQLTISPDKNKIEFKNATLTWNENDSDMNAFKLC 686

Query: 451 SLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDG----QDISKLNSKSLR 506
            LN K + G    I+G +G GKS +   LL      +G+I V       D+   + + L 
Sbjct: 687 GLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIP-DCEGLT 745

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
                  Q   L++ ++++NI +   Y    +   +V   C     +   P    T +G 
Sbjct: 746 NSFAYCSQSAWLLNDTVKNNIIFDNFYNE--DRYNKVIDACGLKRDLEILPAGDLTEIGE 803

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTI 624
            G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  N   G LMK +  T 
Sbjct: 804 KGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGPLMKNR--TC 861

Query: 625 ISIAHRLS-TIRRSEIVIVL-----GNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINE 678
           I + H +S T+R +   IVL      N G++ E+   K LF     +LS     + +INE
Sbjct: 862 ILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQS-KGLFKEKYVQLSS----RDSINE 916

Query: 679 RNPNEKPAETPEQESQK 695
           +N N   A   + +SQK
Sbjct: 917 KNANRLKAPR-KNDSQK 932

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  154 bits (389), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 134/512 (26%), Positives = 241/512 (47%), Gaps = 57/512 (11%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            +++K +H    FFD+  +G +++R   D   V + +T      F +L+           I
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 252  SPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTV 305
            +P+      F    V+++ +Y+  G      SR+L+     +   + +   E   GV T+
Sbjct: 1242 TPQ------FLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTI 1295

Query: 306  QAFVAEQREIKRYNNVIKD----VYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL 361
            +AF  E R I+   + I +     + +   + ++  ++  I S       L+V   G ++
Sbjct: 1296 RAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMRIDLIGS-------LVVFGAGVFI 1348

Query: 362  VLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL--FELTDRIP 414
            +L+      G++   LT  + +TE        L   YS +   + +  RL  + + ++ P
Sbjct: 1349 LLNIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEP 1404

Query: 415  MISP-TTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGK 472
               P  T     P  G +E  +VS  Y   PG  ++ K+++F +EP S V +VG +G GK
Sbjct: 1405 YNQPIMTPPSDWPQHGRVEMSDVSLRYA--PGLPRVIKNVSFTVEPKSKVGVVGRTGAGK 1462

Query: 473  STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
            STI + L ++  P  G I +D  DIS ++ + LRR I I+ Q+P L +G+I+ N+     
Sbjct: 1463 STIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDE 1522

Query: 533  YE-------------ATAEEIRR--VTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQ 577
            Y               + EE+ R  +         + KF D    I    G  LS GQ+Q
Sbjct: 1523 YSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDLNSEI-NEGGGNLSQGQRQ 1581

Query: 578  RIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRS 637
             + +AR+LL+ P +++LDEAT+++D +S++ I  T  K  +    TI++IAHRL ++   
Sbjct: 1582 LVCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDY 1639

Query: 638  EIVIVLGNDGSVVEIGKFKTLFGNPLSELSQL 669
            + ++V+ + G V E     +L  N  S+   +
Sbjct: 1640 DKILVM-DQGEVKEYDHPYSLLLNKNSQFYSM 1670

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 136/282 (48%), Gaps = 13/282 (4%)

Query: 426  PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
            PG  ++ F+N + ++ +       ++LN   + G    ++GP+G GK++I   LL   K 
Sbjct: 741  PGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKL 800

Query: 486  TAGTITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
              G I V   D + +  +++  +   I    Q   L++ ++R+NI +   Y  +      
Sbjct: 801  LNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPY--SEARYND 858

Query: 543  VTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
            V + C              T +G  G  LSGGQKQRI++AR+L      L+LD+  SA+D
Sbjct: 859  VIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVD 918

Query: 603  VESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLF 659
              + S I  N   G LM+ +  T I I+H ++ T+R +E+V++L N G V E G   TL 
Sbjct: 919  SHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLEN-GQVKEQGDPLTLL 975

Query: 660  GNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANES 701
                    +L+  KS+I  RN +    +T    S +N A  S
Sbjct: 976  HKGHLGEDELV--KSSIMSRNNSSVNVKTKSSTSVQNLAKTS 1015

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 143/508 (28%), Positives = 241/508 (47%), Gaps = 48/508 (9%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  I     FF+   VG +I+R  SD   V  S+    S  FK++L             P
Sbjct: 1060 KSVIKSPMIFFETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMP 1119

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
                F +F     +    ++  L R+  R +  +   +  +  E  +G   + A+   +R
Sbjct: 1120 WFLVFNMFLLGIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFER 1179

Query: 314  EIK------RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA-YGSYLVLHGG 366
             I       +YN  I  V+N    + +++ +L TI +++   + +L LA   +   L  G
Sbjct: 1180 FIYLNYEKIQYN--IDFVFNFRSTNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSG 1237

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE---LTDRIPMISPTTG-K 422
            + +G L +Y +  E+TGS  + + +    I   + +  R+ E   L      I+P     
Sbjct: 1238 M-VGLLMSYSL--EVTGSLTWIVRT-TVMIETNIVSVERIVEYCELPSEAQSINPEKRPD 1293

Query: 423  KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
            K  P +G IEFK+ S  Y       + K +N KIEP   V IVG +G GKST++  L + 
Sbjct: 1294 KNWPSRGSIEFKDYSTKYRENLDP-VLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRI 1352

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             +PT G I +DG +IS L    LR H+ I+ Q+     G+++ N+     Y  + +E+++
Sbjct: 1353 LEPTEGKIIIDGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKK 1410

Query: 543  VTKQCFCHNFITKF--------------PDQYQTILGPNGTLLSGGQKQRIAIARALLKK 588
              +       + K                D     +  NG+ LS GQ+Q + +ARALL +
Sbjct: 1411 AVELAHLKPHLEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNR 1470

Query: 589  PNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGS 648
              +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL ++GS
Sbjct: 1471 SKILVLDEATASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGS 1527

Query: 649  VVEIGKFKTLFGNPLSELSQLLNEKSTI 676
            V E       F +P    S+LL+ K++I
Sbjct: 1528 VKE-------FDSP----SKLLSNKASI 1544

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 114/461 (24%), Positives = 212/461 (45%), Gaps = 63/461 (13%)

Query: 297 EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV-- 354
           E  + +K+++ +  E+  +KR N+V  D+          N +   I S+L   ++  V  
Sbjct: 477 ELLNAIKSIKLYAWEEPMMKRLNHVRNDM-------ELKNFRKIGIVSNLIYFAWNCVPL 529

Query: 355 LAYGSYLVLHGGLSIGDLTAYMMYTELT-----GSAVFGLSSFYSEIMQGVGAASRL--F 407
           +   S   L    +   L+  +++  L+      SA++ + S  + I++   +  RL  F
Sbjct: 530 MVACSTFGLFSLFNDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMKRLKSF 589

Query: 408 ELTDRI-----PMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG----------------- 445
            L+D I       I P+  ++ +P    IE  N++F + ++                   
Sbjct: 590 LLSDEIDDSFIERIDPSVDERTLPV---IEMNNITFLWKSKEALASSQLENNSRADEESA 646

Query: 446 ---SQI-FKSLN-FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKL 500
              SQI  K+++ F+ + G+ VCIVG  G GKST       + K   G +         +
Sbjct: 647 MGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKST-------FLKAILGQLPCMSGSKESI 699

Query: 501 NSKSLRRH--IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPD 558
             K + R   +    QE  +M+ S+++NI +G  ++    ++    K C     +   PD
Sbjct: 700 PPKLIIRSSSLAYCSQESWIMNASVKENILFGHKFDKAYYDL--TIKACQLLPDLRILPD 757

Query: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTF-GKL 616
             +T++G  G  LSGGQK R+++ARA+  + ++ +LD+  SA+D E S++ I Y   GK 
Sbjct: 758 GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKK 817

Query: 617 MKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG--NPLSELSQLLNE-K 673
              K  TII   + +S ++ S+++  L N G +VE G + ++    N  S+L +LL E  
Sbjct: 818 ALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYDSVMNRENSTSKLKKLLEEFD 876

Query: 674 STINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQN 714
           S I++ N N+       +          +V+   E+E++ +
Sbjct: 877 SPIDKGNENDTHTGHRSESDIDEPLQLKVVESETEDEVITD 917

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 118/397 (29%), Positives = 195/397 (49%), Gaps = 20/397 (5%)

Query: 273  FGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKES 332
            +G +++      + A  +L     E   G+KTV+    E     +Y  + + + +  +  
Sbjct: 912  YGGVLQKYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRR 971

Query: 333  AFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT---AYMMYTELTGSAV-FG 388
            A +      ++++L      ++  YG  LV+ G  +  +L      +++T +T SA+ + 
Sbjct: 972  AVVTGFGVALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYE 1031

Query: 389  LSSFYSEIMQGVGAASRLFE-LTDRIPMISPTTGKKYIPGKGE------IEFKNVSFAYP 441
            + SF     +G  AA+ +F  L  R   +S     +  P +        I  ++++FAYP
Sbjct: 1032 VPSF----SRGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYP 1087

Query: 442  TRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLN 501
            +    +++K L+  I  G N+ IVG SG GKST+  +L   Y     T+ +D  DI K N
Sbjct: 1088 SALDVEVYKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWN 1147

Query: 502  SKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQ 561
              SLR+HI +V+Q+     GSIRDN+ YGL    T  +I  V       +F+ + P    
Sbjct: 1148 LSSLRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLN 1207

Query: 562  TILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKE 621
            T +  N  L+SGGQ QRI+I RALL++P +LILDE TS+LD ++  AI    G  +    
Sbjct: 1208 TRIDTN--LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG-- 1263

Query: 622  VTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            +T I I H    ++    ++   N G + E G F+ L
Sbjct: 1264 ITTIVITHNTQMMKSCNRILFFKN-GRISEEGTFQEL 1299

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 119/446 (26%), Positives = 197/446 (44%), Gaps = 40/446 (8%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
           S  L+  +L  TP ++  ++ F +L+   +      T     +        + ++ F  E
Sbjct: 175 SWSLTLVILASTPLIIALAIIFSKLVEKYTELENTETSHAASILTWSMEAPQLIRLFGTE 234

Query: 312 QREIKRYNNVIKDV----YNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGL 367
           Q E+++++  +K       N+ K +A   A L      L  + F+    +G+ ++  G L
Sbjct: 235 QVELQKFSISVKKCSKFFINLSKYAAANQASL----RGLSLIMFVQGFWFGNTMIKRGKL 290

Query: 368 SIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDR--------------- 412
           + G +        L G+ +         + +G  A  ++  + +                
Sbjct: 291 NSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMVESESDALRGRRGETFEI 350

Query: 413 IPMISPTTGKKYIP-GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
            P  SP +G    P    +I F+NVSF+YP+RP      +++    P     IVG SG G
Sbjct: 351 FP--SPISGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSG 408

Query: 472 KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGL 531
           KST+++LLLK Y    GTI V   DI       L  +I +V+Q   L + S+ +N+    
Sbjct: 409 KSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLFNDSLLNNLLLTA 468

Query: 532 TYEATAE-EIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPN 590
             +   E  I+R  +       +   PD   T++G NG  LSGGQ+QR+A+ARA+L+   
Sbjct: 469 KDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTP 528

Query: 591 VLILDEATSALDVESESAI-----NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
           VLILDE+ SALD+     +     N+  GK       T I + H LS I   + + ++  
Sbjct: 529 VLILDESISALDIIHRDLLMEVIRNWRAGK-------TTIILTHELSHILDDDYLYLM-E 580

Query: 646 DGSVVEIGKFKTLFGNPLSELSQLLN 671
           DG V E G  + L        ++L N
Sbjct: 581 DGKVGEHGYKRDLLSYTSGRFTELHN 606

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 229/501 (45%), Gaps = 50/501 (9%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++KK ++    FFD+   G +++R   D   +   +       F +L+           I
Sbjct: 1163 LLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYI 1222

Query: 252  SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTVQA 307
            +P      LFF   + +S    G      SR+LQ           + FS    GV T++A
Sbjct: 1223 TP----VFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRA 1278

Query: 308  FVAEQREIKRYNNVIK-DVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLH-- 364
            F  E+R +   +N+ K D +N      ++  +          +   ++LA G +++L+  
Sbjct: 1279 FGDERRFLA--DNLSKVDTHNRPFFYLWVTNRWLAFRIDF--IGAFVILASGIFILLNVN 1334

Query: 365  ---GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG 421
                GL+   L   + +TE        L   YS +   + +  RL E   +I    P+TG
Sbjct: 1335 SLDAGLAGISLIYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYM-KIEQ-EPSTG 1388

Query: 422  ----KKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
                    P +G+IE  N+S  Y +    ++ K++ F +EP S V IVG +G GKSTI +
Sbjct: 1389 LYEPPPEWPDRGKIEVNNLSLRYASNL-PKVIKNVTFTVEPQSKVGIVGRTGAGKSTIIT 1447

Query: 478  LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY--EA 535
             L ++  P  GTI +D  DI+ +  K LR+ I I+ Q+P+L +G+I+ N+     Y  + 
Sbjct: 1448 ALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDR 1507

Query: 536  TAEEIRRVT---------------KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIA 580
              E ++RV                        + KF D    I    G+ LS GQ+Q + 
Sbjct: 1508 IFEALKRVNLIVQEELTPTDIPSSSSSLSFENVNKFLDLTSEI-TEGGSNLSQGQRQLVC 1566

Query: 581  IARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIV 640
            +AR+LL+ P  ++LDEAT+++D  S++ I  T  +       TI++IAHRL +I   + V
Sbjct: 1567 LARSLLRNPKAILLDEATASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKV 1624

Query: 641  IVLGNDGSVVEIGKFKTLFGN 661
            +V+ + G + E     TL  N
Sbjct: 1625 LVI-DSGELAEYDHPYTLLLN 1644

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 134/287 (46%), Gaps = 16/287 (5%)

Query: 428 KGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
           K  + F N +  +     +    K+LN   + G    IVGP+G GK+++   LL     +
Sbjct: 708 KDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLS 767

Query: 487 AGTITVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRV 543
            G I V   +  +   +++  +   IG   Q   L++ ++R+NI +   YEA       V
Sbjct: 768 EGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNNILFSAPYEAN--RYNAV 825

Query: 544 TKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
              C     +       QT +G  G  LSGGQKQR+++ARA+  +   ++LD+  SA+D 
Sbjct: 826 IHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDS 885

Query: 604 ESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGN-----DGSVVEIGKF 655
            +   I  +   G LM+ +  T + ++H  + T++ ++ V++L N      G  +E+   
Sbjct: 886 HTAQWIYKHCITGPLMEGR--TCVLVSHNTALTLKNADWVVILENAKVTAQGEPLELFNR 943

Query: 656 KTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESI 702
             L  + L + S +  + S++N +  ++  ++    +  K  + E I
Sbjct: 944 GLLGEDDLLKSSLMSTKTSSVNLKRMDDNRSDLDLGKLHKKISKEGI 990

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 140/518 (27%), Positives = 242/518 (46%), Gaps = 71/518 (13%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++KK +H    FFD+  +G +++R   D   + + +   V   F +L+           I
Sbjct: 1145 LLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFI 1204

Query: 252  SPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTV 305
            +P+      F +  ++++ +Y+  G      SR+ +           + FS    GV T+
Sbjct: 1205 TPQ------FLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETLVGVTTI 1258

Query: 306  QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAYG 358
            +AF  E R ++   N+ K   N        N   F +  +   +SF       L+V   G
Sbjct: 1259 RAFGDEGRFMQE--NLSKIDEN--------NRPFFYLWVANRWLSFRIDMVGALVVFGSG 1308

Query: 359  SYLV-----LHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT--D 411
            S+++     +  G++   LT  + +TE        L   YS +   + +  RL E    +
Sbjct: 1309 SFIIWNIKNIDAGMAGISLTYAISFTE----GALWLVRLYSNVEMNMNSVERLKEYMKIE 1364

Query: 412  RIPMISPT-TGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGR 470
            + P    T T     P +G+IE  ++S  Y      ++ K++ F + P + + IVG +G 
Sbjct: 1365 QEPYEDATCTPPPEWPQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGA 1423

Query: 471  GKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-Y 529
            GKSTI + L ++  P  G I +D  DI+ +N   LRR I I+ Q+P L +G+I+ N+  Y
Sbjct: 1424 GKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPY 1483

Query: 530  G-LTYEATAEEIRRV------------TKQCFCHNFITKFPDQYQTILGPNGTLLSGGQK 576
            G  + E     +RRV            T+     N + KF +    I    G+ LS GQ+
Sbjct: 1484 GEYSDEDMFTALRRVNLVPEDVSSNIETESISSQN-VNKFLNLNNEI-SEGGSNLSQGQR 1541

Query: 577  QRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRR 636
            Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K       TI++IAHRL ++  
Sbjct: 1542 QLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEFNSS--TILTIAHRLRSVID 1599

Query: 637  SEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
             + ++V+ + G V E       + +P    S LLN+KS
Sbjct: 1600 YDKILVM-DAGEVKE-------YDHP---YSLLLNKKS 1626

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 137/288 (47%), Gaps = 32/288 (11%)

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           P   ++EFKN + ++ +       K LN   + G    ++GP+G GK+++   LL   K 
Sbjct: 704 PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKI 763

Query: 486 TAGTITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             G I V   D ++   ++       I    Q   L++ ++R+NI +   Y         
Sbjct: 764 MEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEA--RYTS 821

Query: 543 VTKQC-FCHNF-ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
           V + C    +F I K  D   T +G  G  LSGGQKQR+++ARA+      ++LD+  SA
Sbjct: 822 VIEACGLKRDFEILKAGDM--TEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSA 879

Query: 601 LDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKT 657
           +D  +   I  N   G LM  +  T I ++H ++ T++ +++V++L       E GK K 
Sbjct: 880 VDSHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVIL-------EDGKVKD 930

Query: 658 LFGNPLSELSQ-LLNE----KSTINER-----NPNEKPAETPEQESQK 695
             G+P+  L + LL E    KS+I  R     N N + + T  Q S+ 
Sbjct: 931 Q-GDPMELLQKGLLGEDELVKSSILSRHASSVNLNSQKSTTTLQASKH 977

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 128/497 (25%), Positives = 230/497 (46%), Gaps = 68/497 (13%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            +++ K +H    FFD+  +G +++R   D   + + +       F + +           
Sbjct: 1133 KLLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITF 1192

Query: 251  ISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKT 304
            I+P+      F +  +++  +Y+  G      SR+L+           + FS    GV T
Sbjct: 1193 ITPQ------FLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTT 1246

Query: 305  VQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAY 357
            ++AF  E R ++   N++K   N        N   F +  +   +SF       L+V   
Sbjct: 1247 IRAFGDESRFLRE--NLLKIDEN--------NRPFFYLWVANRWLSFRIDVIGALVVFGS 1296

Query: 358  GSYLV-----LHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT-- 410
            G +++     +  G++   LT  + +TE        L  FYSE+   + +  R+ E    
Sbjct: 1297 GIFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTI 1352

Query: 411  -----DRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIV 465
                 D +  +S +      P +G IE  ++S  Y      ++ K++ F ++P + V +V
Sbjct: 1353 EQEPYDEV-QVSDSKVPADWPEEGRIEVSDLSLRYAAHL-PKVIKNVTFNVDPRAKVGVV 1410

Query: 466  GPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRD 525
            G +G GKSTI + L ++ +   G I +DG DI+ +N   LRR I I+ Q+P L SG+I+ 
Sbjct: 1411 GRTGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKS 1470

Query: 526  NITYGLTY--EATAEEIRRVT----------------KQCFCHNFITKFPDQYQTILGPN 567
            N+     Y  E   E +RRV                 +       I +F D  ++ +   
Sbjct: 1471 NLDPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIAEG 1529

Query: 568  GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
            GT  S GQ+Q I +AR+LL+ P +L+LDEAT+++D +S++ +  T     +  E TI++I
Sbjct: 1530 GTNFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTI 1587

Query: 628  AHRLSTIRRSEIVIVLG 644
            AHRL ++   + ++V+G
Sbjct: 1588 AHRLRSVIDYDKILVMG 1604

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 128/279 (45%), Gaps = 18/279 (6%)

Query: 427 GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            K +I FKN + A+     S   ++LN   + G    I+GP+G GK+++   LL      
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLL 756

Query: 487 AGTITVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRV 543
            G I V   +      + S      I    Q   L++ ++R+NI +   Y  T      V
Sbjct: 757 EGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYHNV 814

Query: 544 TKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
            + C              T +G  G  LSGGQKQRI++ARAL      ++LD+  SA+D 
Sbjct: 815 VEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDA 874

Query: 604 ESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLFG 660
            +   +  N   G LM+ +  T I ++H ++ T+R +++V++L  DG V + G   TL  
Sbjct: 875 HTALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVML-EDGQVKDQGTPMTLLE 931

Query: 661 NPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAAN 699
             L    +L+  KSTI  R     PA +    + ++  N
Sbjct: 932 KGLLGEDELV--KSTIMSR-----PASSANIANNRSTVN 963

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 228/502 (45%), Gaps = 43/502 (8%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  +D Y +   + +  S  F+  +          S + +     +F 
Sbjct: 1034 FFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVVICSTTWQF----IFL 1089

Query: 263  TPPVMLSSMYFGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTVQAFVAEQREIK-- 316
              P+    +Y+ +     SR+L+         L    +E   GV T++ F  + R I   
Sbjct: 1090 IIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHIN 1149

Query: 317  --RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTA 374
              R ++ +   Y     + ++  +L      LG +  L       + + +G L+ G +  
Sbjct: 1150 QSRVDSNMMAYYPSINSNRWLAFRL----EFLGSLIILGAATLSIFRLKNGSLTAGMIGL 1205

Query: 375  YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE---LTDRIPMISPTTG-KKYIPGKGE 430
             M Y      ++  +     ++   + +  R+ E   L    P+I       +  P KG 
Sbjct: 1206 SMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEEWPSKGA 1265

Query: 431  IEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
            IEFKN S  Y  RP    + K++N KI P   V IVG +G GKS++   L +  + ++G+
Sbjct: 1266 IEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGS 1323

Query: 490  ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFC 549
            I +DG +I++L    LR  + I+ Q+  +  GSIR+NI    T + + +EI    +    
Sbjct: 1324 IEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNALEMAHL 1381

Query: 550  HNFITKF---------PDQYQTI------LGPNGTLLSGGQKQRIAIARALLKKPNVLIL 594
               I K           D  Q+       +   G+ LS GQ+Q I +ARALL   NVLIL
Sbjct: 1382 KPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLIL 1441

Query: 595  DEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGK 654
            DEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ +IVL N G V E  K
Sbjct: 1442 DEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDK 1498

Query: 655  FKTLFGNPLSELSQLLNEKSTI 676
             + L  N  S    L  E   +
Sbjct: 1499 PEILLTNKNSLFYSLCYESGVL 1520

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 152/324 (46%), Gaps = 26/324 (8%)

Query: 424 YIPGKGEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
           ++   GE   K   N +F +  +P  ++  K++NF+   G   CIVG  G GKS     +
Sbjct: 605 FVKQNGETTVKIGDNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSI 664

Query: 480 LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
           L       G  ++ G             ++  V Q   +M+G+++DNI +G  Y+   E 
Sbjct: 665 LGDLFRVKGFASIHG-------------NVAYVSQLAWIMNGTVKDNIIFGHRYDP--EF 709

Query: 540 IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
             +  K C     ++  PD  QT++G  G  LSGGQK R+++ARA+  + ++ +LD+  +
Sbjct: 710 YEKTIKACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLA 769

Query: 600 ALDVE-SESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
           A+D   S+  I    G     K  T I   +++  +  ++ + +L N G + E G +  +
Sbjct: 770 AVDEHVSKHLIQNVLGAKGLLKSKTRILTTNKIPVLSIADSITLLEN-GEITEQGTYFDV 828

Query: 659 FGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQ----N 714
                S LS+L+ E     + + +E   +    ES +++ N  +  V +E+E+ +    N
Sbjct: 829 MATEGSSLSKLITEYGKKKDSSESEAAKDNVNSESDESSVNRELT-VPIEDELRELDKLN 887

Query: 715 DIRSQDEKDILDKQPFPDKSSINL 738
           D++  DE   L +  F    S++ 
Sbjct: 888 DLKFIDEGKSLRRASFDTLGSMDF 911

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  148 bits (373), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 224/488 (45%), Gaps = 55/488 (11%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++   +H    FFD   +G +++R   D   V + +T  +   F  L+           I
Sbjct: 1164 LLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTMLLIAFI 1223

Query: 252  SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
            +P+     +F      L   ++    R+  R        + +   E   G+ T++A+  E
Sbjct: 1224 TPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTIRAYGDE 1283

Query: 312  QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAYGSYLVLH 364
            +R +      +++++ + +     N   F + +    +SF       L+V   G +++L+
Sbjct: 1284 KRFM------LENLHKIDEN----NKPFFYLWAFNRWLSFRIDMIGSLVVFGAGVFIILN 1333

Query: 365  -----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT--DRIPM-- 415
                  GL+   LT  + +TE    A   L  FY+++   + +  RL E    D+ P   
Sbjct: 1334 IDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEPYEE 1389

Query: 416  ---ISPTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
                S        P  G+IE  N+S  Y P  P  ++ K++ F +EP   V +VG +G G
Sbjct: 1390 HLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTGAG 1447

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-YG 530
            KSTI + L ++     G I +D  DI+ +N   LRR I I+ Q+P L SG+IR N+  Y 
Sbjct: 1448 KSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDPYN 1507

Query: 531  -LTYEATAEEIRRVT--------------KQCFCHNFITKFPDQYQTILGPNGTLLSGGQ 575
              + +A  + +RRV                       + KF +    I    G  LS GQ
Sbjct: 1508 EFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNEI-TEGGNNLSHGQ 1566

Query: 576  KQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIR 635
            +Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K  + KE TI++IAHRL ++ 
Sbjct: 1567 RQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRSVC 1624

Query: 636  RSEIVIVL 643
              + ++V+
Sbjct: 1625 DYDKILVM 1632

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 92/311 (29%), Positives = 146/311 (46%), Gaps = 31/311 (9%)

Query: 429  GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
              I F+N + A+  +      + LN   +PG    ++GP+G GKS++   LL       G
Sbjct: 729  NRIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENG 788

Query: 489  TITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY-EATAEEIRRVT 544
             I V   D +D   ++   +   I    Q   L++ ++R+NI +   Y EA    +  V 
Sbjct: 789  NIIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYNAV--VE 846

Query: 545  KQCFCHNF-ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
              C   +F I K  D   T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D 
Sbjct: 847  ACCLKRDFEILKAGDM--TEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDS 904

Query: 604  ESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLFG 660
             +   I  N   G LM+ +  T I ++H ++ T+R +E+V++L  DG V + G   T+  
Sbjct: 905  HTALWIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVIL-EDGRVKDQGDPVTILQ 961

Query: 661  NPLSELSQLLNEKSTINER-------------NPNEKPAETPEQESQKNAANESIVDVVL 707
              L    +L+  KS+I  R             N  E    T ++E   N AN +    ++
Sbjct: 962  KGLLGDDELV--KSSILSRTNSSVNLSSNSAINLAEADKVTAKKEDGDNTANLA-AGRLI 1018

Query: 708  EEEILQNDIRS 718
            EEE   N + S
Sbjct: 1019 EEETKANGVVS 1029

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 143/522 (27%), Positives = 244/522 (46%), Gaps = 73/522 (13%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            S ++ K +H +  FFD+  +G +++R   D   V + +   +      ++          
Sbjct: 1142 SLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLIT 1201

Query: 250  SISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVK 303
             I+PE      F    ++++ +Y+  G L    SR+L+           + FS    GV 
Sbjct: 1202 YITPE------FLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLVGVT 1255

Query: 304  TVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLA 356
            TV+A+  E R ++    +I +           N   F +  S   ++F       L++  
Sbjct: 1256 TVRAYGDEARFMRENLKMIDEN----------NKPFFYLWVSNRWLAFRIDVVGALVIFG 1305

Query: 357  YGSYLVLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL-- 409
             G +++L+      GL+   L+  + +TE   SA++ L   YS +   + +  RL E   
Sbjct: 1306 SGVFVLLNIDKIDSGLAGISLSFAISFTE---SALW-LVRHYSNLEMNMNSVERLMEYME 1361

Query: 410  TDRIPMISPTTG-KKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGP 467
             ++ P  S +       P +G+IE  +VS  Y P  P  ++ K+  F ++P   V IVG 
Sbjct: 1362 VEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGR 1419

Query: 468  SGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI 527
            +G GKSTI + L ++  P  G+I +D  DIS +  K LRR I I+ Q+P L SG+I+ N+
Sbjct: 1420 TGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNL 1479

Query: 528  TYGLTY--EATAEEIRRVT-------------KQCFCHNFITKFPDQYQTILGPNGTLLS 572
                 Y  +   E ++RV              +Q        KF +    I    G+ LS
Sbjct: 1480 DPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNVNNEI-SEGGSNLS 1538

Query: 573  GGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLS 632
             GQ+Q + +AR+LL+ P V++LDEAT+++D  S++ I  T     +  + TI++IAHRL 
Sbjct: 1539 QGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLR 1596

Query: 633  TIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
            T+   + ++V+ + G V E       F +P    S LLN+ S
Sbjct: 1597 TVIDYDKILVM-DAGEVKE-------FDHP---YSLLLNKNS 1627

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 115/237 (48%), Gaps = 11/237 (4%)

Query: 428 KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTA 487
           + +I FKN +  +         ++++   + G    I+GP+G GK+++   LL       
Sbjct: 700 QNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLID 759

Query: 488 GTITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
           G I V   D ++  KL++  L   I    Q   L++ ++R+NI +   Y    E    V 
Sbjct: 760 GEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFNSPY--CEERYNAVV 817

Query: 545 KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
           +                T +G  G  LSGGQKQR+++ARAL      L+LD+  SA+D  
Sbjct: 818 EASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSH 877

Query: 605 SESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTL 658
           + + I  N   G LM+ +  T I ++H ++ T+R ++ V+ L N G +VE G+  TL
Sbjct: 878 TATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLEN-GKIVEHGEPLTL 931

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 128/493 (25%), Positives = 239/493 (48%), Gaps = 56/493 (11%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++ +T+H    FFD   +G +++R   D   V + +T  +   F  L+           I
Sbjct: 1145 LLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFI 1204

Query: 252  SPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTV 305
            +P+      F +  +++  +Y+  G      SR+L+     +   + +   E   GV T+
Sbjct: 1205 TPQ------FLSVAILVGCLYYLVGYFYMAASRELKRFESISKSPIYQHFSETLVGVATI 1258

Query: 306  QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG 365
            +A+  E R +      +++++ + +     N   F +      +SF + +  G++++   
Sbjct: 1259 RAYGDESRFM------LENLHKIDEN----NKPFFYLWVFNRWLSFRIDMI-GAFVIFGA 1307

Query: 366  GL----SIGDLTAYMMYTELTGSAVF-----GLSSFYSEIMQGVGAASRLFELTD--RIP 414
            G+    +I ++ + M    LT +  F      L  FY+++   + +  RL E  +  + P
Sbjct: 1308 GVFILTNIKNIDSGMAGISLTYAISFTEGALWLVRFYADVEMNMNSVERLKEYMEIEQEP 1367

Query: 415  M--ISPTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
                  T      P  G+IE K++S  Y P  P  ++ K+++F +EP + + IVG +G G
Sbjct: 1368 YDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAG 1425

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI---- 527
            KSTI + + ++  P +G I +D  +I+ +N   LRR I I+ Q+P L +G+I+ N+    
Sbjct: 1426 KSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYN 1485

Query: 528  --TYGLTYEA-------TAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQR 578
              T    +EA       T EE++    Q        KF +    I    G+ LS GQ+Q 
Sbjct: 1486 EFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLNLENEI-TEGGSNLSHGQRQL 1544

Query: 579  IAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSE 638
            + +AR+LL+ P +++LDEAT+++D  S++ I  T  K   +   TI++IAHRL ++   +
Sbjct: 1545 VCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQS--TILTIAHRLRSVIDYD 1602

Query: 639  IVIVLGNDGSVVE 651
             +IV+ + G V E
Sbjct: 1603 KIIVM-DAGEVKE 1614

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 135/296 (45%), Gaps = 28/296 (9%)

Query: 429 GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
             I FKNV+  +         + LN + +PG+   ++GP+G GK+++   LL       G
Sbjct: 709 NRIAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKG 768

Query: 489 TITVDG----QDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
            I V      QD+  ++   L   I    Q   L++ ++R+NI +   Y    E    V 
Sbjct: 769 EIIVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPY--NEERYNAVI 825

Query: 545 KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
             C     +        T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D  
Sbjct: 826 DACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSH 885

Query: 605 SESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
           +   I  N   G LM  +  T I ++H ++ T++ +E+V++L N       G+ K   G 
Sbjct: 886 TALWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILEN-------GRVKDQ-GT 935

Query: 662 PLSELSQ-LLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDI 716
           PL  L++ LL +   I       K        S  N A  S  ++V  +++ +NDI
Sbjct: 936 PLVLLNKGLLGDDDLI-------KSNILSRTNSSVNVATPSSTNLVTSQQLQKNDI 984

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 140/512 (27%), Positives = 239/512 (46%), Gaps = 52/512 (10%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  I     FF+   VG +I+R  SD   V  S+    S  FK++L             P
Sbjct: 1060 KSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMP 1119

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
                F +F     +    ++  L R+  R +  +   +  +  E  +G   + A+   +R
Sbjct: 1120 WFFVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFER 1179

Query: 314  EIK------RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA-YGSYLVLHGG 366
             I       +YN  I  V+N    + +++ +L TI +++   + +L L    +   L  G
Sbjct: 1180 FIYLNYEKIQYN--IDFVFNFRSTNRWLSVRLQTIGATIVLATAMLALTTMNTKKQLSSG 1237

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE---LTDRIPMISPTTG-K 422
            + +G L +Y +  E+TGS  + + +    I   + +  R+ E   L      I+P     
Sbjct: 1238 M-VGLLMSYSL--EVTGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEARSINPENRPD 1293

Query: 423  KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
            +  P KG IEFKN S  Y       + K +N +I+P   + IVG +G GKST++  L + 
Sbjct: 1294 ESWPSKGSIEFKNYSTKYRENL-DPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRI 1352

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             +PT G+I +D  +IS L    LR H+ I+ Q+     G++R N+     Y  +  E+++
Sbjct: 1353 LEPTEGSIVIDDINISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRY--SEGELKK 1410

Query: 543  VTKQCFCHNFITKFPDQ------------------YQTILGPNGTLLSGGQKQRIAIARA 584
                      + K  D                       +  NGT LS GQ+Q + +ARA
Sbjct: 1411 AVDLAHLGPHLEKMLDNEIRGADGAAEENGNVSDVLNVKINENGTNLSVGQRQLLCLARA 1470

Query: 585  LLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG 644
            LL +  +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL 
Sbjct: 1471 LLNRSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL- 1527

Query: 645  NDGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
            ++G+V E       F +P    S+LL++K++I
Sbjct: 1528 DEGTVKE-------FDSP----SKLLSDKASI 1548

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 117/490 (23%), Positives = 221/490 (45%), Gaps = 73/490 (14%)

Query: 272 YFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKE 331
           Y  R ++  S+   +      +   E  + +K+++ +  E+  ++R N+V  D+      
Sbjct: 452 YLSRKVKKLSKTQMKYKDLRIKTITEILNAIKSIKLYAWEEPMMERLNHVRNDM------ 505

Query: 332 SAFINAKLFTITSSLGDMSFLLV--LAYGSYLVLHGGLSIGDLTAYMMYTELT-----GS 384
               N +   I S+L   ++  V  +   S   L    S   L+  +++  L+      S
Sbjct: 506 -ELQNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDTPLSPAIVFPSLSLFNILNS 564

Query: 385 AVFGLSSFYSEIMQGVGAASRL--FELTDRI-----PMISPTTGKKYIPGKGEIEFKNVS 437
           A++ + S  + I++   +  RL  F L+D I       I P+  ++ +P    IE  N++
Sbjct: 565 AIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIEMNNIT 621

Query: 438 FAYPTRPG--------------------SQI-FKSLN-FKIEPGSNVCIVGPSGRGKSTI 475
           F + ++                      SQI  K+++ F+ + G  VC+VG  G GKST 
Sbjct: 622 FLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTF 681

Query: 476 ASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEA 535
              +L      +G+    G    KL  ++    +    QE  +M+ S+R+NI +G  ++ 
Sbjct: 682 LKGILGQLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFGHKFDK 736

Query: 536 TAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILD 595
              ++    K C     +   PD  +T++G  G  LSGGQK R+++ARA+  + ++ +LD
Sbjct: 737 AYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLD 794

Query: 596 EATSALDVE-SESAINYTF-GKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIG 653
           +  SA+D E S++ + Y   GK    K  TII   + +  ++ S+++  L N G ++E G
Sbjct: 795 DVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYALEN-GEIIEQG 853

Query: 654 KFKTLFG--NPLSELSQLLNE---------KSTINERNPNEKPAETP------EQESQKN 696
            ++ +    N  S+L +LL E         KS I   + +E   + P      E E++  
Sbjct: 854 NYEGVMNRENTNSKLKKLLEEFDSPIDNGSKSDIQTEHRSESDMDEPLQLKVVESETEDE 913

Query: 697 AANESIVDVV 706
            A E  ++++
Sbjct: 914 IATEGELELI 923

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 132/500 (26%), Positives = 236/500 (47%), Gaps = 66/500 (13%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++KK ++    FFD+  +G +++R   D   V + +T  V   F +L+           I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 252  SPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTV 305
            +P+      FF   + +   Y+  G      SR+L+           + FS    G+ T+
Sbjct: 1193 TPD------FFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTI 1246

Query: 306  QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAYG 358
            +AF  E+R ++   N+ K   N        N   F +  +   ++F        ++ A G
Sbjct: 1247 RAFGDERRFMQE--NLTKIDEN--------NKPFFYLWVANRWLAFRIDMIGACVIFAAG 1296

Query: 359  SYLVLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL--TD 411
             +++L+      GL+   LT  + +TE        L   YS +   + +  RL E    +
Sbjct: 1297 IFVLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVE 1352

Query: 412  RIPMISPTTGKK-YIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSG 469
            + P    T       P +G+IE  ++S  Y P+ P  ++ K++ F ++P   V IVG +G
Sbjct: 1353 QEPHYQSTHNPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTG 1410

Query: 470  RGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITY 529
             GKSTI + L ++  P +G I +D  DI+ +  K LR+ I I+ Q+P L +G+++ N+  
Sbjct: 1411 AGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDP 1470

Query: 530  GLTY--EATAEEIRR---VTKQCFCHNFITKFPDQYQTI-------------LGPNGTLL 571
               Y  +   E ++R   VT++   H      PD    +             +   G+ L
Sbjct: 1471 YDEYSDKQIFEALKRVNLVTQEELDHA-ANPSPDNASAVSENVNKFLFLENEISEGGSNL 1529

Query: 572  SGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRL 631
            S GQ+Q + +AR+LL+ P V++LDEAT+++D +S++ I  T     +  + TI++IAHRL
Sbjct: 1530 SQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRL 1587

Query: 632  STIRRSEIVIVLGNDGSVVE 651
             +I   + ++V+ + G V E
Sbjct: 1588 RSIIDYDKILVM-DAGEVKE 1606

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 114/238 (47%), Gaps = 21/238 (8%)

Query: 428 KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL------- 480
           + +I F+N +F++  +      K++N   + G    ++GP+G GK+++   LL       
Sbjct: 686 RNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 745

Query: 481 -KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
            K Y P      +D ++   + +  +   I    Q   L++ ++++NI +   +      
Sbjct: 746 GKVYAPC-----LDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFSSPFNEG--R 798

Query: 540 IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
              V + C             QT +G  G  LSGGQKQR+++ARAL      L+LD+  S
Sbjct: 799 YNAVIEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLS 858

Query: 600 ALDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGK 654
           A+D  +   I  N   G LM+ +  T I ++H ++ T++ +E V+ + N G V + G+
Sbjct: 859 AVDSHTALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMEN-GRVKDQGE 913

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 140/527 (26%), Positives = 247/527 (46%), Gaps = 90/527 (17%)

Query: 196  TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPEL 255
             +H    FFD   VG +++R   D   + + +   +      L+           I+P  
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILLLIVVITPR- 1140

Query: 256  SAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTVQAFV 309
                 FF+  V++  +Y+  G+     SR L+           + FS    GV T++AF 
Sbjct: 1141 -----FFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAFG 1195

Query: 310  AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAYGSYLV 362
             E+R I      ++++  + +     N   F ++ ++   +F        +VL  GS+++
Sbjct: 1196 DEKRFI------LENMEKIDQN----NKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFIL 1245

Query: 363  LH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT------- 410
             +      GL+   LT  +++T+   SA++ L   YS     + +  RL E +       
Sbjct: 1246 FNIDNIDSGLAGISLTYAILFTD---SALW-LVQLYSRFEMNMNSVERLKEYSSIVQEKY 1301

Query: 411  -----DRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIV 465
                 D I  ++ ++     P  G+IE +N+S  Y +     + K++ FK++P S V IV
Sbjct: 1302 LGYDEDHIQALNDSSW----PKHGKIEVENLSLRYASNL-PLVLKNVCFKVDPQSKVGIV 1356

Query: 466  GPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRD 525
            G +G GKSTI + L +  +P  G I +D QDISK++  +LRR I I+ Q+P+L +G+I+ 
Sbjct: 1357 GRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKS 1416

Query: 526  NITYGLTYEATAEEIRRVTKQCFCHNFIT--KFPDQY---------------QTILGPNG 568
            NI     Y+      RR+ K     N I+  +F   +               Q+ +   G
Sbjct: 1417 NIDPHDEYDE-----RRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIVEGG 1471

Query: 569  TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
              LS G++Q + IAR+LL++  +++LDEATS++D +S+  I         K   TI++IA
Sbjct: 1472 LNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQSIIRSKFNKS--TILTIA 1529

Query: 629  HRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKST 675
            HRL ++   + ++V+ + G + E       +G+P   L    NE+ST
Sbjct: 1530 HRLRSVIYYDKILVM-DAGEIKE-------YGHPYELLK---NERST 1565

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 135/304 (44%), Gaps = 27/304 (8%)

Query: 426 PGKGEIEFKNVSFAYPTRPGS-QIFK--SLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
           P + +IEFK  +  +         FK   LN     G    ++G +G GKS +   LL  
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 483 YKPTAGTITVDG----QDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE 538
               +G I + G     D+   +   L        Q   L+S +I++NI +  +Y+ +  
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKS-- 775

Query: 539 EIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEAT 598
             ++V   C  +  +   P    T +G  G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 776 RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCL 835

Query: 599 SALDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVL-----GNDGSVV 650
           SA+D  +   I  N   G+LMK +  T I + H +   IR +   I+L      N G++ 
Sbjct: 836 SAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTIK 893

Query: 651 EIGKFKTLFGNPLSELS-QLLNEKSTIN---ERNPNEKPAETPEQESQKNAANESIVDVV 706
           E+ K K +F   +++LS Q    K T+N   E N           E   N  N+    ++
Sbjct: 894 ELQK-KGIFKEEIAQLSHQDTITKKTVNNLDENNIQRSKCVIDNTEYDINLVNDG--QLI 950

Query: 707 LEEE 710
            EEE
Sbjct: 951 EEEE 954

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 136/527 (25%), Positives = 248/527 (47%), Gaps = 78/527 (14%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            + ++ K +H    FFD    G +++R   D   + + +T  +   F +L+          
Sbjct: 1139 NMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILIT 1198

Query: 250  SISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQFSGVK 303
             I+P+      F +  +++S MY+  G      SR+L+     +   + +   E   GV 
Sbjct: 1199 FITPQ------FLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSETLVGVT 1252

Query: 304  TVQAFVAE----QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGS 359
            T++AF  E    Q  +++ +   K  + +   + ++  ++  I S       L++   G 
Sbjct: 1253 TIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGS-------LVIFGAGL 1305

Query: 360  YLV-----LHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
            +++     L  G++   LT  + +TE        L   YSE+   + +  R+ E  +   
Sbjct: 1306 FILSNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQ 1361

Query: 415  MISPTTGKKYIP-----GKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPS 468
               P    K +P       G+IE  ++S  Y P  P  ++ K+++F ++  S V IVG +
Sbjct: 1362 --EPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKVGIVGRT 1417

Query: 469  GRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI- 527
            G GKSTI + L ++ +P  G I +D  DIS ++ + LRR I I+ Q+P L SG+I+ N+ 
Sbjct: 1418 GAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSGTIKTNLD 1477

Query: 528  -----TYGLTYEA---------------TAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
                 +    +EA               T  E+   T      N + KF D  ++ +   
Sbjct: 1478 PYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSEN-VNKFLD-LESEVSEG 1535

Query: 568  GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
            G+ LS GQ+Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K  +    TI++I
Sbjct: 1536 GSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTI 1593

Query: 628  AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
            AHRL ++   + ++V+ + G V E       + +P    S LLN++S
Sbjct: 1594 AHRLRSVIDYDKILVM-DAGEVKE-------YDHP---YSLLLNKQS 1629

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 115/236 (48%), Gaps = 15/236 (6%)

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           P      F+N + ++         K LN + + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 486 TAGTITVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             G + V   D  +   + +      I    Q   L++ ++++NI +   +  T    + 
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNET--RYKA 806

Query: 543 VTKQC-FCHNF-ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
           V + C    +F I K  D   T +G  G  LSGGQKQR+++ARAL      ++LD+  SA
Sbjct: 807 VVEACGLKRDFEILKAGDL--TEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 601 LDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIG 653
           +D  + S I  N   G LM+ +  T I ++H ++ T+R +E+V++L  DG V + G
Sbjct: 865 VDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLL-EDGRVKDQG 917

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  145 bits (366), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 138/507 (27%), Positives = 244/507 (48%), Gaps = 59/507 (11%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            +++ K  +     FF+    G +I+R  SD   V  ++    S  F+++L          
Sbjct: 1030 NKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVT 1089

Query: 250  SISPELSAFLLFF--TPPVMLSSMYFGRLIRDNSRKLQEATG----QLTRVSEEQFSGVK 303
               P      LFF     +++  +Y+       SR+L+  T      +  +  E  SG  
Sbjct: 1090 FNMP------LFFLLNAGLLVIYLYYQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHF 1143

Query: 304  TVQAFVAEQREIKRYNNV--------IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVL 355
            T+ A+     +I+R++++        I   +N    + +++ +L +I + +   + LL L
Sbjct: 1144 TISAY----EQIRRFSHLNYERIQFSINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLAL 1199

Query: 356  A-YGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
            +  G+   L  GL +G L +Y +  ++T S ++ + S    I   + +  R+ E  D  P
Sbjct: 1200 SSLGTDHQLSSGL-VGLLMSYAL--QVTSSLIWIIRS-SVLIETNIVSVERIVEYCDISP 1255

Query: 415  MISPTTGKKY-----IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSG 469
              +P   +++      P +G+IEFKN S +Y       + K +N  I PG  + +VG +G
Sbjct: 1256 E-APEVKEEHRLDDNWPNQGQIEFKNYSTSYRENLDP-VLKHINLVISPGEKIGVVGRTG 1313

Query: 470  RGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIR----- 524
             GKST++  L +  +PTAGTI++D  DI+ +  + LR HI I+ Q+     G+IR     
Sbjct: 1314 AGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDP 1373

Query: 525  ------DNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQ------YQTILGPNGTLLS 572
                  D++ + +        +  + K+    N  +++ D+          +   G+ LS
Sbjct: 1374 FEKFSDDDLWHAIELSHLKFHLETIAKEI---NDDSEYSDRSRLESPLDIPVREAGSNLS 1430

Query: 573  GGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLS 632
             GQKQ + +ARALL K  +L+LDEAT+++DVE++  I  T  K    +  TI++IAHRL 
Sbjct: 1431 VGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR--TILTIAHRLD 1488

Query: 633  TIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            T+  S+ +IVL + G V E  K +TL 
Sbjct: 1489 TVFDSDRIIVL-DGGEVKEFDKPETLL 1514

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 137/268 (51%), Gaps = 33/268 (12%)

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDIS---KLNSKSLRRHI 509
           NF++   S +C+VG  G GKSTI   +L      +G    +   +S   ++N+ +    +
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG----NNDHLSPQFQINATT----V 690

Query: 510 GIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT-KQCFCHNFITKFPDQYQTILGPNG 568
               QE  +M+ S++DNI +G  Y+   E   + T K C     I   PD  +T++G  G
Sbjct: 691 AYCPQEAWIMNASVKDNILFGHKYD---EAFYKATIKACQLLPDIKVLPDGDETMVGEKG 747

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKEVTI 624
            +LSGGQK R+++ARA+  + ++ +LD+  SA+D E  ++ I     +   L+K K  +I
Sbjct: 748 IVLSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDK--SI 805

Query: 625 ISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL-SELSQLLNEKSTINERNPNE 683
           +   + +S ++ S  + +L N  S+ + G +  +  N   S+L  +L+E          E
Sbjct: 806 VLATNTISVLKHSTKIYLLENK-SIAQEGNYDDIMNNQQDSKLKNILHEFDL-------E 857

Query: 684 KPAETPEQESQKNAANESIVDVVLEEEI 711
           KP +TP    Q+     S ++++LE+ +
Sbjct: 858 KP-DTP--AVQEGTDPTSAINLLLEDAL 882

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 139/518 (26%), Positives = 244/518 (47%), Gaps = 63/518 (12%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++ + +H    FFD+  +G +++R   D   + + +   +   F + +           I
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISYI 1188

Query: 252  SPELSAFLLFFTPPVMLSSMY--FGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTV 305
            +P       FF   +++   Y   G      SR+L+     +   + +   E   GV T+
Sbjct: 1189 TPA------FFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTI 1242

Query: 306  QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLH- 364
            +AF  EQR IK   ++I D  ++     ++  +  +    L  +  L++ + G +++L+ 
Sbjct: 1243 RAFGDEQRFIKENLSMI-DQNSMPFFYLWVVNRWLSFRIDL--IGALVIFSSGVFILLNI 1299

Query: 365  ----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT--DRIPMIS- 417
                 GL+   LT  + +TE    A   L   YSE+   + +  R+ E    ++ P+I+ 
Sbjct: 1300 NNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIAD 1355

Query: 418  ---PTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKS 473
                 T     P  G++E  N+S  Y P  P   + K + F IEP   V IVG +G GKS
Sbjct: 1356 PANAVTPPPQWPDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAGKS 1413

Query: 474  TIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY 533
            TI + L ++ +   G+I +DG +I+ ++ K LRR I I+ Q+P L +GSIR N+     Y
Sbjct: 1414 TIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEY 1473

Query: 534  E-------------ATAEEIRRVTK--QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQR 578
                           + EE+   T   Q      + KF +  ++ +   G+  S GQ+Q 
Sbjct: 1474 SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLN-LESEIAEGGSNFSQGQRQL 1532

Query: 579  IAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSE 638
            + +AR+LL+ P V++LDEAT+++D  S++ I  T  +       T+++IAHRL +I   +
Sbjct: 1533 MCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVLTIAHRLRSIVDYD 1590

Query: 639  IVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
             ++V+ + G V E       F +P S    LL EK +I
Sbjct: 1591 KILVM-DAGEVKE-------FDHPYS----LLLEKKSI 1616

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 106/228 (46%), Gaps = 9/228 (3%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F+NV+  + +   S + ++L+ +   G    IVG +G GK++I   LL   + + G I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 491 TVDG---QDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQC 547
            V     +   +  +  +   I    Q   L++ ++R+NI +   ++    +   V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 548 FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESES 607
                         T +G  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 608 AI--NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIG 653
            I      G LM+ +  T I + H ++   ++   +V+  DG V E G
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKG 929

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 131/499 (26%), Positives = 238/499 (47%), Gaps = 64/499 (12%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++KK ++    FFD+  +G +++R   D   V + +T  V   F +L+           I
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 252  SPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTV 305
            +P       FF   + ++ +Y+  G      SR+L+           + FS    G+ T+
Sbjct: 980  TPG------FFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTI 1033

Query: 306  QAFVAEQR----EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL 361
            +AF  E+R     +++ +   K  + +   + ++  ++  I + +       + A G ++
Sbjct: 1034 RAFGDERRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGACV-------IFAAGIFV 1086

Query: 362  VLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL--TDRIP 414
            +L+      GL+   LT  + +TE        L   YS +   + +  RL E    ++ P
Sbjct: 1087 LLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEP 1142

Query: 415  MISPT-TGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGK 472
                T T     P +G+IE  ++S  Y P+ P  ++ K+++F ++P   V IVG +G GK
Sbjct: 1143 HYQSTHTPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGK 1200

Query: 473  STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI----- 527
            STI + L ++  P +G I +D  DI+ +  K LR+ I I+ Q+P L +G+++ N+     
Sbjct: 1201 STIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDE 1260

Query: 528  -TYGLTYEA-------TAEEIRRV------TKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
             + G  +EA       T EE+                N + KF  +    +   G  LS 
Sbjct: 1261 YSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSEN-VNKFL-RLDNEITEGGANLSQ 1318

Query: 574  GQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTF-GKLMKKKEVTIISIAHRLS 632
            GQ+Q + +AR+LL+ P V++LDEAT+++D  S++ I  T  G+       TI++IAHRL 
Sbjct: 1319 GQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLR 1375

Query: 633  TIRRSEIVIVLGNDGSVVE 651
            +I   + ++V+ + G V E
Sbjct: 1376 SIIDYDKILVM-DAGEVKE 1393

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 112/242 (46%), Gaps = 19/242 (7%)

Query: 428 KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL------- 480
           +  I F+N +F++  +      K+++ +   G    ++GP+G GK+++   LL       
Sbjct: 472 RKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 531

Query: 481 -KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE 539
            K Y P      +D ++   + +  +   I    Q   L++ ++++NI +   +     +
Sbjct: 532 GKVYAPC-----LDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEARYD 586

Query: 540 IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATS 599
              V + C             QT +G  G  LSGGQKQR+++ARAL      L+LD+  S
Sbjct: 587 --AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLS 644

Query: 600 ALDVESESAI--NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657
           A+D  +   I  N   G LM+ +  T I ++H ++   ++   +V   +G V + G+   
Sbjct: 645 AVDSHTALWIYENCITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPLE 702

Query: 658 LF 659
           LF
Sbjct: 703 LF 704

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 154/590 (26%), Positives = 272/590 (46%), Gaps = 89/590 (15%)

Query: 132  GSADLSIESSELPP-----IAFGLSLYEFLGCIGAALLIG-TAANFGXXXXXXXXXXXXX 185
            GS+ +S+ S+E  P       + L LY  +G   A L  G T  NF              
Sbjct: 1082 GSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNF-------VAGINAS 1134

Query: 186  XXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXX 245
                + ++ K +H    FFD    G +++R   D   + + +T  +   F +L+      
Sbjct: 1135 RKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTV 1194

Query: 246  XXXXSISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQF 299
                 I+P+      F +  +++S +Y+  G      SR+L+     +   + +   E  
Sbjct: 1195 ILITFITPQ------FLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETL 1248

Query: 300  SGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGS 359
             GV T++AF  E R ++      ++++ + +     N   F +  +   ++F + +  GS
Sbjct: 1249 VGVTTIRAFGDEGRFMQ------ENLHKIDEN----NKPFFYLWVANRWLAFRIDMI-GS 1297

Query: 360  YLVLHGGL----SIGDLTAYMMYTELTGSAVF-----GLSSFYSEIMQGVGAASRLFELT 410
             ++   GL    +I +L + M    LT +  F      L   YSE+   + +  R+ E  
Sbjct: 1298 LVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYM 1357

Query: 411  DRIPMISPTTGKKYIP-----GKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCI 464
            +      P    K IP       G+IE  ++S  Y P  P  ++ K+++F ++  S + I
Sbjct: 1358 EIEQ--EPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGI 1413

Query: 465  VGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIR 524
            VG +G GKSTI + L ++ +P  G I +D  DIS ++ + LRR I I+ Q+P L SG+I+
Sbjct: 1414 VGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIK 1473

Query: 525  DNI------TYGLTYEA------TAEE------IRRVTKQCFCHNF--ITKFPDQYQTIL 564
             N+      +    +EA       +EE       R  + +    N   + KF D    I 
Sbjct: 1474 TNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDLSSEI- 1532

Query: 565  GPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTI 624
               G+ LS GQ+Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K  +    TI
Sbjct: 1533 SEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TI 1590

Query: 625  ISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
            ++IAHRL ++   + ++V+ + G V E       + +P    S LLN++S
Sbjct: 1591 LTIAHRLRSVIDYDKILVM-DAGEVKE-------YDHP---YSLLLNKQS 1629

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 147/316 (46%), Gaps = 32/316 (10%)

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           P      F+N + ++         K LN + + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 486 TAGTITVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             G + V   +  +   +++      I    Q   L++ ++++NI +   +       + 
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEA--RYKA 806

Query: 543 VTKQC-FCHNF-ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
           V + C    +F I K  D   T +G  G  LSGGQKQR+++ARAL      ++LD+  SA
Sbjct: 807 VVEACGLKRDFEILKAGDL--TEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 601 LDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGK--- 654
           +D  + S I  N   G LM+ +  T I ++H ++ T+R +E+V++L  DG V + G    
Sbjct: 865 VDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLL-EDGRVKDQGDPID 921

Query: 655 --FKTLFG-NPLSELSQLLNEKSTIN-----ERNPNEKPAETPEQESQKNAANESIVDVV 706
              K LFG + L + S L    S+ N       + +  PA   +Q S  N ++       
Sbjct: 922 MLQKGLFGEDELVKSSILSRANSSANLAAKSSTSLSNLPAVKEQQVSVNNNSSH------ 975

Query: 707 LEEEILQNDIRSQDEK 722
            E + LQ  +R++ E+
Sbjct: 976 FEAKKLQKSLRTEAER 991

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 132/489 (26%), Positives = 218/489 (44%), Gaps = 21/489 (4%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  +     FF+   VG +++R  +D Y V   + +  S  F  +           SI+ 
Sbjct: 1023 KAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTMIVICSITW 1082

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
            +   F+L  +   +    Y+ R  R+  R        +    +E  +GV TV++F  + R
Sbjct: 1083 QFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTVRSFKKQDR 1142

Query: 314  EIK----RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
             I     R N  +   Y     + ++  +L      +G +  L       + +  G L+ 
Sbjct: 1143 FIHINQSRINTYMCAYYLSINANRWLAFRL----EFMGSIVILAAAVLSVFRLKQGKLTA 1198

Query: 370  GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD---RIPMISPTTGK-KYI 425
            G L   + Y      ++  +     E+   + +  R+ E TD     PMI PT+   K  
Sbjct: 1199 GMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRPPKNW 1258

Query: 426  PGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P  G+I+F++ S  Y  RP    I + +N  I P   V IVG +G GKS++   L +  +
Sbjct: 1259 PANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIE 1316

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
              AG I +D   I  +    LR  + I+ Q+  +  G+ R+NI     +  T +EI    
Sbjct: 1317 AAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKF--TDDEIWNAL 1374

Query: 545  KQCFC-HNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
            +      + +T   +   T L   G+ LS GQ+Q + +ARALL    +L+LDEAT+A+DV
Sbjct: 1375 ELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDV 1434

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
            E++  I  T     K +  TI++IAHRL+TI  S+ ++VL + G + E      L  +  
Sbjct: 1435 ETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGRIAEFDTPCNLLKDET 1491

Query: 664  SELSQLLNE 672
            S    L NE
Sbjct: 1492 SIFYSLCNE 1500

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 129/276 (46%), Gaps = 23/276 (8%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + ++ +  +P  ++  K++NF+   G   CIVG  G GKS +   +L       G+ T+ 
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAMLGDLFRVKGSATLH 678

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G              +  V Q   +M+G+I+DNI +G  Y+A  E   +  K C     +
Sbjct: 679 GS-------------VAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACALSLDL 723

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYT 612
              PD  QT +G  G  LSGGQK R+A+ARA+  K +V  LD+  +A+D   S+  + Y 
Sbjct: 724 NTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYV 783

Query: 613 FGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLL-- 670
            G     K  T I   +++  +  ++ + +L N G +V+ G +  +  N  S L +L+  
Sbjct: 784 IGPTGLLKTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSYDQVNSNKDSPLFKLIAN 842

Query: 671 --NEKSTINERNPNEKPAETPEQESQKNAANESIVD 704
              +KS   E N  +  AE     S      E I+D
Sbjct: 843 FGKQKSQAIENN-EDTVAEVKTSSSSSPLVQEDIID 877

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 133/493 (26%), Positives = 227/493 (46%), Gaps = 74/493 (15%)

Query: 196  TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPEL 255
             +H    FFD   +G +++R   D   V + +T  +      L+           I+P  
Sbjct: 1088 VLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITIITPH- 1146

Query: 256  SAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTVQAFV 309
                 F    V++  +Y+  G      SR+L+           + FS    GV T++AF 
Sbjct: 1147 -----FLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFG 1201

Query: 310  AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAYGSYLV 362
             E+R I      ++++  + +     N   F ++ ++   +F        +VLA GS+++
Sbjct: 1202 DEKRFI------LENLDKIDQN----NRAFFYLSVAVKWFAFRVDIIGAFIVLASGSFIL 1251

Query: 363  LH-GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT----------- 410
            ++ G +  G     + Y  L       L   YS     + +  RL E +           
Sbjct: 1252 INIGNIDSGLAGISLTYAILFTDGALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYN 1311

Query: 411  -DRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSG 469
             D I  +  ++     P  G+IE  N+S  Y +     + K+++F IEP S V IVG +G
Sbjct: 1312 KDHIQELQQSSW----PEHGQIEVDNLSLRYASNL-PPVIKNVSFTIEPQSKVGIVGRTG 1366

Query: 470  RGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITY 529
             GKSTI + L +  +P  G I +DG DIS+++  +LRR I I+ Q+PIL +G+I+ N+  
Sbjct: 1367 AGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDP 1426

Query: 530  GLTYEATAEEIRRVTKQCFCHNFIT-------------------KFPDQYQTILGPNGTL 570
               Y+   ++I +V  Q    N I+                   KF +  QT +   G  
Sbjct: 1427 CDEYD--NKKIFKVLSQV---NLISTGEMEAAQNMGDDSNTARNKFVN-LQTEITEGGQN 1480

Query: 571  LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHR 630
            +S G++Q + IAR+LL++P +++LDEATS++D ES+  I         K   TI++IAHR
Sbjct: 1481 ISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS--TILTIAHR 1538

Query: 631  LSTIRRSEIVIVL 643
            L ++   + V+V+
Sbjct: 1539 LRSVIDYDRVLVM 1551

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 121/473 (25%), Positives = 213/473 (45%), Gaps = 62/473 (13%)

Query: 283 KLQEATGQLT--RVSE--EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESA---FI 335
           K Q++  Q T  R+++  E    ++ V+ F  E       NN+ KD+ ++ +      F 
Sbjct: 516 KFQKSALQCTDKRIAKLNECLQNIRIVKYFAWE-------NNISKDIKSIRQNELRFLFQ 568

Query: 336 NAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFG-----LS 390
            A ++ ++S L  ++  LV   G    ++  +   +L A + +T L+   +       LS
Sbjct: 569 KALVWALSSFLWFVTPTLVT--GVTFAIYIFVQHQELNAPLAFTTLSLFTLLKTPLDQLS 626

Query: 391 SFYSEIMQGVGAASRLFELTDRIPMISPTTGKKY-----IPGKGEIEFKNVSFAY-PTRP 444
           +  S + Q + +  R+      +  I+    +KY      P + +IEFKN +  +     
Sbjct: 627 NMLSFMNQSIVSLDRI------VKFINEDDTEKYNQLTVSPDENKIEFKNATLTWNENDK 680

Query: 445 GSQIFK--SLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDG----QDIS 498
            S IFK   LN   + G    I+G +G GKS +   LL      +G+ITV G     D+ 
Sbjct: 681 DSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELHLISGSITVPGLEPRHDLI 740

Query: 499 KLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPD 558
             +   L        Q   L++ ++++NI +   Y+      + V   C     +   P 
Sbjct: 741 P-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDV--RYKEVIDACGLKRDLEILPA 797

Query: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKL 616
              T +G  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  N   G +
Sbjct: 798 GDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPI 857

Query: 617 MKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTL-----FGNPLSELSQLL 670
           M+ +  T I + H +S TIR +   ++L N G V   G  K L     F   ++++S   
Sbjct: 858 MENR--TCILVTHNVSLTIREAYFAVILEN-GKVKNQGTIKQLEKTGIFKEEIAQMSY-- 912

Query: 671 NEKSTINERNPNEKPAETPEQESQKNAA----NESIVDVVLEEEILQNDIRSQ 719
             K    E++ NE  ++  E +SQK        ES  D+V + ++++++ +S 
Sbjct: 913 --KGDRTEKSVNE-TSDLQESDSQKTKGVTENKESGEDLVQKGQLVKDEQKSN 962

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 233/497 (46%), Gaps = 60/497 (12%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++ K +H    FFD+  +G +++R   D     + +T  +   F +L+           I
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 252  SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTVQA 307
            +P+     LF    V +   + G      SR+L+     +   + +   E   GV T++A
Sbjct: 1188 TPQF----LFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRA 1243

Query: 308  FVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSF-------LLVLAYGSY 360
            F  E R ++   N+ K   N        N   F +  +   +SF       L++   G +
Sbjct: 1244 FGDESRFMRE--NLQKIDEN--------NRPFFYLWVANRWLSFRIDMIGALVIFGAGIF 1293

Query: 361  LVLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD--RI 413
            ++L+      G +   LT  + +TE        L   YS +   + +  RL E  D  + 
Sbjct: 1294 VLLNIDHIDSGKAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQE 1349

Query: 414  PM-ISPTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
            P   S  T     P +G IE  ++S  Y P  P  ++ K+++F ++P S V IVG +G G
Sbjct: 1350 PYDQSILTPPVEWPQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAG 1407

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI---- 527
            KSTI + L ++  P  G I +D  DI+ ++ + LRR I I+ Q+P L +G+I+ N+    
Sbjct: 1408 KSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYD 1467

Query: 528  --TYGLTYEA-------TAEEI-RRVTKQCFCHNF--ITKFPDQYQTILGPNGTLLSGGQ 575
              T    +EA       T EE+ RR T +    +   I KF D    I    G  +S GQ
Sbjct: 1468 EYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLDLSSEI-SEGGGNISQGQ 1526

Query: 576  KQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIR 635
            +Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K       TI++IAHRL ++ 
Sbjct: 1527 RQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVI 1584

Query: 636  RSEIVIVLGNDGSVVEI 652
              + ++V+ + G V E 
Sbjct: 1585 DYDKILVM-DAGEVKEF 1600

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 94/375 (25%), Positives = 168/375 (44%), Gaps = 52/375 (13%)

Query: 297 EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGK-ESAFINAKLFTITSSLGDMSFLLVL 355
           E F  ++ ++ F  E       NN  KD+ +V + E  F+  +      S    SF+  +
Sbjct: 564 EAFQAIRIIKFFSWE-------NNFEKDIRDVRETELKFLMKRSLVWAGS----SFVWYI 612

Query: 356 --------AYGSYLVLHGGLSIGDLTAYMMYTELTGSAVF-----GLSSFYSEIMQGVGA 402
                   A+  Y+ + G +    LT  + +T L+  ++       LS   S ++Q   +
Sbjct: 613 TPTIVTSCAFWFYIYIQGEV----LTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVS 668

Query: 403 ASRLFEL-----TDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPT-RPGSQIFKSLNFKI 456
             R+ E      T++   +S    KK      +I F+N +  +   RP  ++ K+LN   
Sbjct: 669 LDRVQEFLEEKDTEKYNQLSTAKDKK------KIGFENATITWDAERPDFKL-KNLNIDF 721

Query: 457 EPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISK---LNSKSLRRHIGIVQ 513
           + G    I+GP+G GK+++   LL      +G I V   D  +   + +  +   +    
Sbjct: 722 KVGKLNVIIGPTGSGKTSLLMALLGEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCS 781

Query: 514 QEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
           Q   L++ ++++NI +   Y     E   V + C      +       T +G  G  LSG
Sbjct: 782 QAAWLLNDTVKNNILFNSPYNEGRYE--AVVEACGLKRDFSILSAGDLTEIGERGITLSG 839

Query: 574 GQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIISIAHRL 631
           GQKQRI++AR+L      ++LD+  SA+D  + S I  N   G LM+ +  T I ++H  
Sbjct: 840 GQKQRISLARSLYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEGR--TCILVSHNT 897

Query: 632 S-TIRRSEIVIVLGN 645
           + T+R +E+V+ + N
Sbjct: 898 ALTLRNAELVVTMEN 912

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  142 bits (359), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 128/495 (25%), Positives = 230/495 (46%), Gaps = 72/495 (14%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            V+KK ++    FFD+  +G +++R   D   V + +T  V   F +L+           I
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 252  SPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTV 305
            +P       F    + +  +Y+  G      SR+L+           + FS    G+ T+
Sbjct: 1198 TPG------FLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTI 1251

Query: 306  QAFVAEQR----EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL 361
            +AF  E+R     +++ +   K  + +   + ++  ++  I + +       V A G ++
Sbjct: 1252 RAFGDERRFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGACV-------VFAAGVFI 1304

Query: 362  VLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMI 416
            +L+      GL+   LT  + +TE        L   YS +   + +  RL E    +   
Sbjct: 1305 LLNIKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYM--VIEQ 1358

Query: 417  SPTTGKKY-----IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRG 471
             P+    +      P +G+IE  ++S  Y T    ++ K+++F ++P   V IVG +G G
Sbjct: 1359 EPSNDGAFNPPIEWPDQGKIEVNDLSLRYATNL-PRVIKNVSFTVDPKCKVGIVGRTGAG 1417

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-YG 530
            KSTI + L ++  P  G I +D  DI+ +  K LR+ I I+ Q+P L SG+++ N+  Y 
Sbjct: 1418 KSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYD 1477

Query: 531  LTYEATAEEIRRVTKQCFCHNFIT----------------------KFPDQYQTILGPNG 568
               E T E+I +  K+    N +T                      KF D    I    G
Sbjct: 1478 ---EYTDEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEI-TEGG 1530

Query: 569  TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
              LS GQ+Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  +  +  + TI++IA
Sbjct: 1531 ANLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIA 1588

Query: 629  HRLSTIRRSEIVIVL 643
            HRL +I   + ++V+
Sbjct: 1589 HRLRSIIDYDKILVM 1603

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 138/305 (45%), Gaps = 44/305 (14%)

Query: 428 KGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTA 487
           + +I F+N +FA+  +  S   K+LN + + G    ++G +G GK+++   LL       
Sbjct: 689 RNKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIE 748

Query: 488 GTITVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
           G + V   D  +   + S  +   I    Q   L++ ++R+NI +   Y  T    + V 
Sbjct: 749 GKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYKAVV 806

Query: 545 KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
           + C             QT +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D  
Sbjct: 807 EACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSH 866

Query: 605 SESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
           +   I  N   G LM+ +  T I ++H ++ T++ +E V+VL N       G+ K   G 
Sbjct: 867 TALWIYENCITGPLMQGR--TCILVSHNVALTLKNAEWVVVLDN-------GRIKDQ-GE 916

Query: 662 PLSELSQ-LLNE-------------------------KSTINERNPNEKPAETPEQESQK 695
           PL  L++ LL E                         KS IN    N K  E+PE   +K
Sbjct: 917 PLDLLNRGLLGEDELVKTSILSRTNSSVNLASKNSESKSGINLSKMNAKLKESPEDSKKK 976

Query: 696 NAANE 700
             ++E
Sbjct: 977 LQSDE 981

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 242/508 (47%), Gaps = 58/508 (11%)

Query: 197  IHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELS 256
            ++   +FF+   +G +++R  +D   V  ++       FK++              P   
Sbjct: 1049 VYSSMQFFETTPIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFL 1108

Query: 257  AFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG----QLTRVSEEQFSGVKTVQAFVAEQ 312
             F LF    +M+  +Y+ +L    SR+L+  T      +  +  E   G+  ++A+    
Sbjct: 1109 VFCLF----LMVIYIYYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAY-KHF 1163

Query: 313  REIKRYNNV-----IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA-YGSYLVLHGG 366
               K  NN      I  V++    + +++ +L TI + +  ++ +L L+   S   L  G
Sbjct: 1164 SMFKYLNNERVQFNINCVFDYRSTNRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAG 1223

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKY-- 424
            + +G L +Y++  ++T S ++ + S    I  G+ +  R+ E  + +P  +      Y  
Sbjct: 1224 M-VGLLMSYVL--QVTTSLMWIVRS-SVMIETGIVSVERIMEYCE-LPSEAEQIVDDYRP 1278

Query: 425  ---IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
                P KG I+FKN S  Y       + K+++  I PG  V IVG +G GKST+   L +
Sbjct: 1279 ASNWPSKGAIQFKNYSTRYRANL-DPVLKNISININPGEKVGIVGRTGAGKSTLTLALFR 1337

Query: 482  YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDN-----------ITYG 530
              +P  GTI +DG DISK+    LR H+ I+ Q+     G++R N           +   
Sbjct: 1338 LLEPIEGTIIIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTA 1397

Query: 531  LTYEATAEEIRRVTKQCFCHNFITKFP--DQYQTILGPNGTLLSGGQKQRIAIARALLKK 588
            +T       ++++ ++       ++ P  D  +  +  +G+ LS GQ+Q + +ARALL +
Sbjct: 1398 ITLSHLKPHLKKLMEESG-----SELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNR 1452

Query: 589  PNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGS 648
              +L+LDEAT+++DVE++  I  T  +    +  TII+IAHR+ T+  S+ ++VL   G 
Sbjct: 1453 SKILVLDEATASVDVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGE 1509

Query: 649  VVEIGKFKTLFGNPLSELSQLLNEKSTI 676
            V E       F +P S    LL +KST+
Sbjct: 1510 VKE-------FNSPAS----LLADKSTL 1526

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 99/209 (47%), Gaps = 28/209 (13%)

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT-------ITVDGQDISKLNSKSLR 506
           F+ +     C+VG  G GK+T+   +L     T+G+       + + G+ ++        
Sbjct: 654 FRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESVAY------- 706

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGP 566
                  QE  +M+ SI++NI +G  Y+ T   +    K C         PD   T++G 
Sbjct: 707 -----CPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGE 759

Query: 567 NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTF----GKLMKKKEV 622
            G  LSGGQK R+++ARA+  + ++ +LD+  SA+D     +I +        L+K K  
Sbjct: 760 KGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNK-- 817

Query: 623 TIISIAHRLSTIRRSEIVIVLGNDGSVVE 651
            II   + +S +  S+ + VL  DG ++E
Sbjct: 818 AIILTTNDISVLEHSDRIYVL-QDGRIIE 845

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 133/508 (26%), Positives = 228/508 (44%), Gaps = 50/508 (9%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  I    +FF+   +G +I+R  SD   V  ++    S  F+++L             P
Sbjct: 1044 KAIIRSPVQFFETTPIGRVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMP 1103

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG----QLTRVSEEQFSGVKTVQAFV 309
                + L F   +M+   Y+ +L    SR+L+  T      +  +  E   G   + A+ 
Sbjct: 1104 ----WFLLFNALIMIIYFYYEKLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAY- 1158

Query: 310  AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGL-- 367
                ++ ++ N+ +  YN+          LFT  S+   +S  L  + G++++L  GL  
Sbjct: 1159 -NHSKMFKFMNIERVQYNLNV--------LFTFRSTNRWLSIRLQ-SIGAFIILCTGLLA 1208

Query: 368  ----------SIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP--- 414
                        G +   M Y     SA+  +     +I   + +  R+ E     P   
Sbjct: 1209 LTTLRTSSPIGSGLIGLLMSYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAE 1268

Query: 415  -MISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKS 473
             +I     ++  P +G IEFKN +  Y     S + K+++  I P   V IVG +G GKS
Sbjct: 1269 DIIDSNRVERDWPQRGSIEFKNYTTTYRANL-SPVLKNISVTINPSEKVGIVGRTGAGKS 1327

Query: 474  TIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY 533
            T++  L +  +   GTI +DG DIS++    LR ++ I+ Q+     G++R N+      
Sbjct: 1328 TLSLALFRILEAAEGTIFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNL--DPFQ 1385

Query: 534  EATAEEIRRVTKQCFCHNFITKFPDQ---------YQTILGPNGTLLSGGQKQRIAIARA 584
            + T  E+  V +       + +  +              +  NG+ LS GQ+Q + +ARA
Sbjct: 1386 KHTDVELWNVIELSHLKPHVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARA 1445

Query: 585  LLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG 644
            LL +  VL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL TI  ++ ++VL 
Sbjct: 1446 LLNQSKVLVLDEATAAVDVETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL- 1502

Query: 645  NDGSVVEIGKFKTLFGNPLSELSQLLNE 672
            + G V E    K L  +  +   QL ++
Sbjct: 1503 DAGGVKEFDSPKNLLSDESTLFYQLCDK 1530

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 126/267 (47%), Gaps = 45/267 (16%)

Query: 420 TGK---KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLN-------------------FKIE 457
           TGK   +YIP    +E +N +F + ++  +Q+  S N                   F   
Sbjct: 596 TGKPANEYIPA---VEIENATFLWKSQ--AQLINSENDDSEANIETTQVALKNIDHFTAS 650

Query: 458 PGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDIS-KLNSKSLRRHIGIVQQEP 516
           P S  C++G  G GK+T+   +L      +G+     + IS KL+ +     I    QE 
Sbjct: 651 PKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG--ESIAYCPQEA 704

Query: 517 ILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQK 576
            +M+ +I++NI +G  ++ T   +      C         PD  QT++G  G  LSGGQK
Sbjct: 705 WIMNDTIKENILFGHKFDETYYTL--TVAACELLADFDILPDGDQTLVGEKGISLSGGQK 762

Query: 577 QRIAIARALLKKPNVLILDEATSALDVE-----SESAINYTFGKLMKKKEVTIISIAHRL 631
            R+++ARA+  + ++ +LD+  SA+D        E+ ++   G L  K   T+I   + +
Sbjct: 763 ARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSGLLRNK---TVILSTNTV 819

Query: 632 STIRRSEIVIVLGNDGSVVEIGKFKTL 658
           S ++ S+++  L N G +VE G +  +
Sbjct: 820 SVLKHSQLIYALEN-GIIVERGNYNDI 845

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 136/505 (26%), Positives = 239/505 (47%), Gaps = 41/505 (8%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLF- 261
            FF++  +G +I+R  SD   V R++    +  FK   C          I   +  FL+F 
Sbjct: 1077 FFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFK---CVLDYFVTILLIGYNMPWFLVFN 1133

Query: 262  --FTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR-EIKRY 318
                   +   +++  L R+  R    A   +  +  E   G   + AF   +R     +
Sbjct: 1134 AGLLVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAFRHSERFHFLNF 1193

Query: 319  NNV---IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA-YGSYLVLHGGLSIGDLTA 374
            N     I   +N+   + +++ +L  I  ++  ++ LL LA  G+   +  GL +G L +
Sbjct: 1194 NKTQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGL-VGLLMS 1252

Query: 375  YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE---LTDRIP-MISPTTGKKYIPGKGE 430
            Y++  ++T S ++ +    + I   + +  R++E   L    P +I  +  +K  P  GE
Sbjct: 1253 YVL--QVTNSLMW-IVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRPEKSWPSMGE 1309

Query: 431  IEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
            I FK+ S  Y  RP    + K +N  I+P   + +VG +G GKS+++  L +  + T G+
Sbjct: 1310 IIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGS 1367

Query: 490  ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFC 549
            I +DG DISK+    LR H+ I+ Q+     G++R N+     Y  + +EI +  +    
Sbjct: 1368 IEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQY--SVQEIWKAVELAHL 1425

Query: 550  HNFITKF-----PDQ---------YQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILD 595
               I K      PD+             +  NG  +S GQ+Q + ++RALL K  VL+LD
Sbjct: 1426 KPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLD 1485

Query: 596  EATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKF 655
            EAT+A+D+E++  I  T     + K  TI++IAHR+ T+  S+ ++VL + G V E    
Sbjct: 1486 EATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEVKEFESP 1542

Query: 656  KTLFGNPLSELSQLLNEKSTINERN 680
             TL  +  S    L  +   ++++N
Sbjct: 1543 DTLLKDEKSLFYGLCQKGGYLDKKN 1567

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 120/237 (50%), Gaps = 16/237 (6%)

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           +F+ + G+  C+VG  G GKST+   +L      +G       +I         R +   
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEI-----LVRARSVAYC 715

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLS 572
            Q P +M+ SI+DNI +G  Y+ T   +    K C     +    +  +T++G  G  LS
Sbjct: 716 PQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLS 773

Query: 573 GGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKEVTIISIA 628
           GGQK R+++ARA+  + ++ ++D+  SA+D E S++ I+   G+   L+K K  TII   
Sbjct: 774 GGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTT 831

Query: 629 HRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN-PLSELSQLLNEKSTINERNPNEK 684
           + +S ++ S ++  L   G +VE G ++        S L +L+ E  T  E NP++K
Sbjct: 832 NAVSVLKHSNMIYAL-QGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAE-NPSDK 886

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  141 bits (356), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 241/509 (47%), Gaps = 66/509 (12%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++K  ++    FFD+  +G +++R   D   + + +T  +   F +L+           I
Sbjct: 1136 LLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYI 1195

Query: 252  SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS----GVKTVQA 307
            +P+     L     VML   +        +R+L+           + FS    G+ T++A
Sbjct: 1196 TPQF----LIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGITTIRA 1251

Query: 308  FVAEQR----EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVL 363
            F  E+R     +K+ ++  +  + +   + +++ ++  I +       L+VLA GS+++L
Sbjct: 1252 FSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGA-------LIVLAAGSFILL 1304

Query: 364  H--------GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT--DRI 413
            +         G+S+G         + T  A++ +   YS +   + +  RL E T  ++ 
Sbjct: 1305 NIKSIDSGLAGISLG------FAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQE 1357

Query: 414  P-----MISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPS 468
            P     ++ P       P  G+IE K++S  Y      ++ K++ F ++    V IVG +
Sbjct: 1358 PSNVGALVPPCEW----PQNGKIEVKDLSLRYAAGL-PKVIKNVTFTVDSKCKVGIVGRT 1412

Query: 469  GRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT 528
            G GKSTI + L ++  P  G I +D  DI+ +  K LR+ I I+ Q+P L +G+++ N+ 
Sbjct: 1413 GAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLD 1472

Query: 529  -YGLTYEATA-EEIRRV-------------TKQCFCHNF-ITKFPDQYQTILGPNGTLLS 572
             Y    EA   E ++RV             +     H+  + KF D  +  +   G+ LS
Sbjct: 1473 PYNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLD-LENEVSEGGSNLS 1531

Query: 573  GGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLS 632
             GQ+Q I +AR+LL+ P V++LDEAT+++D  S+S I  T  +       TI++IAHRL 
Sbjct: 1532 QGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTIAHRLR 1589

Query: 633  TIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
            +I   + ++V+ + G V E     +L  N
Sbjct: 1590 SIIDYDKILVM-DAGEVKEYDHPYSLLLN 1617

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 99/429 (23%), Positives = 185/429 (43%), Gaps = 47/429 (10%)

Query: 297 EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV-- 354
           E F  ++ ++ F  E+       N  KD+ N   E   +  K  +I  +L  + + +   
Sbjct: 569 EAFQAIRIIKFFSWEE-------NFEKDIQNTRDEELNMLLKR-SIVWALSSLVWFITPS 620

Query: 355 ----LAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFG-----LSSFYSEIMQGVGAASR 405
                ++  Y+ + G      LT  + +T L+  A+       LS   S ++Q   +  R
Sbjct: 621 IVTSASFAVYIYVQGQ----TLTTPVAFTALSLFALLRNPLDMLSDMLSFVIQSKVSLDR 676

Query: 406 LFELTDRIPMISPTTGKKY---IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNV 462
           + E       ++    KKY      + ++  +N +F +         K+L    + G   
Sbjct: 677 VQEF------LNEEETKKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLN 730

Query: 463 CIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISK---LNSKSLRRHIGIVQQEPILM 519
            IVGP+G GK+++   LL   +   G + V   +  +   + +  +   I    Q   L+
Sbjct: 731 VIVGPTGSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLL 790

Query: 520 SGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRI 579
           + ++R+NI +   Y         V   C             QT +G  G  LSGGQKQR+
Sbjct: 791 NDTVRNNILFNAPYNEN--RYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRV 848

Query: 580 AIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRR 636
           ++AR+L      L+LD+  SA+D  +   I  N   G LM+ +  T + ++H ++ T++ 
Sbjct: 849 SLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGR--TCVLVSHNVALTLKN 906

Query: 637 SEIVIVLGN-----DGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQ 691
           ++ VI++ N      G  VE+ +  +L  + + + S L    S++N    N K +  P+ 
Sbjct: 907 ADWVIIMENGRVKEQGEPVELLQKGSLGDDSMVKSSILSRTASSVNISETNSKISSGPKA 966

Query: 692 ESQKNAANE 700
            ++ + ANE
Sbjct: 967 PAESDNANE 975

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  141 bits (355), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 137/496 (27%), Positives = 230/496 (46%), Gaps = 47/496 (9%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   VG +I+R  SD   V  ++ Q V   F  L+           I  ++  FLL  
Sbjct: 1065 FFETTPVGRIINRFSSDMNSVDDNV-QYVISFF--LISILDYVVVVVIIGYQVPLFLLVN 1121

Query: 263  TPPV---MLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR------ 313
               +   +   +++  L R+  R +  +   +  +  E  +G   + AF    R      
Sbjct: 1122 AALLGIYLYYQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNI 1181

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
            E  ++N  I  V+N    + +++ +L +I + +   + LL LA  +       LS G + 
Sbjct: 1182 EAVQFN--INCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTG---DKALSTGMVG 1236

Query: 374  AYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD----RIPMISPTTGKKYIPGKG 429
              M Y     + +  +     ++   V +  R+ E  D      P+I     +K  P +G
Sbjct: 1237 LLMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQG 1296

Query: 430  EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
             + FK+ S  Y       + K LN +I P   + IVG +G GKST++  L +  +P  GT
Sbjct: 1297 HVVFKDYSARYRENL-DPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGT 1355

Query: 490  ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFC 549
            I +DG DI+K+    LR H+ I+ Q+     GS+R N+     Y  + +EI R  +    
Sbjct: 1356 IVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQY--SDDEIWRALELSHL 1413

Query: 550  HNFITKFPDQ---------YQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
               I K  ++          +T +  NG+ LS GQ+Q + ++RALL +  +L+LDEAT+A
Sbjct: 1414 KPHILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAA 1473

Query: 601  LDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG 660
            +D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V E       F 
Sbjct: 1474 VDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKE-------FD 1523

Query: 661  NPLSELSQLLNEKSTI 676
            +P    S LL +K+TI
Sbjct: 1524 SP----SNLLADKNTI 1535

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 131/263 (49%), Gaps = 19/263 (7%)

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513
           F+   G  VC+VG  G GKST    LL      + +     Q   K++ +     + +  
Sbjct: 658 FQALKGQLVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRC--DSVALCS 712

Query: 514 QEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
           Q+  +++ S++ N+ +G  Y+  +   +   + C     +    D  +T++G  G  LSG
Sbjct: 713 QQAWILNASVKYNVLFGHKYDEAS--YKATIEACQLLPDLGILADGDETLVGEKGISLSG 770

Query: 574 GQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKEVTIISIAH 629
           GQK RI++ARA+  + +V +LD+  SA+D E  +  I++   +   L+K K  T+I   +
Sbjct: 771 GQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTN 828

Query: 630 RLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG-NPLSELSQLLNEKSTINERNPNEKPAET 688
            +S ++ S+ +  L N G +VE G F  +   +  S+L  L+ E  + +    +++P   
Sbjct: 829 SISVLKHSQSIYALEN-GEIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAVKDDEP--I 885

Query: 689 PEQESQKNAANESIVDVVLEEEI 711
           PEQ+   +   + + D  LEEEI
Sbjct: 886 PEQKPPVDL--QEVEDDALEEEI 906

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 139/504 (27%), Positives = 234/504 (46%), Gaps = 48/504 (9%)

Query: 196  TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPEL 255
             I     FF+   VG +I+R  SD   +  S+ Q V   F  L+           I  ++
Sbjct: 1049 VIRSPMSFFETTPVGRIINRFSSDMNSLDDSV-QYVMSFF--LVSILDYLVVVIIIGYQV 1105

Query: 256  SAFLLFFTPPVMLS---SMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQ 312
              FL+     +++     +Y+  L R+  R +  +   +  +  E  +G   + AF    
Sbjct: 1106 PLFLIVNAVLLVIYFYYQVYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSD 1165

Query: 313  R-EIKRYNNV---IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGG-- 366
            R +     NV   I  ++N    + +++ +L +I + +   + LL LA       +GG  
Sbjct: 1166 RFDYLNVENVQFNINCLFNFRSTNRWLSIRLESIGALMILTTALLSLATK-----NGGHA 1220

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD----RIPMISPTTGK 422
            LS G +   M Y     + +  +     ++   + +  R+ E  D      P+I  +   
Sbjct: 1221 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPP 1280

Query: 423  KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
            K  P +G I FKN S  Y       + + L+ +I+P   + IVG +G GKST++  L + 
Sbjct: 1281 KNWPSQGLIRFKNYSTRYRANLDP-VLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRI 1339

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             +P+ GTI +DG DISK+  K LR ++ I+ Q+     G++R N+     Y  + EEI +
Sbjct: 1340 LEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIWK 1397

Query: 543  VTKQCFCHNFITKFP----------DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
              +       I K            D  QT +  NG+ LS GQ+Q + ++RALL +  +L
Sbjct: 1398 ALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRIL 1457

Query: 593  ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
            +LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V E 
Sbjct: 1458 VLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKE- 1513

Query: 653  GKFKTLFGNPLSELSQLLNEKSTI 676
                  F +P    S LL +K +I
Sbjct: 1514 ------FDSP----SNLLAQKDSI 1527

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 130/269 (48%), Gaps = 40/269 (14%)

Query: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYY-----KPTAGTITVDGQDISKLNSKSLRRH 508
           F++  G  VC+VG  G GKST    LL         P+  + TV      + NS      
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALLGQLPCISNSPSHASPTVHF----RANS------ 698

Query: 509 IGIVQQEPILMSGSIRDNITYG-----LTYEATAEEIRRVTKQCFCHNFITKFPDQYQTI 563
           + +  Q+  +M+ S++DN+ +G      TY+AT E  + V         +    D  +T+
Sbjct: 699 VALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILADGDETL 751

Query: 564 LGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKK 619
           +G  G  LSGGQK R+++ARA+  + +V +LD+  SA+D E  +  I     K   L+K 
Sbjct: 752 VGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLLKN 811

Query: 620 KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF-GNPLSELSQLLNEKSTINE 678
           K  T+I   + +S ++ S+ +  L  DG +VE G F  +   +  S+L +L+ E  + N 
Sbjct: 812 K--TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECESENT 868

Query: 679 R---NPNEKPAETPE--QESQKNAANESI 702
           +    P +   + P   ++ + NA  E +
Sbjct: 869 KAKIEPVDSEIKAPVNLEDVECNAMEEEV 897

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 133/506 (26%), Positives = 229/506 (45%), Gaps = 74/506 (14%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            + ++K ++H    FFD+  +G +++R   D   V + +   +   F  L+          
Sbjct: 1172 NSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLIT 1231

Query: 250  SISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTV 305
             I+P+     +F    + +   + G +    SR+L+         + +   E  +G+ TV
Sbjct: 1232 LITPQFLGVAIF----IAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTV 1287

Query: 306  QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVL-H 364
            +A+  E R ++   N+ K   N        N   F +  S   +SF   +  G++++L  
Sbjct: 1288 RAYGDESRFMRE--NLEKIDEN--------NKPFFYMWVSNRWLSFRTQII-GAFVILGA 1336

Query: 365  GGLSIGDLTAY--------MMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELT--DRIP 414
            GG SI ++           + Y      A   L  FY +    + +  R+ E    D+ P
Sbjct: 1337 GGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEP 1396

Query: 415  M----ISPTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSG 469
                 + P       P  G+IE  +VS  Y P  P  ++ K+++F ++  S V IVG +G
Sbjct: 1397 YNEGTVEPPADW---PENGKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTG 1451

Query: 470  RGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITY 529
             GKSTI + L ++ +P  G I +D  DI  ++ + LRR I I+ Q+P L +G+IR N+  
Sbjct: 1452 AGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLDP 1511

Query: 530  GLTYE-------------ATAEEIRRV-------TKQCFCHNFITKFPDQYQTILGPNGT 569
               Y               + EE+ +V       T      NF      +Y    G  G+
Sbjct: 1512 YTQYSDKEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEG--GS 1569

Query: 570  LLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYT----FGKLMKKKEVTII 625
             +S GQ+Q + +AR+LL KP +++LDEAT+++D ES+  I  T    FG        TI+
Sbjct: 1570 NISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFGN------STIL 1623

Query: 626  SIAHRLSTIRRSEIVIVLGNDGSVVE 651
            +IAHRL ++   + ++V+  D   VE
Sbjct: 1624 TIAHRLRSVIDYDKILVM--DAGEVE 1647

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 100/406 (24%), Positives = 180/406 (44%), Gaps = 47/406 (11%)

Query: 297  EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV-- 354
            E F  ++ ++ F  E+       N   D++ + +E  +I   L  +  S     F +   
Sbjct: 626  ETFQAIRIIKFFSWEK-------NFENDIHKIREEELYI-LLLRCLVWSFSTFIFFISPT 677

Query: 355  ----LAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFG-----LSSFYSEIMQGVGAASR 405
                L++  Y+ +       +LT+ + +T L+  A+       +++  S ++Q   +  R
Sbjct: 678  IVTSLSFAYYIFIQKQ----ELTSPVAFTALSLFALLKIPLDQMANMLSYVVQSKVSLDR 733

Query: 406  LFELTDRIPMISPTTGKKY----IP-GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGS 460
            +    D      P T KKY    +P  K ++ FKN + ++     S   ++L+   + G 
Sbjct: 734  VQTFLDE-----PDT-KKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQ 787

Query: 461  NVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISK---LNSKSLRRHIGIVQQEPI 517
               ++GP+G GK+++   LL     T G I +   D      + S      I    Q   
Sbjct: 788  LNVVIGPTGSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAW 847

Query: 518  LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQ 577
            L++ ++R+NI +   Y     +   V         I    D   T +G  G  LSGGQKQ
Sbjct: 848  LLNDTVRNNILFNSPYNKDRYDAAIVAAGLKRDFEILAAGDL--TEIGERGITLSGGQKQ 905

Query: 578  RIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TI 634
            RI++ARAL      ++LD+  SA+D  + + I  N   G LM+ +  T + ++H ++ T+
Sbjct: 906  RISLARALYSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGR--TCVLVSHNIALTL 963

Query: 635  RRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERN 680
            + + +V++L N G V + G   TL         +L+  KS+I  RN
Sbjct: 964  KNASLVVMLKN-GRVADQGDPVTLLNKGALGEDELV--KSSILSRN 1006

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 134/498 (26%), Positives = 228/498 (45%), Gaps = 45/498 (9%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAF 258
            FF+   +G +++R  +D Y    ++ R+ +Q   +  K +           ++    +  
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVIF--------TITVICATTWQ 1092

Query: 259  LLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAFVAEQR 313
             +F   P+ +  +Y+ +     SR+L+     +TR       +E   G+ TV+ + ++Q+
Sbjct: 1093 FIFIIIPLGVCYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 314  EIKRYNNVIKDVYNVGKESAF---INAKLFTITSSLGDMSFLLVLAYGSYLVL---HGGL 367
                 N    D       SAF   INA  + +   L  +  +++L   +  V     G L
Sbjct: 1151 RFSHINQCRID----NNMSAFYPSINANRW-LAYRLELIGSIIILGAATLSVFRLKQGTL 1205

Query: 368  SIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPG 427
            + G     + Y       +  +     E+   + +  R+ E  D +   +P T + ++P 
Sbjct: 1206 TAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYAD-LKSEAPLTIEGHMPP 1264

Query: 428  K-----GEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
            K     G+I+F N S  Y  RP    + K +N  I+P   + IVG +G GKS++   L +
Sbjct: 1265 KEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFR 1322

Query: 482  YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR 541
              + +AG I +DG  I+++    LR  + I+ Q+  +  GS+R+NI    T + T E I 
Sbjct: 1323 MIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI--DPTNQYTDEAIW 1380

Query: 542  RVTKQCFCHNFITKFP-DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
            R  +       +     D     L   G  LS GQ+Q + +ARA+L    +LILDEAT+A
Sbjct: 1381 RALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAA 1440

Query: 601  LDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG 660
            +DVE++  +  T     K +  TI++IAHRL+TI  S+ +IVL N G+V E      L  
Sbjct: 1441 VDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLS 1497

Query: 661  NPLSELSQLLNEKSTINE 678
            N  S    L  E   +NE
Sbjct: 1498 NSESLFHSLCAEAGLVNE 1515

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 144/316 (45%), Gaps = 52/316 (16%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + +F +  +P  ++  K++NF+ + G   C+VG  G GK+ + S +L       G  TV 
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKGFATVH 691

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G              +  V Q P +M+G++ +NI +G  Y+   E   +  K C     +
Sbjct: 692 GS-------------VAYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACALTIDL 736

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD----------V 603
               D  +T++G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D          V
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 604 ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
              + + +T  +L+   +V+ +SIA            + L ++G +++ G +  +  +  
Sbjct: 797 LGPNGLLHTKTRLLATNKVSALSIADS----------VALLDNGEIIQKGTYDEITKDAD 846

Query: 664 SELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKD 723
           S L +LLN+    N    N+        +S KN+  ES + V  E E LQ          
Sbjct: 847 SPLWKLLNDYGKKNNNKRNDSG------DSSKNSVRESSIPVEGELEQLQK--------- 891

Query: 724 ILDKQPFPDKSSINLK 739
            LD   F +  +++L+
Sbjct: 892 -LDDLDFGNSDAVSLR 906

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 142/511 (27%), Positives = 242/511 (47%), Gaps = 51/511 (9%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  I     FF+   VG +I+R  SD   V  ++    S  FK++L             P
Sbjct: 1060 KSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMP 1119

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
                F +F     +    ++  L R+  R +  +   +  +  E  +G   + A+   +R
Sbjct: 1120 WFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFER 1179

Query: 314  EIK------RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA-YGSYLVLHGG 366
             I       +YN  +  V+N    + +++ +L TI +++   + +L LA   +   L  G
Sbjct: 1180 FIYLNYEKIQYN--VDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSG 1237

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKY-- 424
            + +G L +Y +  E+TGS  + + +  + I   + +  R+ E  +  P       +K   
Sbjct: 1238 M-VGLLMSYSL--EVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPD 1293

Query: 425  --IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
               P KG IEFKN S  Y       +  ++N KIEP   V IVG +G GKST++  L + 
Sbjct: 1294 ENWPSKGGIEFKNYSTKYRENL-DPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRI 1352

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             +PT G I +DG DIS +    LR H+ I+ Q+     G+++ N+     Y  + +E++R
Sbjct: 1353 LEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKR 1410

Query: 543  VTKQCFCHNFITKF-----------------PDQYQTILGPNGTLLSGGQKQRIAIARAL 585
              +Q      + K                   D     +  NG+ LS GQ+Q + +ARAL
Sbjct: 1411 AVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARAL 1470

Query: 586  LKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
            L +  +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL +
Sbjct: 1471 LNRSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-D 1527

Query: 646  DGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
             GSV E       F +P    S+LL++K++I
Sbjct: 1528 QGSVRE-------FDSP----SKLLSDKTSI 1547

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 119/468 (25%), Positives = 216/468 (46%), Gaps = 74/468 (15%)

Query: 297 EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV-- 354
           E  + +K+++ +  E+  + R N+V  D+          N +   I S+L   ++  V  
Sbjct: 477 ELLNAIKSIKLYAWEEPMMARLNHVRNDM-------ELKNFRKIGIVSNLIYFAWNCVPL 529

Query: 355 LAYGSYLVLHGGLSIGDLTAYMMYTELT-----GSAVFGLSSFYSEIMQGVGAASRL--F 407
           +   S   L    S   L+  +++  L+      SA++ + S  + I++   +  RL  F
Sbjct: 530 MVTCSTFGLFSLFSDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSF 589

Query: 408 ELTDRI-----PMISPTTGKKYIPGKGEIEFKNVSFAYPTRP------------------ 444
            L+D I       I P+  ++ +P    IE  N++F + ++                   
Sbjct: 590 LLSDEIDDSFIERIDPSADERALPA---IEMNNITFLWKSKEVLTSSQSGDNLRTDEESI 646

Query: 445 --GSQI-FKSLN-FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKL 500
              SQI  K+++ F+ + G  VC+VG  G GKST       + K   G +         +
Sbjct: 647 IGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKST-------FLKAILGQLPCMSGSRDSI 699

Query: 501 NSKSLRRH--IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPD 558
             K + R   +    QE  +M+ S+R+NI +G  ++    ++    K C     +   PD
Sbjct: 700 PPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDL--TIKACQLLPDLKILPD 757

Query: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTF-GKL 616
             +T++G  G  LSGGQK R+++ARA+  + ++ +LD+  SA+D E S++ I Y   GK 
Sbjct: 758 GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKT 817

Query: 617 MKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG--NPLSELSQLLNE-K 673
              K  TII   + +S ++ S+++  L N G +VE G ++ +    N  S+L +LL E  
Sbjct: 818 ALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKLKKLLEEFD 876

Query: 674 STINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDE 721
           S I+  N         E + Q    +ES VD  L+ ++ +++  ++DE
Sbjct: 877 SPIDNGN---------ESDVQTEHRSESEVDEPLQLKVTESE--TEDE 913

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 132/527 (25%), Positives = 244/527 (46%), Gaps = 78/527 (14%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            + ++ K +H    FFD    G +++R   D   + + +T  +   F +L+          
Sbjct: 1139 NMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILIT 1198

Query: 250  SISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQFSGVK 303
             I+P+      F +  +++S +Y+  G      SR+L+     +   + +   E   GV 
Sbjct: 1199 FITPQ------FLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVT 1252

Query: 304  TVQAFVAE----QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGS 359
            T++AF  E    Q  +++ +   K  + +   + ++  ++  I S       L++   G 
Sbjct: 1253 TIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGS-------LVIFGAGL 1305

Query: 360  YLVLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
            +++ +      G++   LT  + +TE        L   YSE+   + +  R+ E   +I 
Sbjct: 1306 FILFNIDHIDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYM-KIE 1360

Query: 415  MISPTTGKKYIP-----GKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPS 468
               P    K +P       G+IE  ++S  Y P  P  ++  +++F ++  S + IVG +
Sbjct: 1361 Q-EPYNQHKEVPPSQWPQDGKIEVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRT 1417

Query: 469  GRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDN-- 526
            G GKSTI + L ++ +P  G I +D  DIS ++ + LRR I I+ Q+P L SG+I+ N  
Sbjct: 1418 GAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLD 1477

Query: 527  -------------------ITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
                               I+   +++    E    T      N I KF D    +    
Sbjct: 1478 PYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSEN-INKFLDLSSEV-SEG 1535

Query: 568  GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
            G+ LS GQ+Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K  +    TI++I
Sbjct: 1536 GSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTI 1593

Query: 628  AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
            AHRL ++   + ++V+ + G V E       + +P    S LLN++S
Sbjct: 1594 AHRLRSVIDYDKILVM-DAGEVKE-------YDHP---YSLLLNKQS 1629

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 137/288 (47%), Gaps = 24/288 (8%)

Query: 450 KSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISK---LNSKSLR 506
           K LN + + G    ++GP+G GK+++   LL       G I V   +  +   +++    
Sbjct: 713 KDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKIVVPALEPRQELVVDANGTT 772

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQC-FCHNF-ITKFPDQYQTIL 564
             I    Q   L++ +I+ NI +   +       + V + C    +F I K  D   T +
Sbjct: 773 NSIAYCSQGAWLLNDTIKHNILFNSPFNEA--RYKAVVEACGLKRDFEILKAGDL--TEI 828

Query: 565 GPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEV 622
           G  G  LSGGQKQR+++ARAL      ++LD+  SA+D  + S I  N   G LM+ +  
Sbjct: 829 GEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDR-- 886

Query: 623 TIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGK-----FKTLFG-NPLSELSQLLNEKST 675
           T I ++H ++ T+R +E+V++L  DG + + G       K LFG + L + S L    S+
Sbjct: 887 TCILVSHNIALTLRNAELVVLL-EDGRIKDQGDPIDMLQKGLFGEDELVKSSILSRANSS 945

Query: 676 IN-ERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEK 722
            N     N   +  P  + QK + N +      E   LQ  +R++ E+
Sbjct: 946 ANLATKSNTSLSNLPAVKEQKISVNNN--SPQFESTKLQKPMRTEAER 991

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 133/526 (25%), Positives = 248/526 (47%), Gaps = 76/526 (14%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            + ++ K +H    FFD    G +++R   D   + + +T  +   F +L+          
Sbjct: 1139 NMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILIT 1198

Query: 250  SISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQE----ATGQLTRVSEEQFSGVK 303
             I+P+      F +  +++S +Y+  G      SR+L+     +   + +   E   GV 
Sbjct: 1199 FITPQ------FLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVT 1252

Query: 304  TVQAFVAE----QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGS 359
            T++AF  E    Q  +++ +   K  + +   + ++  ++  I S       L++   G 
Sbjct: 1253 TIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGS-------LVIFGAGL 1305

Query: 360  YLV-----LHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
            +++     L  G++   LT  + +TE        L   Y+E+   + +  R+ E  +   
Sbjct: 1306 FILFNINHLDSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERVKEYMEIEQ 1361

Query: 415  MISPTTGKKYIP-----GKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPS 468
               P    K +P       G+IE  ++S  Y P  P  ++ K+++F ++  S + IVG +
Sbjct: 1362 --EPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRT 1417

Query: 469  GRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT 528
            G GKSTI + L ++ +P  G I +D  DIS ++ + LRR I I+ Q+P L SG+I+ N+ 
Sbjct: 1418 GAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLD 1477

Query: 529  -YG-LTYEATAEEIRRV------------TKQCFCHNF------ITKFPDQYQTILGPNG 568
             Y   +     E ++RV            T++    N       + KF D    +    G
Sbjct: 1478 PYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKFLDLSSEV-SEGG 1536

Query: 569  TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
            + LS GQ+Q + +AR+LL+ P +++LDEAT+++D  S++ I  T  K  +    TI++IA
Sbjct: 1537 SNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRKEFQGS--TILTIA 1594

Query: 629  HRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
            HRL ++   + ++V+ + G V E       + +P    S LLN++S
Sbjct: 1595 HRLRSVIDYDKILVM-DAGEVKE-------YDHP---YSLLLNKQS 1629

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 116/236 (49%), Gaps = 15/236 (6%)

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           P      F+N + ++         K LN + + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 486 TAGTITVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
            +G + V   +  +   +++      I    Q   L++ ++++NI +   +       + 
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEA--RYKA 806

Query: 543 VTKQC-FCHNF-ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
           V + C    +F I K  D   T +G  G  LSGGQKQR+++ARAL      ++LD+  SA
Sbjct: 807 VVEACGLKRDFEILKAGDL--TEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 601 LDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIG 653
           +D  + S I  N   G LM+ +  T I ++H ++ T+R +E+V++L  DG V + G
Sbjct: 865 VDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLL-EDGRVKDQG 917

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 133/496 (26%), Positives = 233/496 (46%), Gaps = 53/496 (10%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKA-----LLCXXXXXXXXXSISP 253
            FF+   +G +++R  +D Y    V+ R+ +Q   +  K      ++C             
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGVICVTTWQ-------- 1094

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAF 308
                  +F   P+ +  +Y+ +     SR+L+     +TR       +E   G+ T++ +
Sbjct: 1095 -----FIFVIVPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGIVTIRGY 1148

Query: 309  VAEQREIKRYNNVIKDVYNVGKESAF---INAKLFTITSSLGDMSFLLVLAYGSYLVL-- 363
              +Q+   + N    D       SAF   +NA  + +   L  +  +++L   +  V+  
Sbjct: 1149 -GQQKRFSQINQCRVD----NNMSAFYPSVNANRW-LAYRLELIGSIIILGAATLSVMRL 1202

Query: 364  -HGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD---RIP-MISP 418
              G L+ G +   + Y      ++  +     E+   + +  R+ E  D     P +I  
Sbjct: 1203 KQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSEAPEIIED 1262

Query: 419  TTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
               ++  P +G+I+F++ S  Y  RP    + K +NF I+P   + IVG +G GKS++  
Sbjct: 1263 HRPQETWPEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTL 1320

Query: 478  LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA 537
             L +  + + G I +D  DIS +    LR  + I+ Q+  +  G+IR+NI    T + T 
Sbjct: 1321 ALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNQYTD 1378

Query: 538  EEIRRVTKQCFCHNFI-TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
            E+I RV +     + I T   D   T L   G+ LS GQ+Q + +ARALL    +L+LDE
Sbjct: 1379 EQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDE 1438

Query: 597  ATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFK 656
            AT+A+DVE++  +  T     K +  TI++IAHR++TI  ++ ++VL N GS+ E  + K
Sbjct: 1439 ATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN-GSIKEFDEPK 1495

Query: 657  TLFGNPLSELSQLLNE 672
             L  N  S    L  E
Sbjct: 1496 KLLENKSSLFYSLCEE 1511

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/458 (22%), Positives = 196/458 (42%), Gaps = 66/458 (14%)

Query: 266 VMLSSMYFGRLIRDNSRKLQEATGQL----TRVSEEQFSGVKTVQAFVAE-----QREIK 316
           +++  M     +    +KLQ++  Q     TRV  E  + +K+++ +  E     + E  
Sbjct: 453 ILVIMMPLNSFLMKTQKKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENV 512

Query: 317 RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYM 376
           R N  +K++  +G   A ++ + F +   L   S   V  Y     L   L    LT + 
Sbjct: 513 RNNKELKNLTKLGCYMALMSFQ-FNVVPFLVSCSTFAVFVYTEDRPLTTDLVFPALTLF- 570

Query: 377 MYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL----------TDRIPMISPTTGKKYIP 426
               L    +  + +  + +++   +  RLF              R+P ++         
Sbjct: 571 ---NLLHFPLMVIPNVLTALIECSVSVGRLFSFLTNEELQKDSVQRLPKVTEIGDVAINV 627

Query: 427 GKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           G       + +F +  +P  ++  K++NF+ + G   CIVG  G GKS +   +L     
Sbjct: 628 GD------DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSILGDLFR 681

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
             G  T+ G             ++  V Q   +M+G+++DNI +G  Y+A  E   +  K
Sbjct: 682 VKGFATIHG-------------NVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIK 726

Query: 546 QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE- 604
            C     ++   D  QT++G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   
Sbjct: 727 ACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHV 786

Query: 605 SESAINYTFG---------KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKF 655
           +   I +  G         K++   +V+++S+A  +S          L  +G +V+ G +
Sbjct: 787 ARHLIEHVLGPNGLLHTKTKVLATNKVSVLSVADSVS----------LLENGEIVQQGSY 836

Query: 656 KTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQES 693
             +  +  S+L++L+ E    +  NP    A TP   S
Sbjct: 837 DEIMKDGASQLNKLIMEYGKKSNGNPASSNAITPASSS 874

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 147/562 (26%), Positives = 249/562 (44%), Gaps = 73/562 (12%)

Query: 124  SKSEDAELGSADLSIESSELPP-----IAFGLSLYEFLGCIGAALL-IGTAANFGXXXXX 177
            S S +A L S   +I SS  PP       + LS+Y  +G I A L  I T A F      
Sbjct: 1013 SFSMEASLLSKGKTIGSSN-PPKNRHTAVYYLSMYFLIGIIQALLGGIKTMATF------ 1065

Query: 178  XXXXXXXXXXXXSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 237
                        + ++   +H +  FFD   VG +++R   D   V + +   +      
Sbjct: 1066 -LSGLQASKKIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFC 1124

Query: 238  LLCXXXXXXXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEE 297
            L+           I+P      +            +    R+  R        + +   E
Sbjct: 1125 LIQCLSIIFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSE 1184

Query: 298  QFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAY 357
              +GV T++AF  E+R I      ++++  + +     N   F ++ ++   +F + +  
Sbjct: 1185 TLAGVCTIRAFGDEKRFI------LENMDKIDQN----NRAFFYLSVAVKWFAFRVDII- 1233

Query: 358  GSYLVLHGG----LSIGDLTAYMMYTELTGSAVF-----GLSSFYSEIMQGVGAASRLFE 408
            G+++VL  G    L+IGD+ + +    LT S +F      L   YS     + +  RL E
Sbjct: 1234 GAFIVLGSGSFILLNIGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKE 1293

Query: 409  LT---------DRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPG 459
             +         + I  +  +      P  G+IE  N+S  Y +     + K+++F ++P 
Sbjct: 1294 YSGIEQENYNENHIQALQNSLW----PEHGKIEVDNLSLRYASNL-PPVIKNVSFTVDPQ 1348

Query: 460  SNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILM 519
            + + IVG +G GKSTI + L +  KP  G I +DG DISK++  +LRR I I+ Q+PIL 
Sbjct: 1349 TKIGIVGRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILF 1408

Query: 520  SGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT------------KFPDQYQTILG-- 565
            +G+I+ N+     Y+   E  RR+ K     N I+             F   +   L   
Sbjct: 1409 TGTIKSNLD---PYDEYDE--RRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLR 1463

Query: 566  ----PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKE 621
                  G  LS G+KQ + IAR+LL++P +++LDEATS++D +S+  I         +  
Sbjct: 1464 TEIVEGGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSRS- 1522

Query: 622  VTIISIAHRLSTIRRSEIVIVL 643
             TI++IAHRL ++   + V+V+
Sbjct: 1523 -TILTIAHRLRSVIDYDKVLVM 1543

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 118/257 (45%), Gaps = 31/257 (12%)

Query: 426 PGKGEIEFKNVSFAYPTRPGS-QIFK--SLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
           P K +I+FK  +  +         F+   LN     G    I+G +G GKS +   LL  
Sbjct: 657 PDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLGE 716

Query: 483 YKPTAGTITVDGQD-----ISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA 537
               +G+I V G +     I  LN   L        Q   L++G++R+NI +   Y+   
Sbjct: 717 LYLLSGSIIVPGLEPRHDMIPDLNG--LTNSFAYCSQSAWLLNGTVRNNIIFNGVYDEN- 773

Query: 538 EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597
              + V   C     +   P    T +G  G  LSGGQKQRI++ARA+      ++LD+ 
Sbjct: 774 -RYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDC 832

Query: 598 TSALDVESESAINYTF-----GKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGN-----D 646
            SA+D  S +AI + +     G LMK +  T I + H +S  IR++   ++L N      
Sbjct: 833 LSAVD--SHTAI-WIYEICITGLLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQ 887

Query: 647 GSVVEI---GKFKTLFG 660
           G++ E+   G FK  FG
Sbjct: 888 GTITELKNKGVFKEDFG 904

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 127/499 (25%), Positives = 227/499 (45%), Gaps = 44/499 (8%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            +++ + ++    FFDN  +G +++R   D  V+   +   +   F   +           
Sbjct: 1138 KLLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVF 1197

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTVQ 306
            I+P+     +F    ++ SS+  G L    SR+L+     +   + +   E  SG+ T++
Sbjct: 1198 ITPKFLIIAIF----IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIR 1253

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG- 365
            AF  E + +K   + I +          +N+ L      LG ++   V   G++++L+  
Sbjct: 1254 AFGNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAIT---VFGSGAFILLNAD 1310

Query: 366  ----GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD--RIPMISP- 418
                GL+   LT  + +TE        +  FYS +   + +  RL E  +     +  P 
Sbjct: 1311 KIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPG 1366

Query: 419  -TTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIA 476
              T  +  P +G I F N S  Y P  P   + K LN KI+ GS + +VG +G GKSTI 
Sbjct: 1367 AITPSENWPVQGAITFANYSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTGAGKSTII 1424

Query: 477  SLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
            S L ++   ++G I +D  DIS++N + LR  + I+ Q+P L  G+IR N+     YE  
Sbjct: 1425 SALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYENK 1484

Query: 537  AEEIRRVTKQCFCHNFITKF-----------PDQYQTILGP---NGTLLSGGQKQRIAIA 582
                  V       +++               + +  +  P    G  LS GQ+Q I +A
Sbjct: 1485 DIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLICLA 1544

Query: 583  RALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIV 642
            R++L    +++LDEAT+++D +S+  +  T      +K  TI++IAHR+ ++   + ++V
Sbjct: 1545 RSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKILV 1602

Query: 643  LGNDGSVVEIGKFKTLFGN 661
            L + G  +E      L  N
Sbjct: 1603 L-DAGQALEFDHPYVLLQN 1620

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 112/427 (26%), Positives = 199/427 (46%), Gaps = 61/427 (14%)

Query: 256 SAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREI 315
           +A ++FF P     +++  +LI    R+    T Q  +   E F  ++ +++F  E    
Sbjct: 545 TAVIIFFIP----FNVFLTKLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWE---- 596

Query: 316 KRYNNVIKDVYNV-GKESAFINAKLFTITSSLGDMSFLL------VLAYGSYLVLHGGLS 368
              NN+I+ +  +  KE + +     +IT S+  + + L       L++  Y+++     
Sbjct: 597 ---NNIIQKILGLRNKEISVLKRN--SITWSINALVWYLSPTIITTLSFSYYILVDKQ-- 649

Query: 369 IGDLTAYMMYTELTGSAVFGL--------SSFYSEIMQGVGAASRLFELTDRIPMISPTT 420
             DLT  + +T L   A+F L        S+  + + Q   +  R+    ++   +  TT
Sbjct: 650 --DLTTPVAFTAL---ALFNLLKAPLDQLSNTINFLTQSKVSLDRI----EKFLSVKETT 700

Query: 421 GKKYIP---GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
             + +     +  + F   +  +     S   +++N + E G    ++GP+G GK+++  
Sbjct: 701 KFENLSVDSSQNRLAFSGATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLM 760

Query: 478 LLLKYYKPTAGTITVDGQDISKLN----SKSLRRHIGIVQQEPILMSGSIRDNITYGLTY 533
            LL      +G + V   + SK N    S +L   I    Q P + + +IR+NI + + Y
Sbjct: 761 ALLGELHLFSGKVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGY 819

Query: 534 EATAEEIRRVTKQC-FCHNF-ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNV 591
           +    E   V   C    +F I    D+  TI+G  G+ LSGGQKQRI++ARAL  K   
Sbjct: 820 DKDRYE--NVVIACGLERDFQILNLGDK--TIVGDKGSCLSGGQKQRISLARALYSKSRH 875

Query: 592 LILDEATSALDVESESAINYTF---GKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDG 647
           LILD+  SA+D  S   I Y     G LM+ +  T I ++H +S TI+++  V ++ N G
Sbjct: 876 LILDDCLSAVDSHSAKWI-YNVCITGPLMQGR--TCILVSHNVSLTIKKASKVFMIEN-G 931

Query: 648 SVVEIGK 654
            +V  G+
Sbjct: 932 YIVASGR 938

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 131/494 (26%), Positives = 223/494 (45%), Gaps = 37/494 (7%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQ----KVSDGFKALLCXXXXXXXXXSISPE 254
            FF+   +G +++R  +D Y    V+ R+ +Q     V   F  ++           I P 
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIVICFTTWQFIFIIIP- 1096

Query: 255  LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQRE 314
            L  F +++         YF R  R+  R        +    +E   G+ T++ +  + R 
Sbjct: 1097 LGVFYIYY-------QQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRF 1149

Query: 315  IK----RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
                  R +N +   Y     + ++  +L TI    G +  L       + +  G L+ G
Sbjct: 1150 THINQCRVDNNMSAFYPSVNANRWLAYRLETI----GSLIILGAATLSVFRLRQGTLTAG 1205

Query: 371  DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD---RIP-MISPTTGKKYIP 426
             +   + Y      ++  +     E+   + +  R+ E +D     P +I      +  P
Sbjct: 1206 MVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWP 1265

Query: 427  GKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
             +G+I+F++ S  Y  RP    I K +N  I+P   V IVG +G GKS++   L +  + 
Sbjct: 1266 DEGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEA 1323

Query: 486  TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
            ++G I +D   I+++    LR  + I+ Q+  +  G++R+NI    T E T E+I  V  
Sbjct: 1324 SSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLA 1381

Query: 546  QCFCHNFITKFPDQ-YQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
                 + I    D+     L   G  LS GQ+Q + +ARALL    +L+LDEAT+A+DVE
Sbjct: 1382 LSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVE 1441

Query: 605  SESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLS 664
            ++  I  T     K +  TI++IAHR++TI  S+ +IVL N G++ E    + L  NP S
Sbjct: 1442 TDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENPSS 1498

Query: 665  ELSQLLNEKSTINE 678
                L  E    N+
Sbjct: 1499 LFYSLCQEAGLQNK 1512

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 131/270 (48%), Gaps = 35/270 (12%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + +F +  +P  ++  K++NF+ + G   CIVG  G GKS +   +L       G  T+ 
Sbjct: 628 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIH 687

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G             ++  V Q   +M+G++++NI +G  Y+   +  ++  K C     +
Sbjct: 688 G-------------NVAYVSQVAWIMNGTVKENILFGHKYDE--DFYQKTIKACALTIDL 732

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD----------V 603
               D  QT++G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D          V
Sbjct: 733 AVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHV 792

Query: 604 ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
              + + +T  K++   +V+++SIA  +S +   EIV      G+  EI K  +   +PL
Sbjct: 793 LGPNGLLHTKTKVLATNKVSVLSIADSVSLLENGEIV----QQGTYDEIMKDDS---SPL 845

Query: 664 SELSQLLNEKSTINERN--PNEKPAETPEQ 691
           S+L     +KST +  N  P+   +   EQ
Sbjct: 846 SKLITEYGKKSTDSTSNVTPSTSSSNIHEQ 875

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 230/509 (45%), Gaps = 46/509 (9%)

Query: 194 KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
           K  I     FF+   VG +I+R  SD   V  S+    S  FK++L             P
Sbjct: 489 KSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMP 548

Query: 254 ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
               F +F     +    ++  L R+  R +  +   +  +  E  +G   + A+   +R
Sbjct: 549 WFLVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYER 608

Query: 314 EIK-RYNNV---IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
            I   Y+ +   I  V+N    + +++ +L TI +++   +    L   + +     LS 
Sbjct: 609 FIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLAT---ALLALATINTKNQLSS 665

Query: 370 GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKY----I 425
           G +   M Y+    S++  +      I   + +  R+ E  +  P       +K      
Sbjct: 666 GMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENW 725

Query: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           P +G IEFKN S  Y       + K +N  I+P   + IVG +G GKST++  L +  +P
Sbjct: 726 PSEGRIEFKNYSTKYRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEP 784

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
           + G I +D  +IS+L    LR ++ I+ Q+     G++R N+     Y  + +E++R  +
Sbjct: 785 SEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIE 842

Query: 546 QCFCHNFITKF------------------PDQYQTILGPNGTLLSGGQKQRIAIARALLK 587
                + + K                    D     +  NG+ LS GQ+Q + +ARALL 
Sbjct: 843 LAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLS 902

Query: 588 KPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDG 647
              +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL + G
Sbjct: 903 HSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKG 959

Query: 648 SVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
           +V E       F +P    S+LL++K +I
Sbjct: 960 NVKE-------FDSP----SKLLSDKGSI 977

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 146/302 (48%), Gaps = 32/302 (10%)

Query: 420 TGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
           T ++ I G  +I  KN+                +F+ + G  +C+VG  G GKST     
Sbjct: 70  TDEESIMGSSQIALKNIE---------------HFEAKRGDLICVVGRVGAGKST----- 109

Query: 480 LKYYKPTAGTITVDGQDISKLNSKSLRR--HIGIVQQEPILMSGSIRDNITYGLTYEATA 537
             + K   G +         L  K + R   +    QE  +M+ S+R+NI +G  ++   
Sbjct: 110 --FLKAILGQLPCMSGSKESLAPKLIIRASSLAYCSQESWIMNASVRENILFGHKFDKAY 167

Query: 538 EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597
            ++    K C     +   PD  +T++G  G  LSGGQK R+++ARA+  + ++ +LD+ 
Sbjct: 168 YDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDI 225

Query: 598 TSALDVE-SESAINYTF-GKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKF 655
            SA+D E S++ I +   GK    K  TII   + +S ++ S+++  L N G +VE G +
Sbjct: 226 LSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNY 284

Query: 656 KTLFG--NPLSELSQLLNEKST-INERNPNEKPAETPEQESQKNAANESIVDVVLEEEIL 712
           +++    N  S+L +LL E  T I+  N +++  +   +  ++      +V+   E+E+ 
Sbjct: 285 ESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRTDQSPERDEEETLQLKVVESEAEDEVA 344

Query: 713 QN 714
            N
Sbjct: 345 TN 346

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 130/495 (26%), Positives = 224/495 (45%), Gaps = 39/495 (7%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAF 258
            FF+   +G +++R  +D Y    ++ R+ +Q   +  K +                    
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAVICATTWQ-------- 1090

Query: 259  LLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAFVAEQR 313
             +F   P+ +  +Y+ +     SR+L+     +TR       +E   G+ T++ +  E+R
Sbjct: 1091 FIFVIIPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGITTIRGYNQEKR 1149

Query: 314  --EIK--RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
               I   R +N +   Y     + ++  +L      +G +  L       + +  G L+ 
Sbjct: 1150 FGHINQCRVDNNMSAFYPSINANRWLAFRL----ELIGSIIILGAATLSIFRLKEGTLTP 1205

Query: 370  GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFE---LTDRIP-MISPTTGKKYI 425
            G +   + Y       +  +     E+   + +  R+ E   L    P ++      +  
Sbjct: 1206 GMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMW 1265

Query: 426  PGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P +G+I+F+N S  Y  RP    + K++N  I P   V IVG +G GKS++   L +  +
Sbjct: 1266 PTEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIE 1323

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
             TAG I +DG  I+++    LR  + I+ Q+  +  G++R+NI    T   T EEI RV 
Sbjct: 1324 ATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVL 1381

Query: 545  KQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
            +       +     D     L   G+ LS GQ+Q + +ARALL    +L+LDEAT+A+DV
Sbjct: 1382 ELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1441

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
            E++  +  T     K +  TI++IAHRL+TI  S+ +IVL + G +VE      L   P 
Sbjct: 1442 ETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKPE 1498

Query: 664  SELSQLLNEKSTINE 678
            S    L NE    N+
Sbjct: 1499 SLFYSLCNEAGLTNK 1513

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/446 (23%), Positives = 194/446 (43%), Gaps = 38/446 (8%)

Query: 282 RKLQEATGQL----TRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKD--VYNVGKESAF- 334
           RKLQ+   Q     T V  E  + +K+++ +  E     + N+V  D  ++N+ K   + 
Sbjct: 467 RKLQKQQMQFKDERTGVISEILNNIKSLKLYAWEVPYQTKLNHVRNDKELHNLTKLGCYM 526

Query: 335 -INAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFY 393
            + +  F I   L   +   V  Y     L   L    LT +     L    +  + +  
Sbjct: 527 AVTSFQFNIVPFLVSCATFAVFVYTENKPLTTDLVFPALTLF----NLLSFPLMVVPNVI 582

Query: 394 SEIMQGVGAASRLFE-LTDRIPMISPTTGKKYIPGKGEIEFK---NVSFAYPTRPGSQI- 448
           +  ++   + +RLF  LT+             +  KG++      N +F +  +P  ++ 
Sbjct: 583 TSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEYKVA 642

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
            K++NF+ + G   CIVG  G GKS +   +L       G  TV G             +
Sbjct: 643 LKNINFQAKKGDLTCIVGKVGSGKSALIQSILGDLFRVKGFATVHG-------------N 689

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
           +  V Q P +M+G++++NI +G  Y+   E   +  K C     +    D  QT++G  G
Sbjct: 690 VAYVSQVPWIMNGTVKENILFGHKYDQ--EFYEKTIKACALTIDLGILVDGDQTLVGEKG 747

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK R+++ARA+  + +  +LD+  +A+D   S+  + +  G        T +  
Sbjct: 748 ISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKVLC 807

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAE 687
            +++S +  ++ + +L N G +V+ G ++ +  +  S L +L+ E      R  N+    
Sbjct: 808 TNKISVLSIADSITLLEN-GEIVQQGSYEEVNSDEDSPLFKLIKEYG----RKENKSKGS 862

Query: 688 TPEQESQKNAANESIVDVVLEEEILQ 713
           +    +   ++ E  + V  E E LQ
Sbjct: 863 STSLSTVTESSREQTIPVEDELEALQ 888

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 230/509 (45%), Gaps = 46/509 (9%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K  I     FF+   VG +I+R  SD   V  S+    S  FK++L             P
Sbjct: 1060 KSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMP 1119

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR 313
                F +F     +    ++  L R+  R +  +   +  +  E  +G   + A+   +R
Sbjct: 1120 WFLVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYER 1179

Query: 314  EIK-RYNNV---IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSI 369
             I   Y+ +   I  V+N    + +++ +L TI +++   +    L   + +     LS 
Sbjct: 1180 FIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLAT---ALLALATINTKNQLSS 1236

Query: 370  GDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKY----I 425
            G +   M Y+    S++  +      I   + +  R+ E  +  P       +K      
Sbjct: 1237 GMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENW 1296

Query: 426  PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
            P +G IEFKN S  Y       + K +N  I+P   + IVG +G GKST++  L +  +P
Sbjct: 1297 PSEGRIEFKNYSTKYRENLDP-VLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEP 1355

Query: 486  TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
            + G I +D  +IS+L    LR ++ I+ Q+     G++R N+     Y  + +E++R  +
Sbjct: 1356 SEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIE 1413

Query: 546  QCFCHNFITKF------------------PDQYQTILGPNGTLLSGGQKQRIAIARALLK 587
                 + + K                    D     +  NG+ LS GQ+Q + +ARALL 
Sbjct: 1414 LAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLS 1473

Query: 588  KPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDG 647
               +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL + G
Sbjct: 1474 HSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKG 1530

Query: 648  SVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
            +V E       F +P    S+LL++K +I
Sbjct: 1531 NVKE-------FDSP----SKLLSDKGSI 1548

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 146/302 (48%), Gaps = 32/302 (10%)

Query: 420 TGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
           T ++ I G  +I  KN+                +F+ + G  +C+VG  G GKST     
Sbjct: 641 TDEESIMGSSQIALKNIE---------------HFEAKRGDLICVVGRVGAGKST----- 680

Query: 480 LKYYKPTAGTITVDGQDISKLNSKSLRR--HIGIVQQEPILMSGSIRDNITYGLTYEATA 537
             + K   G +         L  K + R   +    QE  +M+ S+R+NI +G  ++   
Sbjct: 681 --FLKAILGQLPCMSGSKESLAPKLIIRASSLAYCSQESWIMNASVRENILFGHKFDKAY 738

Query: 538 EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597
            ++    K C     +   PD  +T++G  G  LSGGQK R+++ARA+  + ++ +LD+ 
Sbjct: 739 YDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDI 796

Query: 598 TSALDVE-SESAINYTF-GKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKF 655
            SA+D E S++ I +   GK    K  TII   + +S ++ S+++  L N G +VE G +
Sbjct: 797 LSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNY 855

Query: 656 KTLFG--NPLSELSQLLNEKST-INERNPNEKPAETPEQESQKNAANESIVDVVLEEEIL 712
           +++    N  S+L +LL E  T I+  N +++  +   +  ++      +V+   E+E+ 
Sbjct: 856 ESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRTDQSPERDEEETLQLKVVESEAEDEVA 915

Query: 713 QN 714
            N
Sbjct: 916 TN 917

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 237/508 (46%), Gaps = 64/508 (12%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            + + + +H    + D   +G +++R   D    + S+  ++++  + +L           
Sbjct: 987  KAVHRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESIRLML---FQTANIVG 1039

Query: 251  ISPELSAFLLFFTPPVMLSSMYFG-RLIRDNSRKLQEATGQLTRVSE--------EQFSG 301
            +      +L +F   + +  ++ G  LI D+ +       +L  +          E   G
Sbjct: 1040 VCVMCIIYLPWFA--IAIPFLFIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGG 1097

Query: 302  VKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL 361
            + T++++ +E+R + + + +I  +   G  S  +  +   I   L  + F L++      
Sbjct: 1098 MDTIKSYGSEERFLAKSDYLINKMNEAGYLSVALQ-RWVAIFLDLVAVCFALIITLLCVT 1156

Query: 362  -VLH-GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL--------FELTD 411
               H   +S+G L  Y++  +L G  + G+    ++    + +A RL         E   
Sbjct: 1157 RAFHISAVSVGVLLTYVL--QLPG-LLNGVLRALTQTENDMNSAERLVSYATELPLEAAY 1213

Query: 412  RIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGR 470
            R P +SP       P +G+IEFK+V F+Y  RPG  I  K L+  I+ G  + I G +G 
Sbjct: 1214 RRPEVSPPEN---WPSEGKIEFKHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGA 1268

Query: 471  GKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDN---- 526
            GKSTI S L +  + + G I +D  DISKL    LRR + I+ Q+P+L  G+IR N    
Sbjct: 1269 GKSTIMSALYRLNEISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPF 1328

Query: 527  ------------ITYGLTYEATAEEIR--RVTKQCFCHNFITKFPDQYQTILGPNGTLLS 572
                        +  G    A   +I+  +V K    H  + KF      ++   G   S
Sbjct: 1329 NEHDDDLLWDSLVRGGAIERAALNKIKNQKVDKDG-THADMFKF--HLDQLVEEEGANFS 1385

Query: 573  GGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKK-KEVTIISIAHRL 631
             G++Q +A+ RAL+++  VLILDEATS++D E++  I     +++K+  + TI+ IAHRL
Sbjct: 1386 LGERQLLALTRALVRQAKVLILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRL 1442

Query: 632  STIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            +TI   + ++VL   G V E  K K LF
Sbjct: 1443 NTILNYDRILVL-EKGEVAEFEKPKVLF 1469

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 103/211 (48%), Gaps = 20/211 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F  +   I+ G  + +VGP G GK++  + L  +   T G I V+G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + ++RDNI +G  Y+    E   V + C     +   P    T +G  G
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR + KK ++ + D+  SA+D    +  ++  F  L+K +  T I  
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNE--TRILA 788

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            H+LS + R+  VIVLG DGS  EIG    L
Sbjct: 789 THQLSLLERASRVIVLGTDGS-FEIGPVDVL 818

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 133/538 (24%), Positives = 240/538 (44%), Gaps = 72/538 (13%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            + +K+ +H    F D   +G +++R   D   +   +T+ V      L            
Sbjct: 931  KAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVR-----LFVYQTANIAGVI 985

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----------EEQF 299
            I        + + P   ++  + G +    +   Q +  ++ R+             E  
Sbjct: 986  I------MCIIYLPWFAIAVPFLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEVL 1039

Query: 300  SGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGS 359
            SG+ T++A+ +E R + + + +I  +   G     +  +  +I+  +  ++F L++   +
Sbjct: 1040 SGMDTIKAYKSENRFLMKSDFLINRMSEAGYLVVAVQ-RWVSISLDMIAVAFALII---T 1095

Query: 360  YLVLH-----GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
             L +         S+G L  Y++  +L G  + GL    ++    + +  R+      +P
Sbjct: 1096 LLCVTRQFDISAASVGVLLTYVL--QLPG-LLNGLLRAMTQAENDMNSVERIVNYATELP 1152

Query: 415  MISP-----TTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPS 468
              +       T ++  P  GE+ F NVS +Y  RPG   + K ++  I+ G  + I G +
Sbjct: 1153 QEAAYRKPEMTPQEPWPSNGEVVFDNVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRT 1210

Query: 469  GRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT 528
            G GKSTI S L +  +   G + +DG D SKL    LRR + I+ Q+P+L  GSIR N+ 
Sbjct: 1211 GAGKSTIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLD 1270

Query: 529  -YG----------LTYEAT--AEEIRRVTKQ--------CFCHNFITKFPDQYQTILGPN 567
             +G          L    T  AEE+ +V  Q           H F           +  +
Sbjct: 1271 PFGEREDEELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKF------HLDQEVEDD 1324

Query: 568  GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
            GT  S G++Q +A+ RAL+++  +LILDEATS++D E+++ I     +   +   TI+ I
Sbjct: 1325 GTNFSLGERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQEFNR--CTILCI 1382

Query: 628  AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKP 685
            AHRL TI   + ++VL N G+V E    ++LF    +   ++ ++     E  P E+P
Sbjct: 1383 AHRLKTILNYDRLVVLDN-GTVKEFDTPRSLFRIKDTIFREMCDKSGIKAEDFPGEQP 1439

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 141/310 (45%), Gaps = 33/310 (10%)

Query: 437 SFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQD 496
           +FA   +     FK+LNF+I+ G  V I G  G GKS++ + L  + K T G I  +G  
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG-- 616

Query: 497 ISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKF 556
                  SL     ++   P + + ++RDNI +G +++      + V + C     +   
Sbjct: 617 -------SL-----LLCGYPWIQNTTVRDNILFGSSFDDV--RYKEVIRVCALQADLDIL 662

Query: 557 PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFG 614
           P    T +G  G  LSGGQK RI +AR++ K  ++ + D+  SA+D      I      G
Sbjct: 663 PAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMG 722

Query: 615 KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
            L  K   T I   H+LS I R+  VI LG  GS  +IG  + L     S   +L+   +
Sbjct: 723 MLDGK---TRILATHQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLMEFST 777

Query: 675 TINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKDILDKQPFPDK- 733
                N  E+  +  E+   +N   E      LE++I +   +S  EK   D +    + 
Sbjct: 778 QTKSANQREEVDDHAEENLGQNCQQEI---AKLEKQISK---KSNSEKTTTDGRLISKEE 831

Query: 734 ---SSINLKI 740
              +SINLKI
Sbjct: 832 RAVNSINLKI 841

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 130/499 (26%), Positives = 226/499 (45%), Gaps = 44/499 (8%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            +Q+    +     FF+   VG +++R  SD   +       +S  F+++L          
Sbjct: 1069 NQMAHSVVMAPMSFFETTPVGRIVNRFSSDVNSIDEDFQHIISFFFRSML---DYLITIV 1125

Query: 250  SISPELSAFLLFFTPPVMLSSMYFGR-----LIRDNSRKLQEATGQLTRVSEEQFSGVKT 304
             I+  +  FLLF T  ++L   Y+ +     L R+  R    +   +  +  E   G   
Sbjct: 1126 IITVSMPWFLLFNT--ILLGIYYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVV 1183

Query: 305  VQAFVAEQREIKRYNNV------IKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA-Y 357
            + A+  +   I  Y N       I  ++N    + +++ +L TI + +  ++ L+ LA  
Sbjct: 1184 INAY--KHANIFNYYNFENIQTNINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALASL 1241

Query: 358  GSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP--- 414
            G+   +  GL IG L +Y +      S++  +      I   + +  R+ E  D  P   
Sbjct: 1242 GTSNPISAGL-IGLLMSYALQV---SSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGI 1297

Query: 415  -MISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKS 473
             +I  +   K  P +GEI F++ +  Y       + K ++ +I+    + +VG +G GKS
Sbjct: 1298 RVIEDSRPPKNWPKRGEITFEHYTTKYRENL-DPVLKDIDLRIKHQEKIGVVGRTGAGKS 1356

Query: 474  TIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY 533
            T+   L +  +P  G IT+DG DIS L    LRR + I+ Q+     G++R N+      
Sbjct: 1357 TLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDAQAFEGTVRSNL--DPFN 1414

Query: 534  EATAEEIRRVTK----QCFCHNFITKFPDQ-------YQTILGPNGTLLSGGQKQRIAIA 582
              T  EI +  +    +      +++ PD          T +  NG  LS GQ+Q + ++
Sbjct: 1415 RHTDAEIWKALELSHLKPHIERIVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLS 1474

Query: 583  RALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIV 642
            RALL    +LILDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++V
Sbjct: 1475 RALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMV 1532

Query: 643  LGNDGSVVEIGKFKTLFGN 661
            L + G V E      L  N
Sbjct: 1533 L-DKGEVKEFDTPDNLLKN 1550

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 108/464 (23%), Positives = 200/464 (43%), Gaps = 58/464 (12%)

Query: 272 YFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDV--YNVG 329
           Y  RL +   +   +   +  +   E  + +K+++ +  E+  + R N+V  D+  +N+ 
Sbjct: 448 YMTRLYKKLFKTQMQYKDKRIKTVTEILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMK 507

Query: 330 KESAFINAKLF--TITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVF 387
           K +   N   F   I   L   S  ++ +Y +  VL   +    LT + M  +    A+F
Sbjct: 508 KIAIVSNFMFFCWNIVPLLVTCSTFVLFSYLTDQVLSPQIIFPSLTLFSMLND----ALF 563

Query: 388 GLSSFYSEIMQGVGAASRL--FELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPT--- 442
            + +  S I++   +  RL  + L + +   S     +       +E  N  F + +   
Sbjct: 564 TVPTMISNIIEIGVSLKRLKGYLLAEELDT-SFIEHARATASDPTVEISNAVFLWKSPKS 622

Query: 443 --------------RPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
                          PG  +    NF  +     CIVG  G GKST    +L       G
Sbjct: 623 AASSEDTDEEAEISSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------G 675

Query: 489 TI-TVDGQDISKLNSKSLRR--HIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
            +  V     S +  K + R  ++    Q+P +M+ S++DNI +G  Y+      ++  K
Sbjct: 676 QLPCVSSDSASGVKPKVVIRADNLAYCPQQPWIMNASLKDNILFGYKYDEAM--YKKTIK 733

Query: 546 QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE- 604
            C     +   PD  QT++G  G  LSGGQK R+++ARA+  + ++ +LD+  SA+D   
Sbjct: 734 ACQLLPDLEILPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHV 793

Query: 605 SESAINYTFGK---LMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
            +S I+    +   L+K K  T+I   + ++ +  S+++ +L N G +VE   ++ +   
Sbjct: 794 CKSIIDDVLDRQKGLLKNK--TVILTTNAVNVLVHSDMIYLLKN-GKIVESNSYEEVMSK 850

Query: 662 PLSELSQLLNEKSTINE------RNPNEKPAETPEQESQKNAAN 699
             +       EKS++ E       N +E+ AE   + S  +  N
Sbjct: 851 DRNN-----GEKSSLREIIEEFASNESEETAEKKSESSTIDDKN 889

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 125/478 (26%), Positives = 237/478 (49%), Gaps = 43/478 (8%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            ++ K +H    FFD+  +G +++R   D   + + +T  V    ++++           +
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 252  SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQ--EATGQ--LTRVSEEQFSGVKTVQA 307
               ++   +     V+L   + G      SR+L+  E+T +  + +   E   GV T++A
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 308  FVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLH--- 364
            +  E R +K   N+ K   N  K   ++      +   +  +  L++   G  ++++   
Sbjct: 1252 YGDEIRFMKE--NLTKIDEN-NKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVLMNINK 1308

Query: 365  --GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG- 421
               GL+   LT  + +TE   SA++ + S YS +   + +  R+ E  D I     + G 
Sbjct: 1309 IDSGLAGISLTYAITFTE---SALWLVRS-YSNVEINMNSVERVKEYMD-IEQEPYSAGI 1363

Query: 422  ---KKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
                K  P +G+IE  ++S  Y P+ P  ++ K+++F +EP   V +VG +G GKSTI +
Sbjct: 1364 VNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKSTIIT 1421

Query: 478  LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY--EA 535
             L ++  P  G I +D  DI+ ++ K LR+ I I+ Q+P L +G+I+ N+     Y  + 
Sbjct: 1422 ALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDDQ 1481

Query: 536  TAEEIRRVT----------KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARAL 585
              + +RRV                   + KF +  Q+ +   G+ LS GQ+Q + +AR+L
Sbjct: 1482 IFKALRRVNLIVDGNLNSDVTSVSSENVNKFLN-LQSEISEGGSNLSQGQRQLMCLARSL 1540

Query: 586  LKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVL 643
            L+ PN+++LDEAT+++D  S++ I  T     + K+ TI++IAHRL ++   + ++V+
Sbjct: 1541 LRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILVM 1596

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 121/260 (46%), Gaps = 14/260 (5%)

Query: 411 DRI-PMISPTTGKKY--IPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGP 467
           DRI   +     KKY  +    +I  +NV+ ++  +      ++LN   + G    ++GP
Sbjct: 675 DRIQKFLDEDDTKKYEQLSLGNKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGP 734

Query: 468 SGRGKSTIASLLLKYYKPTAGTITVDGQDIS---KLNSKSLRRHIGIVQQEPILMSGSIR 524
           +G GK+++   LL       G ITV   D       +S  L   +    Q   L++ +++
Sbjct: 735 TGSGKTSLLMALLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVK 794

Query: 525 DNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARA 584
           +NI +   Y    E    V   C              T +G  G  LSGGQKQRI++ARA
Sbjct: 795 NNILFNAEYNE--ERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARA 852

Query: 585 LLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVI 641
           L      ++LD+  SA+D  + + I  N   G LM+ +  T I ++H ++ T++ +E VI
Sbjct: 853 LYSSSKHILLDDCLSAVDSHTAAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVI 910

Query: 642 VLGNDGSVVEIGKFKTLFGN 661
           ++ N G +  IG   TL  N
Sbjct: 911 MIDN-GKISHIGDPLTLLNN 929

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 131/493 (26%), Positives = 223/493 (45%), Gaps = 35/493 (7%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  +D Y V   + +  S  F              ++    +   +F 
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICVTTWQFIFI 1096

Query: 263  TPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAFVAEQREIKR 317
              P+ +  +Y+ +     SR+L+     +TR       +E   G+ TV+ + ++Q+    
Sbjct: 1097 IVPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1154

Query: 318  YNNVIKDVYNVGKESAF---INAKLFTITSSLGDMSFLLVLAYGSYLVL---HGGLSIGD 371
             N    D       SAF   +NA  + +   L  +  +++L   +  V     G L+ G 
Sbjct: 1155 INQCRID----NNMSAFYPSVNANRW-LAYRLELIGSVIILGAATLSVFRLKQGTLTAGM 1209

Query: 372  LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD---RIPM-ISPTTGKKYIPG 427
            +   + Y       +  +     E+   + +  R+ E  D     P+ I      K  PG
Sbjct: 1210 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWPG 1269

Query: 428  KGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            +G+I+F   S  Y  RP    + K ++  I+P   + IVG +G GKS++   L +  + +
Sbjct: 1270 QGDIKFNQYSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEAS 1327

Query: 487  AGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQ 546
            AG I +DG  I+++    LR  + I+ Q+  +  G++R+NI     Y  T E + R  + 
Sbjct: 1328 AGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAMWRALEL 1385

Query: 547  CFCHNFITKFP-DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
                  I     D   + L   G+ LS GQ+Q + +ARA+L +  +L+LDEAT+A+DVE+
Sbjct: 1386 SHLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVET 1445

Query: 606  ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665
            +  I  T     K +  TI++IAHRL+TI  S+ +IVL N G V E      L  N  S 
Sbjct: 1446 DKVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTNTKSL 1502

Query: 666  LSQLLNEKSTINE 678
               L  E   +NE
Sbjct: 1503 FYSLCAEAGLVNE 1515

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 107/217 (49%), Gaps = 26/217 (11%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + +F +  +P  ++  K++NF+ + G   C+VG  G GK+ + S  L       G  +V 
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSSTLGDLFRVKGFASVH 691

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G              +  V Q P +M+G++++NI +G  Y+A  E   +  K C     +
Sbjct: 692 GS-------------VAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDL 736

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD----------V 603
               D  QT++G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D          V
Sbjct: 737 AILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHV 796

Query: 604 ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIV 640
              + + +T  KL+   +V+ +S+A  ++ +   EI+
Sbjct: 797 LGSNGLLHTKTKLLATNKVSALSVADSIALLDNGEII 833

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 88/253 (34%), Positives = 136/253 (53%), Gaps = 9/253 (3%)

Query: 426  PGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P +G I+F+N S  Y  RP  ++  K +N  I+P   + IVG +G GKS++   L +  +
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
              +G I +DG  I  +  + LR H+ I+ Q+  L  G+IR+NI    T E T E+I R  
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI--DPTNEYTDEQIWRAL 1368

Query: 545  KQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
            +     + +     ++    L   G+ LS GQ+Q + +ARALL    +L+LDEAT+A+DV
Sbjct: 1369 ELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
            E++  I  T     K +  TI++IAHR++TI  S+ ++VL + G V E      L  NP 
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 664  SELSQLLNEKSTI 676
            S    L  E   +
Sbjct: 1486 SLFYSLCYEAGVL 1498

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 146/314 (46%), Gaps = 46/314 (14%)

Query: 422 KKYIPGKGEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477
           K  +  KGE+      + +F +  +P  ++  K++NF  + G   C+VG  G GKS +  
Sbjct: 605 KSKVTKKGEVAVNVGADATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQ 664

Query: 478 LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA 537
            +L       G  +V G              I  V Q P +M+G+++DNI +G  Y+   
Sbjct: 665 AILGDLFRVKGFASVHGS-------------IAYVSQVPWIMNGTVKDNILFGHKYD--- 708

Query: 538 EEIRRVT-KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
           E    +T K C     +   P   QT++G  G  LSGGQK R+++ARA+  + +  +LD+
Sbjct: 709 ESFYTMTLKACALIVDLAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDD 768

Query: 597 ATSALDVE-SESAINYTFG---------KLMKKKEVTIISIAHRLSTIRRSEIVIVLGND 646
             +A+D   ++  + +  G         K++   ++T++SIA            I L  +
Sbjct: 769 PLAAVDEHVTKHLVEHVLGPNGLLASKTKVLATNKITVLSIADH----------IALLEN 818

Query: 647 GSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAE-TPEQESQKNAANESIVDV 705
           G +++ G +  +     S LS+++   ST  ++    K  E T     +  A   S +D+
Sbjct: 819 GEIIQQGSYDDVTSAKSSALSKII---STFGKKPEKSKTGENTVATTPELGAIAGSEIDL 875

Query: 706 -VLEEEILQNDIRS 718
             L+++++Q D RS
Sbjct: 876 KKLDDKLIQEDTRS 889

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 128/483 (26%), Positives = 217/483 (44%), Gaps = 27/483 (5%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  +D Y V   + +  S  F  ++           I      F+L  
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVV---KVTFTIVVICTSTWQFILVV 1081

Query: 263  TPPVMLSSMYFGRLIRDNS--RKLQEAT-GQLTRVSEEQFSGVKTVQAFVAEQR----EI 315
             P  +L   Y    +R +   R+L   T   +    +E   GV T++ +  ++R      
Sbjct: 1082 LPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGYGQQKRFAHINQ 1141

Query: 316  KRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAY 375
             R +N +   Y     + ++  +L      LG +  L       + +  G L+ G +   
Sbjct: 1142 ARIDNNMSAFYPAVNANRWLAFRL----EFLGSIIILGAATLSVFRLKQGTLTAGMIGLS 1197

Query: 376  MMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP----MISPTTGKKYIPGKGEI 431
            + Y      ++  +     E+   + +  R+ E  +  P    +I  +   K  P +G+I
Sbjct: 1198 LSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDI 1257

Query: 432  EFKNVSFAYPTRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
             F++ S  Y  RP  Q I + +N  I+    V IVG +G GKS++   L +  +   G I
Sbjct: 1258 RFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHI 1315

Query: 491  TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCH 550
             +DG     +    LR  + I+ Q+  + +G++R+N+    T E T EEI    +     
Sbjct: 1316 FIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLK 1373

Query: 551  NFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI 609
              +     D  QT+L   G+ LS GQ+Q + +ARALL    +L+LDEAT+A+DVE++  I
Sbjct: 1374 EHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVI 1433

Query: 610  NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQL 669
              T     K +  TI++IAHR++TI  S+ +IVL N+G V E    + L   P S    L
Sbjct: 1434 QETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSL 1490

Query: 670  LNE 672
              E
Sbjct: 1491 CKE 1493

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 129/262 (49%), Gaps = 39/262 (14%)

Query: 425 IPGKGEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLL 480
           +  KG+I  K   + +F +  +P  ++  K++NF+ + G   CIVG  G GKS +   +L
Sbjct: 610 VTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGSGKSALIQSIL 669

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI 540
                  G  T+ G              +  V Q P +M+G++++NI +G  Y+ +  E 
Sbjct: 670 GDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENILFGHKYDPSFYE- 715

Query: 541 RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
            +  K C  +  ++  P   QT++G  G  LSGGQK R+++ARA+  + +  +LD+  +A
Sbjct: 716 -KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAA 774

Query: 601 LD----------VESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVV 650
           +D          V   + + ++  K++   ++T++SIA            I L  +G +V
Sbjct: 775 VDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADS----------IALLENGEIV 824

Query: 651 EIGKFKTLFGNPLSELSQLLNE 672
           + G +  +  +  S LS+L++E
Sbjct: 825 QQGSYDEVVRDDGSALSKLIHE 846

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 130/493 (26%), Positives = 219/493 (44%), Gaps = 35/493 (7%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  +D Y V   + +  S  F   +          + + +     +F 
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQF----IFI 1096

Query: 263  TPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAFVAEQREIKR 317
              P+ +  +Y+ +     SR+L+     +TR       +E   G+ TV+ + ++Q+    
Sbjct: 1097 IIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1154

Query: 318  YNNVIKDVYNVGKESAF---INAKLFTITSSLGDMSFLLVLAYGSYLVL---HGGLSIGD 371
             N    D       SAF   INA  + +   L  +  +++L   +  V     G L+ G 
Sbjct: 1155 INQCRID----NNMSAFYPSINANRW-LAYRLELIGSIIILGAATLSVFRLKQGTLTSGM 1209

Query: 372  LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD---RIPMI-SPTTGKKYIPG 427
            +   + Y       +  +     E+   + +  R+ E  D     P+I       K  P 
Sbjct: 1210 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPPKQWPA 1269

Query: 428  KGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            +G+I F N S  Y  RP    + K +N  I+P   V IVG +G GKS++   L +  + +
Sbjct: 1270 QGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1327

Query: 487  AGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQ 546
             G I +DG  I+++    LR  + I+ Q+  +  G++R+NI     Y  + E I R  + 
Sbjct: 1328 EGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--SDEAIWRALEL 1385

Query: 547  CFCHNFITKFP-DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
                  +     D     L   G+ LS GQ+Q + +ARA+L    +L+LDEAT+A+DVE+
Sbjct: 1386 SHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1445

Query: 606  ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL N G V E      L  N  S 
Sbjct: 1446 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDTPGQLLSNSKSL 1502

Query: 666  LSQLLNEKSTINE 678
                  E   +NE
Sbjct: 1503 FYSQCAEAGLVNE 1515

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 144/288 (50%), Gaps = 30/288 (10%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + +F +  +P  ++  K+++F+   G+  CIVG  G GK+ + S +L       G  TV 
Sbjct: 632 DATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVH 691

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G              I  V Q P +M+G++++NI +G  Y+A  E   +  K C     +
Sbjct: 692 GC-------------IAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDL 736

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYT 612
               D  +T++G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 613 FGK--LMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLL 670
            G   L+  K  T I   +++S +  ++ + +L N G +++ G +  +  +  S L +LL
Sbjct: 797 LGPNGLLHTK--TRILATNKVSALSIADSIALLDN-GEIIQQGAYSDITKDADSPLWKLL 853

Query: 671 NEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQ--NDI 716
           N+    N    N K +E  E +S KN+  ES + V  E E LQ  ND+
Sbjct: 854 NDYGKKN----NNKQSE--ECDSSKNSVRESSIPVEGELEQLQKLNDL 895

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 130/512 (25%), Positives = 224/512 (43%), Gaps = 64/512 (12%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  SD   +   +    S  F+++L             P   A     
Sbjct: 1072 FFETTPIGRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVL 1131

Query: 263  TPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR------EIK 316
                     Y+  L R+  R    +   +  +  E   G   + AF    R      E  
Sbjct: 1132 IMIYFYYQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFNFFNFETV 1191

Query: 317  RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG--SYLVL--HGGLSIGDL 372
            +YN  I  V+     + +++ +L TI +       L++LA G  S+  L     LS G +
Sbjct: 1192 QYN--IDCVFQFRSTNRWLSVRLQTIGN-------LIILATGLLSFATLGTKKQLSSGMV 1242

Query: 373  TAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP----MISPTTGKKYIPGK 428
               M Y+    S++  +     +I   + +  R  E  +  P    +I  +   +  P +
Sbjct: 1243 GLLMSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPRE 1302

Query: 429  GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
            G IEF N +  Y       + K +N  I+P   + IVG +G GKST+   L +  + T G
Sbjct: 1303 GAIEFNNYTTKYRENLDP-VLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGG 1361

Query: 489  TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCF 548
            +I++DG DISK+  + LR ++ I+ Q+     G+IR N+      + + EE+ R  +   
Sbjct: 1362 SISIDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSH 1419

Query: 549  CHNFITKF------------------PDQYQ------TILGPNGTLLSGGQKQRIAIARA 584
                I +                   PD +       T +  NG+ +S GQ+Q + ++RA
Sbjct: 1420 LKQHILRMNEEANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRA 1479

Query: 585  LLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG 644
            LL    VLILDEAT+A+D+E++  +  T     + KE TI++IAHR+ T+   + ++VL 
Sbjct: 1480 LLNPSKVLILDEATAAIDMETDKIVQDTIKN--EFKERTILTIAHRIDTVMNYDKILVLD 1537

Query: 645  NDGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
                  E+ +F T        +S LL++K+T+
Sbjct: 1538 KG----EVAEFDT--------VSNLLSDKNTM 1557

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 123/239 (51%), Gaps = 21/239 (8%)

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI-TVDGQDISKLNSKSLR-RHIG 510
           NF ++ GS  CIVG  G GKSTI   +L       G +  +   D ++    ++R   I 
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIA 702

Query: 511 IVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL 570
              QE  +M+ S+++NI +G  ++     +  V + C   + ++  PD  +TI+G  G  
Sbjct: 703 YCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGIS 760

Query: 571 LSGG-QKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKEVTII 625
           L GG QK RI++ARA+  + +V +LD+  SA+D   S++ I Y   K   L++ K  TII
Sbjct: 761 LVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TII 818

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNP-LSELSQLLNEKSTINERNPNE 683
              + ++ ++ S+ +  +   G +VE   ++ +  +   S + +L+ E  T +  N NE
Sbjct: 819 LSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEEFGT-STSNSNE 875

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 127/490 (25%), Positives = 221/490 (45%), Gaps = 41/490 (8%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAF 258
            FF+   +G +++R  +D Y    ++ R+ +Q + +  K +                    
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIVICWTTWQ-------- 1096

Query: 259  LLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAFVAEQR 313
             +F   P+ +  +Y+ +     SR+L+     +TR       +E   G+ T++ +  +QR
Sbjct: 1097 FIFIIGPLGVLYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGMSTIRGY-NQQR 1154

Query: 314  EIKRYNNVIKDVYNVGKESAF---INAKLFTI--TSSLGDMSFLLVLAYGSYLVLHGGLS 368
                 N+   D       SAF   INA  +      S+G +  L       Y +  G L+
Sbjct: 1155 RFDHINHCRID----NNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLT 1210

Query: 369  IGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL---FELTDRIPM-ISPTTGKKY 424
             G +   + Y       +  +     E+   + +  R+    EL    P+ I       +
Sbjct: 1211 AGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAH 1270

Query: 425  IPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYY 483
             P  G+I F + S  Y  RP    + + +N  I+P   + IVG +G GKS++   L +  
Sbjct: 1271 WPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIV 1328

Query: 484  KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRV 543
            + ++G I +DG  I ++    LR ++ I+ Q+  +  G+IR+N+    TY  T +EI RV
Sbjct: 1329 EASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDEIWRV 1386

Query: 544  TKQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
             +    +  +    P      +   G+ LS GQ+Q + +ARALL    +LILDEAT+A+D
Sbjct: 1387 LELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVD 1446

Query: 603  VESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNP 662
            VE++  I  T     + +  TI++IAHR++TI  S+ ++VL + G V E      L  N 
Sbjct: 1447 VETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTNLLRNE 1503

Query: 663  LSELSQLLNE 672
             S+   L  E
Sbjct: 1504 GSQFHSLCQE 1513

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 172/400 (43%), Gaps = 48/400 (12%)

Query: 292 TRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKD--VYNVGKESAF--INAKLFTITSSLG 347
           T V  E  + +K+++ +  E+   K+  +V  D  + N+ K   F  I +  F +   L 
Sbjct: 483 TSVISEILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLV 542

Query: 348 DMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLF 407
                 V  Y     L   L    LT +     L    +F + +  +  ++   + +RLF
Sbjct: 543 SCCTFAVFVYTEDRALTVDLVFPALTLF----NLLSFPLFVIPNVMTSFIEASVSVTRLF 598

Query: 408 E-LTDRIPMISPTTGKKYIPGKGEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNV 462
             LT+             +   G++  K   + +F +  +P  ++  K++NF+ + G   
Sbjct: 599 NFLTNEELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLT 658

Query: 463 CIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGS 522
           C+VG  G GKS +   L        G  TV G              +  V Q   +M+G+
Sbjct: 659 CVVGRVGSGKSALIQSLSGDLFRVKGFATVHGS-------------VAYVSQVAWIMNGT 705

Query: 523 IRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIA 582
           +++NI +G  Y+   E   +  K C     +    D  +T++G  G  LSGGQK R+++A
Sbjct: 706 VKENILFGHRYDP--EFYDKTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLA 763

Query: 583 RALLKKPNVLILDEATSALDVE-SESAINYTFG---------KLMKKKEVTIISIAHRLS 632
           RA+  + +  +LD+  +A+D    +  + +  G         K++   +++++SIA R  
Sbjct: 764 RAVYARADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADR-- 821

Query: 633 TIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNE 672
                   I L  +G +VE G +  +  +  S LS+L+ +
Sbjct: 822 --------IALLENGEIVEQGSYDEVTADGDSALSKLIRD 853

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 144/285 (50%), Gaps = 30/285 (10%)

Query: 400  VGAASRLFELTDRIPMISPTTGKKY-----IPGKGEIEFKNVSFAYPTRPG-SQIFKSLN 453
            + +A RL      +P  +      Y      P  GE+ F++VSFAY  RPG   + K++N
Sbjct: 1178 MNSAERLVTYATELPQEAAYRKSDYSPPDNWPTNGEVIFEDVSFAY--RPGLPTVLKNVN 1235

Query: 454  FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513
              I  G  + I G +G GKSTI + L +  + T+G I +DG D  KL    LRR + I+ 
Sbjct: 1236 LSIAGGEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIP 1295

Query: 514  QEPILMSGSIRDN----------------ITYGLTYEATAEEIRRVT-KQCFCHNFITKF 556
            Q+P+L  G+IR N                I  G   +   E+I+     +   +N + KF
Sbjct: 1296 QDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKF 1355

Query: 557  PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKL 616
                  I+  +G   S G++Q +A+ RAL+++  +LILDEATS++D E++  I       
Sbjct: 1356 --HLDQIVEEDGANFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQTRIAT- 1412

Query: 617  MKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
             + ++ TI+ IAHRL TI   + ++VL   G V E  K + LF N
Sbjct: 1413 -EFQDCTILCIAHRLKTILNYDRILVL-EKGEVAEFDKPEILFNN 1455

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 111/211 (52%), Gaps = 20/211 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F +LNF+I+ G  + I GP G GKS++ + +  +   T G + ++G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
           + ++   P + + ++RDNI +G  Y+   E+ + V + C     I   P    T +G  G
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFGSPYDR--EKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR++ K  ++ + D+  SA+D    +  ++  F + ++ K  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            H+LS I +++ VIVL  +GS V+IG  + L
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  129 bits (323), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 121/464 (26%), Positives = 208/464 (44%), Gaps = 29/464 (6%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  +D Y V   + +  S  F                + + +    FF
Sbjct: 1018 FFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIVICVTTWQFT----FF 1073

Query: 263  TPPVMLSSMYFGRLIRDNSRKLQE----ATGQLTRVSEEQFSGVKTVQAFVAEQREIK-- 316
              P+ +  +Y+ +     SR+L+         +    +E  +GV +++ +    R I   
Sbjct: 1074 VIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVSSIRGYGQLDRFIHIN 1133

Query: 317  --RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTA 374
              R NN     Y     S  +N  L      +G            + +  G L+ G +  
Sbjct: 1134 QARINNNTSAYY----PSMNVNRWLAYRLEFIGSCIIFFAATLSVFRLASGSLTSGMVGL 1189

Query: 375  YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP----MISPTTGKKYIPGKGE 430
             + Y      ++  +     E+   + +  R+ E  +  P     I+ +      P  GE
Sbjct: 1190 SLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWPKDGE 1249

Query: 431  IEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
            I+F+N S  Y  RPG   I + +N  I+P   V IVG +G GKS++A  L +  +   G 
Sbjct: 1250 IKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEAAEGH 1307

Query: 490  ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFC 549
            I++DG  I  +    LR+ + I+ Q+  +  G++RDNI    T + T E+I +  +    
Sbjct: 1308 ISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI--DPTKQYTDEQIWKALELSHL 1365

Query: 550  HNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESA 608
             + +     D   T L   G  LS GQ+Q + +ARALL    +L+LDEAT+A+DVE++  
Sbjct: 1366 ADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVETDKV 1425

Query: 609  INYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652
            I  T       +  TI++IAHR++TI  S+ ++VL + G+V E 
Sbjct: 1426 IQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVAEF 1466

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 126/560 (22%), Positives = 249/560 (44%), Gaps = 71/560 (12%)

Query: 190 SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQK----VSDGFKALLCXXXXX 245
           S + KK +H   E    +  GD+++ +  DA  + R +TQ      S  F+  LC     
Sbjct: 364 SLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLCLYSLH 422

Query: 246 XXXXSISP--ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVK 303
                + P   +   LL FT P+   + Y  R+++   ++  +   + TR+  E  + +K
Sbjct: 423 RL---LGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIK 476

Query: 304 TVQAFV-----AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG 358
           +++ +       E+ +  R    +K +  +G  +AF N + + I   L   S      + 
Sbjct: 477 SLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQ-YNIIPFLVSCS-----TFA 530

Query: 359 SYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSF--------YSEIMQGVGAASRLFE-L 409
            +++   G     LT  +++  LT   +F L SF         +  ++   A  RL   L
Sbjct: 531 VFVLTQKGRP---LTTDLVFPALT---LFNLLSFPLAVLPIAITSFIEASVAIGRLTNFL 584

Query: 410 TDRIPMISPTTGKKYIPGKGEIEF---KNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIV 465
           T         T +  +   G +      N +F +  +P  ++  K++NF+ +     CI+
Sbjct: 585 TAEELQRDAITREPAVKAPGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCII 644

Query: 466 GPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLN-SKSLRRHIGIVQQEPILMSGSIR 524
           G  G GKS +   +L               D+ ++N S  +R ++  V Q   +M+G++R
Sbjct: 645 GKVGSGKSALIQAMLG--------------DLFRVNGSAVVRGNVAYVSQVAWIMNGTVR 690

Query: 525 DNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARA 584
           DNI +G  Y+A  +  ++  K C     ++  PD   T +G  G  LSGGQK R+++ARA
Sbjct: 691 DNILFGHKYDA--KFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARA 748

Query: 585 LLKKPNVLILDEATSALDVE-SESAINYTFGK--LMKKKEVTIISIAHRLSTIRRSEIVI 641
           +  + +  +LD+  +A+D   ++  +   FG   L+K K   + +  ++++ +  ++ ++
Sbjct: 749 VYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIV 806

Query: 642 VLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANES 701
           +L N G +V+ G F  +  +  S +S+L+        +  N  P          +A    
Sbjct: 807 LLEN-GEIVQQGTFSEVISDEDSAISKLVLHHG----KKQNGAPTSGESSSPSSSAFEYD 861

Query: 702 IVDVVLE-EEILQNDIRSQD 720
           +V+  L+ E++   +++ QD
Sbjct: 862 VVEPDLDLEKLADEELQVQD 881

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 130/493 (26%), Positives = 219/493 (44%), Gaps = 35/493 (7%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   +G +++R  +D Y V   + +  S  F   +          + + +     +F 
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQF----IFI 1095

Query: 263  TPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFSGVKTVQAFVAEQREIKR 317
              P+ +  +Y+ +     SR+L+     +TR       +E   G+ TV+ + ++Q+    
Sbjct: 1096 IIPLSVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1153

Query: 318  YNNVIKDVYNVGKESAF---INAKLFTITSSLGDMSFLLVLAYGSYLVL---HGGLSIGD 371
             N    D       SAF   INA  + +   L  +  +++L   +  V     G L+ G 
Sbjct: 1154 INQCRID----NNMSAFYPSINANRW-LAYRLELIGSIIILGAATLSVFRLKQGTLTAGM 1208

Query: 372  LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD---RIPMI-SPTTGKKYIPG 427
            +   + Y       +  +     E+   + +  R+ E  D     P+I       K  P 
Sbjct: 1209 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPS 1268

Query: 428  KGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            +G+I+F N S  Y  RP    + K +N  I+P   V IVG +G GKS++   L +  + +
Sbjct: 1269 QGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1326

Query: 487  AGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQ 546
             G I +D   I+++    LR  + I+ Q+  +  G++R+NI     Y  T E I R  + 
Sbjct: 1327 EGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALEL 1384

Query: 547  CFCHNFITKFP-DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
                  +     D     L   G  LS GQ+Q + +ARA+L    +L+LDEAT+A+DVE+
Sbjct: 1385 SHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1444

Query: 606  ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL N G V E      L  +  S 
Sbjct: 1445 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLLSDNKSL 1501

Query: 666  LSQLLNEKSTINE 678
               L  E   +NE
Sbjct: 1502 FYSLCMEAGLVNE 1514

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 123/260 (47%), Gaps = 36/260 (13%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + +F +  +P  ++  K++NF+ + G+  CIVG  G GK+ + S +L       G  TV 
Sbjct: 631 DATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVH 690

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G              +  V Q P +M+G++++NI +G  Y+A  E   +  K C     +
Sbjct: 691 GS-------------VAYVSQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACALTIDL 735

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD----------V 603
               D  +T++G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D          V
Sbjct: 736 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHV 795

Query: 604 ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
              + + +T  K++   +V+ +SIA            I L ++G + + G +  +  +  
Sbjct: 796 LGPNGLLHTKTKVLATNKVSALSIADS----------IALLDNGEITQQGTYDEITKDAD 845

Query: 664 SELSQLLNEKSTINERNPNE 683
           S L +LLN     N    NE
Sbjct: 846 SPLWKLLNNYGKKNNGKSNE 865

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 153/305 (50%), Gaps = 40/305 (13%)

Query: 400  VGAASRL-FELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIE 457
            V  A++L  E   + P +SP       P KGEI F +V FAY  R G   + K LN  I+
Sbjct: 1164 VNYATKLPLEAAYKKPELSPPES---WPSKGEIRFLDVDFAY--RSGLPVVLKGLNLDIK 1218

Query: 458  PGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPI 517
             G  + I G +G GKSTI S L +  + T+G I +D  DIS L    LRR + I+ Q+P+
Sbjct: 1219 SGEKIGICGRTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPV 1278

Query: 518  LMSGSIRDNITYGLTYEAT-------------AEEIRRVTKQCF----CHNFITKFPDQY 560
            L  G+IR N+     Y+ +              E + +V  +       H  + KF    
Sbjct: 1279 LFKGTIRKNLDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HL 1336

Query: 561  QTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKK- 619
              ++   G+  S G++Q +A+ RAL+++  +LILDEATS++D E++       GK+ K+ 
Sbjct: 1337 DQLVEEEGSNFSLGERQVLALTRALVRQSKILILDEATSSVDYETD-------GKIQKRI 1389

Query: 620  ----KEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKST 675
                   TI+ IAHRL TI + + ++VL   G + E  +   LF +  S    +  E+S 
Sbjct: 1390 VEEFDNCTILCIAHRLKTILQYDRILVL-EKGVIAEFDQPFKLFSDKDSIFRSMC-ERSN 1447

Query: 676  INERN 680
            I E +
Sbjct: 1448 ITESD 1452

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 137/277 (49%), Gaps = 27/277 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F +L+F+I  G  + I GP G GKS++ +    +   T G I V+G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             +    P + + +++DNI +G  +    E+   V + C     +   P   +T +G  G
Sbjct: 636 --LFCGYPWIQNATVKDNILFGSPF--IKEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +ARA+ K  ++ + D+  SA+D    +  ++     L++ K  T I  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAE 687
            H+LS I +++ VIVLG DGS  +IG    L       L+ LL+  +T  E   NE   E
Sbjct: 750 THQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERE---NENRDE 804

Query: 688 TPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKDI 724
           +P  + +    +E ++   L+ ++LQ   R++D +D+
Sbjct: 805 SPVADEEN---DELLIQEELKIQLLQTTTRNEDAEDV 838

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 130/507 (25%), Positives = 230/507 (45%), Gaps = 62/507 (12%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            + +K+ +H    + D   +G +++R   D   +   +T+       +L            
Sbjct: 970  KAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTE-------SLRLLTSQFANIVG 1022

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSE--------EQFSGV 302
            +      +L +F   +    + F  LI D+ +       +L  V          E   G+
Sbjct: 1023 VCVMCIVYLPWFAIAIPFLLVIF-VLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGM 1081

Query: 303  KTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLV 362
             T++A+ +++R + + + +I    N   E+ ++   L        DM  ++     + L 
Sbjct: 1082 DTIKAYRSQERFLAKSDFLI----NKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLC 1137

Query: 363  LHGGL-----SIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMIS 417
            +         S+G L  Y++  +L G     L +  ++    + +A RL      +P+ +
Sbjct: 1138 VTRAFPISAASVGVLLTYVL--QLPGLLNTILRAM-TQTENDMNSAERLVSYATELPLEA 1194

Query: 418  -----PTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRG 471
                   T  +  P KGEI  +NV F+Y  RPG   + K+LN  IE G  + I G +G G
Sbjct: 1195 DYRKPEMTPPESWPSKGEIVLENVCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAG 1252

Query: 472  KSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI---- 527
            KSTI S L +  + +AG I +D  DISKL    LRR + I+ Q+P+L  G+IR N+    
Sbjct: 1253 KSTIMSALYRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFD 1312

Query: 528  --TYGLTYEA------------TAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
              T    ++A            +  ++++  K    H  + KF       +   G+  S 
Sbjct: 1313 ERTDDELWDALVRGGAIAKNDLSEAKLQKPDKNG-THGRMHKF--HLDQAVEEEGSNFSL 1369

Query: 574  GQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKK-KEVTIISIAHRLS 632
            G++Q +A+ RAL+++  +LILDEATS++D E++  I     +++++  + TI+ IAHRL 
Sbjct: 1370 GERQLLALTRALVRQSKILILDEATSSVDYETDGKIQ---ARIVEEFGDCTILCIAHRLQ 1426

Query: 633  TIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            TI   + ++VL   G V E     TLF
Sbjct: 1427 TIVNYDRILVL-EKGEVAEFDTPWTLF 1452

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 114/238 (47%), Gaps = 22/238 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK LNF+I+ G  + I GP G GKS++ + +    + T G I V+G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + +  +RDNI +G  +    E+   V + C     +   P    T +G  G
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPF--IKEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++     ++  K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFG--NPLSELSQLLNEKSTINERNPNE 683
            H+LS I R+  VIVLG DG  V+IG    L      L +L Q  ++ S   E  P E
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLIKLLQFSSQNSKEEEDVPEE 822

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 139/498 (27%), Positives = 225/498 (45%), Gaps = 79/498 (15%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAF 258
            FF+   +G +++R  +D Y    ++ R+ +Q   +  K L            I+     F
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGV-------IAYTTWQF 1114

Query: 259  LLFFTPPVMLSSMYFGRLIRDNS--RKLQEAT-GQLTRVSEEQFSGVKTVQAFVAEQREI 315
            +    P  +    Y    +R +   R+L+  T   +    +E   G+ T++ +  +Q+  
Sbjct: 1115 VFVIVPLGIFYIYYQQYYLRTSRELRRLESVTRSPIFSHFQETLGGLATIRGY-GQQKRF 1173

Query: 316  KRYNNVIKDVYNVGKESAF---INAKLFTITSSLGDMSFLLVLAY-----GSYLVLHGG- 366
            +  N    D       SAF   INA  +              LAY     GS ++L    
Sbjct: 1174 EHINECRVD----NNMSAFYPSINANRW--------------LAYRLEFIGSVIILGAAT 1215

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYS-EIMQGVGAASRLF-----------------E 408
            LSI  L A  M      + + GLS  Y+ +I Q +    R+                  E
Sbjct: 1216 LSIFKLRAGTM-----TAGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSE 1270

Query: 409  LTDRIPM-ISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQ---IFKSLNFKIEPGSNVCI 464
            L    P+ I      K  P  GEI+F++    Y TR       + K +N +I+P   + I
Sbjct: 1271 LKSEAPLVIESNRPPKEWPVAGEIKFEH----YYTRYREDLDYVLKDINLEIKPREKIGI 1326

Query: 465  VGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIR 524
            VG +G GKS++   L +  + T+G I +DG  I+++    LR H+ I+ Q+  +  G+IR
Sbjct: 1327 VGRTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIR 1386

Query: 525  DNITYGLTYEATAEEIRRVTKQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIAR 583
            +NI    T + T  +I R  +       I +   D   T++   G+ LS GQ+Q + +AR
Sbjct: 1387 ENI--DPTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLAR 1444

Query: 584  ALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVL 643
            ALL    VL+LDEAT+A+DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL
Sbjct: 1445 ALLVPSKVLVLDEATAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL 1502

Query: 644  GNDGSVVEIGKFKTLFGN 661
             + G VVE    + L  N
Sbjct: 1503 -DKGKVVEFDTPEALLKN 1519

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 97/399 (24%), Positives = 169/399 (42%), Gaps = 46/399 (11%)

Query: 292 TRVSEEQFSGVKTVQAFVAEQ--REIKRYNNVIKDVYNVGKESAFI--NAKLFTITSSLG 347
           TRV  E  + +K+++ +  EQ  +E   Y    K++ N+ K   ++   +  F I   L 
Sbjct: 503 TRVISEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLV 562

Query: 348 DMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLF 407
             S   V  Y     L   L    LT +     L    +  + +  + I++   + SRLF
Sbjct: 563 SCSTFAVFVYTEDKALTTDLVFPALTLF----NLLSFPLMVIPNVITAIIESSVSVSRLF 618

Query: 408 EL----------TDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKI 456
                         R+P +          G       N +F +  +P  ++  K++N++ 
Sbjct: 619 NFLTNEELQKDAVQRLPKVKEIGDVAVNVGD------NATFLWKRKPEYKVALKNINYQA 672

Query: 457 EPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEP 516
           + G   CIVG  G GKS     LL       G  T+ G              +  V Q  
Sbjct: 673 KKGELSCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGS-------------VAYVSQVA 719

Query: 517 ILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQK 576
            +M+G++RDN+ +G  Y+   E   +  K C     +    D  QT++G  G  LSGGQK
Sbjct: 720 WIMNGTVRDNVLFGHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQK 777

Query: 577 QRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK--LMKKKEVTIISIAHRLST 633
            R+++ARA+  + +  +LD+  +A+D   S   + +  G   L+  K  T I   +++S 
Sbjct: 778 ARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISV 835

Query: 634 IRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNE 672
           +  ++ + +L N G + + G +     +  S L +LL E
Sbjct: 836 LSAADSITLLEN-GEITQQGTYADCRKDEESALGKLLKE 873

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 134/507 (26%), Positives = 232/507 (45%), Gaps = 60/507 (11%)

Query: 203  FFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFF 262
            FF+   VG +I+R  SD  VV + +    +  F  +L           IS  +  FLLF 
Sbjct: 1064 FFETTPVGRIINRFSSDVNVVDQGLQFSFTYFFIYILNYLFTVIL---ISFNMPLFLLFN 1120

Query: 263  TPPVMLS---SMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR------ 313
               ++L     +Y+  L R+  R    +   +  +  E   G   + A+   QR      
Sbjct: 1121 GILLVLYFYYQIYYITLSRELKRLTSISYSPIMSLLSETLGGHLVINAYKHLQRFTYLNN 1180

Query: 314  EIKRYNNVIKDVYNVGKESAFINAKLFTI-TSSLGDMSFLLVLAYGSYLVLHGGLSIGDL 372
            E  ++N  I  ++N    + +++ +L TI    +   + L +    +   L  G+ +G L
Sbjct: 1181 ESIQFN--INCMFNFRSTNRWLSMRLQTIGAVLVLLTALLSLSTINTDKALSSGM-VGLL 1237

Query: 373  TAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP----MISPTTGKKYIPGK 428
             +Y +    + + +  +S    ++   + +  R+ E  +  P    +I  +   K  P +
Sbjct: 1238 MSYALQVTTSLTWIVRMSV---QVETDIVSVERILEYCNLPPEADAIIEESRPPKEWPSR 1294

Query: 429  GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
            G I F+N S  Y       + K +  +I+P   + IVG +G GKST++  L +  +P+ G
Sbjct: 1295 GAITFQNYSTKYRENLDP-VLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEPSGG 1353

Query: 489  TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-YGLTYEATAEEIRRVTKQC 547
            +I +DG DI+KL    LR ++ I+ Q+     G+I+ N+  +G   + + EEI R  +  
Sbjct: 1354 SIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFG---QYSDEEIWRALELS 1410

Query: 548  FCHNFITKFPDQYQT------------------ILGPNGTLLSGGQKQRIAIARALLKKP 589
                 I K   +  T                   +  NG  LS GQ+Q + ++RALL   
Sbjct: 1411 HLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLSRALLNHS 1470

Query: 590  NVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSV 649
             +L+LDEAT+A+D+E++  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V
Sbjct: 1471 KILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEV 1527

Query: 650  VEIGKFKTLFGNPLSELSQLLNEKSTI 676
             E       F  P    + LL +KSTI
Sbjct: 1528 KE-------FDTP----TNLLADKSTI 1543

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 103/204 (50%), Gaps = 16/204 (7%)

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           +F+   G   CIVG  G GKST    +L      +G   +D     KL  ++  + I   
Sbjct: 650 HFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYC 704

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLS 572
            Q+P +M+ S++DN+ +G  +    +  +   ++C     +   PD  QT++G  G  LS
Sbjct: 705 PQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLS 762

Query: 573 GGQKQRIAIARALLKKPNVLILDEATSALDVE-----SESAINYTFGKLMKKKEVTIISI 627
           GGQK R+++ARA+  + +V +LD+  SA+D E      E  +N   G L  K   T+I  
Sbjct: 763 GGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGILKNK---TVILT 819

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVE 651
            + +S ++ S+ +  L  DG +VE
Sbjct: 820 TNAVSVLKHSQNIYALL-DGEIVE 842

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 131/479 (27%), Positives = 219/479 (45%), Gaps = 39/479 (8%)

Query: 203  FFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAF 258
            FF+   +G +++R  +D +    ++ R+ +Q V++  K              I      F
Sbjct: 1047 FFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKV-------SFTIIVICFTTWQF 1099

Query: 259  LLFFTPPVMLSSMYFGRLIRDNS--RKLQEAT-GQLTRVSEEQFSGVKTVQAFVAEQREI 315
             LF  P  +L   Y    +R +   R+L   T   +    +E   G+ T++ +  ++R I
Sbjct: 1100 TLFVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIRGYNQQRRFI 1159

Query: 316  K----RYNNVIKDVYNVGKESAFINAKL-FTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
                 R +N +   Y     + ++  +L F  T  +   S L +L   S     G L+ G
Sbjct: 1160 HINQSRMDNNMSAYYPSVNANRWLAYRLEFIGTIIIFGASSLSILRLKS-----GSLTPG 1214

Query: 371  DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP-----MISPTTGKKYI 425
             +   + Y      ++  +     E+   + +  R+ E ++ IP     +I         
Sbjct: 1215 MIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IPSEAPYLIEDRRPSPNW 1273

Query: 426  PGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P  G I+F++ S  Y  RPG   I K +N  I+P   + IVG +G GKS++   L +  +
Sbjct: 1274 PTDGAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIE 1331

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
               G I +DG  I ++    LR  + I+ Q+  +  GS+R+NI    T + + EEI RV 
Sbjct: 1332 AAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRVL 1389

Query: 545  KQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
                  N +     D   T L   G  LS GQ+Q + +ARALL    +L+LDEAT+A+DV
Sbjct: 1390 DLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDV 1449

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNP 662
            E++  +  T       +  TI++IAHRL+TI  S+ ++VL + G V E    + L  NP
Sbjct: 1450 ETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNP 1505

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 128/511 (25%), Positives = 224/511 (43%), Gaps = 67/511 (13%)

Query: 190 SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKV----SDGFKALLCXXXXX 245
           S + KK++   +E  D +  GD+++ +  D   + + + Q      S  F+ +LC     
Sbjct: 387 SVIYKKSLVLSSEAADMSSTGDIVNLMSVDVQRL-QDLAQWCHLIWSGPFQIILCLTSLY 445

Query: 246 XXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTV 305
                 S  +   +L    P+  S M   R+ ++  +   +   Q TR+  E  + +K++
Sbjct: 446 KLLGK-SMWVGVIILIVMMPLNSSLM---RVQKNLQKGQMKNKDQRTRLINEILNNMKSL 501

Query: 306 QAFV-----AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSY 360
           + +       E+ E  R    +K++  +G  +A IN + F I       S   V  Y   
Sbjct: 502 KLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQ-FNIVPFFVSCSTFAVFVYTE- 559

Query: 361 LVLHGGLSIGDLTAYMMYTELTGSAVFGLSSF-----------YSEIMQGVGAASRLFE- 408
                      LT  +++  LT   +FGL SF           Y E    +G   RL+  
Sbjct: 560 --------DRPLTTDLVFPALT---LFGLLSFPLAVVPLVLNSYIEASVSIG---RLYSF 605

Query: 409 LTDRIPMISPTTGKKYIPGKGEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCI 464
           LT+             +   G++  K   N +F +  +P  ++  K++NF+ + G   C+
Sbjct: 606 LTNEELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGELNCV 665

Query: 465 VGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIR 524
           VG  G GKS +   LL       G  TV G             +I  V Q   +M+G+++
Sbjct: 666 VGRVGSGKSALIQSLLGDLFRVKGFATVHG-------------NIAYVSQVAWIMNGTVK 712

Query: 525 DNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARA 584
           DNI +G  Y+   E   +  K C     +   PD  +TI+G  G  LSGGQK R+++ARA
Sbjct: 713 DNILFGHKYDP--EFYEKTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARLSLARA 770

Query: 585 LLKKPNVLILDEATSALDVE-SESAINYTFGK--LMKKKEVTIISIAHRLSTIRRSEIVI 641
           +  + ++ +LD+  +A+D   S   I++  G   L+K K  T I   +++S +  ++ V 
Sbjct: 771 VYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKISALSIADSVT 828

Query: 642 VLGNDGSVVEIGKFKTLFGNPLSELSQLLNE 672
           +L N G +++ G F  +     S LS+L+ E
Sbjct: 829 LLEN-GEIIQQGTFCEITKAADSPLSKLIKE 858

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 141/275 (51%), Gaps = 36/275 (13%)

Query: 407  FELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIV 465
             E + R P ++P       P  GEI F+NV FAY  RPG  I  K+LN  I+ G  + I 
Sbjct: 1192 LEASYRKPEMTPPES---WPSMGEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGIC 1246

Query: 466  GPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRD 525
            G +G GKSTI S L +  + TAG I +D  DIS+L    LRR + I+ Q+P+L  G+IR 
Sbjct: 1247 GRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRK 1306

Query: 526  NI------TYGLTYEA-------TAEEIRRVTKQ----CFCHNFITKFPDQYQTILGPNG 568
            N+      T    ++A         +++  V  Q       H  + KF       +   G
Sbjct: 1307 NLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEG 1364

Query: 569  TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY----TFGKLMKKKEVTI 624
            +  S G++Q +A+ RAL+++  +LILDEATS++D E++  I       FG      + TI
Sbjct: 1365 SNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFG------DCTI 1418

Query: 625  ISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
            + IAHRL TI   + ++VL   G V E     TLF
Sbjct: 1419 LCIAHRLKTIVNYDRILVL-EKGEVAEFDTPWTLF 1452

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 116/239 (48%), Gaps = 21/239 (8%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK LNF I+ G  + I GP G GKS++ + +    + T G + V+G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + S+RDNI +G  +    E+   V + C     +   P    T +G  G
Sbjct: 652 --LMCGYPWIQNASVRDNIIFGSPF--NKEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR++ KK ++ + D+  SA+D    +  ++     ++  K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPA 686
            H+LS I R+  VIVLG DG  V+IG    L     + L  LL   S  +E+   E+ A
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LINLLQFSSQNSEKEDEEQEA 822

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/249 (33%), Positives = 133/249 (53%), Gaps = 9/249 (3%)

Query: 426  PGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P  G I+F+N S  Y  RP   +  +++N  I+P   + IVG +G GKS++   L +  +
Sbjct: 1247 PTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1304

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
               G I +DG     +  + LR H+ I+ Q+  +  G++R+NI    T E T EEI    
Sbjct: 1305 AAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI--DPTNEYTDEEIWHAL 1362

Query: 545  KQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
            +     + I     D+ +++L   G  LS GQ+Q + +ARALL    +L+LDEAT+A+DV
Sbjct: 1363 ELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDV 1422

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
            E++  I  T     K +  TI++IAHR++TI  S+ ++VL + G + E    + L  N  
Sbjct: 1423 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRE 1479

Query: 664  SELSQLLNE 672
            S    L  E
Sbjct: 1480 SLFYSLCQE 1488

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 147/296 (49%), Gaps = 40/296 (13%)

Query: 435 NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           + +F +  +P  ++  K++NF+ + G   CIVG  G GKS +   +L       G  +V 
Sbjct: 616 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGILGDLFRVKGFASVH 675

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFI 553
           G              I  V Q P +M+G++++NI +G  Y+A   +     + C     +
Sbjct: 676 GS-------------IAYVSQVPWIMNGTVKENILFGHKYDADFYDT--TLRACALAVDL 720

Query: 554 TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYT 612
           +  P   +T++G  G  LSGGQK RI++ARA+  + +  +LD+  +A+D   ++  I + 
Sbjct: 721 SILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHV 780

Query: 613 FG---------KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPL 663
            G         K++   +++++SIA  +S          L  +G +++ G ++ +  +  
Sbjct: 781 LGSQGLLSSKVKVLATNKISVLSIADHIS----------LLENGEIIQQGSYEEVTSDKS 830

Query: 664 SELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVV-LEEEILQNDIRS 718
           S LS+++   +   ++    K  E+PE  +  +   E+ +D+  L+++++Q+D RS
Sbjct: 831 SALSKII---ANYGKKQTKGKGDESPESSTPDSEVAEASIDLQKLDDKLVQDDSRS 883

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 152/288 (52%), Gaps = 31/288 (10%)

Query: 412  RIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGR 470
            R P +SP    +  P KGEI F+NV F+Y  RPG   + K+L+  I+ G  + I G +G 
Sbjct: 1229 RKPEVSPP---EEWPTKGEIHFENVDFSY--RPGLPTVLKNLSLDIKSGEKIGICGRTGA 1283

Query: 471  GKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDN---- 526
            GKSTI S L +  + ++G + +D  DIS +    LRR + I+ Q+P+L  G+IR N    
Sbjct: 1284 GKSTIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPF 1343

Query: 527  ------------ITYGLTYEATAEEIR-RVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
                        +  G   +    EI+ +   +   H+ + KF      ++   G   S 
Sbjct: 1344 NEHQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSL 1401

Query: 574  GQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKK-KEVTIISIAHRLS 632
            G++Q +A+ RAL+++  +LILDEATS++D E++  I     +++++    TI+ IAHRL 
Sbjct: 1402 GERQLLALTRALVRQARILILDEATSSVDYETDGKIQ---ARIVEEFGHCTILCIAHRLK 1458

Query: 633  TIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERN 680
            TI   + ++VL   G V E    KTLF    S + + + ++S I E +
Sbjct: 1459 TILTYDRILVL-EKGEVAEFDTPKTLFAQEDS-IFRSMCQRSGITEED 1504

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 113/212 (53%), Gaps = 22/212 (10%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F  LNF+I+ G  + +VGP G GK+++ +    +    +G I ++G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 509 IGIVQQEPILMSGSIRDNITYGLTY-EATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
             ++   P + + S++DNI +G  Y +A  +E+ RV   C   + +   P    T +G  
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYDEVIRV---CSLKSDLDILPAGDLTEIGER 751

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIIS 626
           G  LSGGQK RI +AR++ K+ ++ + D+  SA+D    +  ++  F  L+K K  T I 
Sbjct: 752 GITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDK--TRIL 809

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
             H+LS + R+  VIVLGNDGS  +IG  + L
Sbjct: 810 ATHQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 137/516 (26%), Positives = 232/516 (44%), Gaps = 50/516 (9%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXX 245
            S ++   +     FF+   +G +++R  +D Y    V+ RS +Q   +  K         
Sbjct: 1035 SSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILV-- 1092

Query: 246  XXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNS--RKLQEAT-GQLTRVSEEQFSGV 302
                 I      F+L   P  +L   Y    +R +   R+L   T   +    +E   G+
Sbjct: 1093 -----ICWNTWQFILLVIPMGVLYLYYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGL 1147

Query: 303  KTVQAFVAEQREIK----RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG 358
             T++ +  ++R I     R +N +   Y     + ++  +L  + S       L++    
Sbjct: 1148 ATIRGYEQQKRFIHINQARVDNNMSAYYPSINSNRWLAYRLEFLGS-------LIIFGAA 1200

Query: 359  SYLVLH---GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL---FELTDR 412
            S  +L    G L+ G +   + Y      ++  +     E+   + +  R+    EL   
Sbjct: 1201 SLSILKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSE 1260

Query: 413  IPMI-SPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGR 470
             P+I       +  P +G I+F+N S  Y  RP    + K+++  I+P   V IVG +G 
Sbjct: 1261 APLIIEEKRPSENWPERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGA 1318

Query: 471  GKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYG 530
            GKS++   L +  +   G+I VDG +IS++    LR  + I+ Q+  +  G+IR+NI   
Sbjct: 1319 GKSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENIDPT 1378

Query: 531  LTYEATAEEIRRVTKQCFCHNFITKFPDQ---------YQTILGPNGTLLSGGQKQRIAI 581
              Y  T E+I    +       I +  ++           T +   G  LS GQ+Q + +
Sbjct: 1379 NIY--TDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCL 1436

Query: 582  ARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVI 641
            ARALL    +LILDEAT+A+DVE++S I  T     K +  TI++IAHRL+TI  S+ ++
Sbjct: 1437 ARALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIV 1494

Query: 642  VLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
            VL + G V E    + L  N  S L   L E+S +N
Sbjct: 1495 VL-DKGEVAEFDTPQNLLKNTES-LFYSLCEQSGLN 1528

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 115/480 (23%), Positives = 211/480 (43%), Gaps = 65/480 (13%)

Query: 272 YFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNV-----IKDVY 326
           Y  R+ +   +   +   + TRV  E  + +K+++ +  EQ   ++  +V     +K++ 
Sbjct: 465 YLMRIQKQLQKVQMKYKDERTRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLT 524

Query: 327 NVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAV 386
            +G  +A  N + F +   L   S   V  Y     L   L    LT + + T    +  
Sbjct: 525 RIGVFNAMTNFQ-FNLVPFLVSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALP 583

Query: 387 FGLSSFYSEIMQGVGAASRLFEL-------TDRIPMISPTTGKKYIPGKGEIEFK---NV 436
             +++F    ++   + SRLF         TD I  + P      +  +G+I      N 
Sbjct: 584 IVITAF----IEASVSMSRLFSFMTNEELQTDAIQRLPP------VKKQGDIAVNIGDNA 633

Query: 437 SFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQ 495
           +F +  +P  ++  K++ F+ + G   CIVG  G GKS     +L       G  T+ G 
Sbjct: 634 TFLWKRKPEYKVALKNIEFQAKKGELACIVGKVGSGKSAFIQSILGDLFRVKGFATIHG- 692

Query: 496 DISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITK 555
                       ++  V Q P +M+G+++DNI +G  Y    E   +  + C     ++ 
Sbjct: 693 ------------NVAYVSQLPWIMNGTVKDNILFGHKY--NQEFYEKTLRACALTIDLSI 738

Query: 556 FPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFG 614
            PD  QT++G  G  LSGGQK R+++ARA+  + +V +LD+  +A+D   S+  I +  G
Sbjct: 739 LPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIG 798

Query: 615 ---------KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665
                    +++   +++++SIA            I L +DG +V+ G +  +  N  S 
Sbjct: 799 PNGLLHTKTRVLATNKISVLSIADN----------ITLLDDGEIVQQGTYNEVTDNINSP 848

Query: 666 LSQLLNE---KSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEK 722
           L +L++E   K+ +N     E      E  +  N  N   V+  L+E    ND++  D++
Sbjct: 849 LCKLISEYGNKNNVNSSTDTESTMTPKESSTSLNRENTVPVETELKELDKLNDLKFLDDE 908

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/227 (35%), Positives = 127/227 (55%), Gaps = 7/227 (3%)

Query: 426  PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
            P KG+I+F++ S  Y     + + K +N  ++P   + IVG +G GKS++   L +  + 
Sbjct: 1269 PSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEA 1327

Query: 486  TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545
              G I +DG  I+++    LR  + I+ Q+  +  G++R+NI    T + + EEI RV +
Sbjct: 1328 AEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIWRVLE 1385

Query: 546  QCFCHNFITKFP-DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
                 N +     D   T L   G  LS GQ+Q + +ARALL    +LILDEAT+A+DVE
Sbjct: 1386 LSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVE 1445

Query: 605  SESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVE 651
            ++  I  T     K +  TI++IAHRL+TI  S+ ++VL + G V E
Sbjct: 1446 TDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVRE 1489

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 123/261 (47%), Gaps = 36/261 (13%)

Query: 429 GEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
           G++  K   + +F +  +P  Q+  K++N +++ G   C+VG  G GKS +   LL    
Sbjct: 627 GDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGDLY 686

Query: 485 PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
              G   V G                 V Q P +M+G+++DNI +G  Y+    ++    
Sbjct: 687 RVKGYAAVHGST-------------AYVSQVPWIMNGTVKDNILFGHKYDPVFYDL--TI 731

Query: 545 KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE 604
           K C     +   PD  QT++G  G  LSGGQK R+++ARA   + +  +LD+  +A+D  
Sbjct: 732 KACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEH 791

Query: 605 -SESAINYTFG---------KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGK 654
            ++  I +  G         KL+   ++T++SIA  +S +   EI+      GS  +I K
Sbjct: 792 VAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVEGGEII----QHGSYEDISK 847

Query: 655 FKTLFGNPLSELSQLLNEKST 675
                 +PLS L +   +K T
Sbjct: 848 D---LDSPLSNLVKEFGKKKT 865

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 126/228 (55%), Gaps = 9/228 (3%)

Query: 426  PGKGEIEFKNVSFAYPTRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P  GEI+F N S  Y  RP  + I K ++  I P   + IVG +G GKS++   L +  +
Sbjct: 1270 PESGEIKFVNYSTRY--RPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIE 1327

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
              +G I +DG  I  +    LR  + I+ Q+  +  G++R+NI    T   T EEI    
Sbjct: 1328 AASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPTNRYTDEEIWNAL 1385

Query: 545  KQCFCHNFITKF-PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
                  + I     +  +T+L   G+ LS GQ+Q + +ARALL   N+LILDEAT+A+DV
Sbjct: 1386 ALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDV 1445

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVE 651
            E++  I  T     K++  TI++IAHR++TI  S+ +IVL + G V E
Sbjct: 1446 ETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTE 1490

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 192/433 (44%), Gaps = 61/433 (14%)

Query: 292 TRVSEEQFSGVKTVQAFVAEQREIKRYNNV-----IKDVYNVGKESAFINAKLFTITSSL 346
           TRV+ E  + +K+++ +  E     + ++V     +K++  +G   A  N + F I   L
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQ-FNIVPFL 540

Query: 347 GDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL 406
              S   V  Y     L   L    LT + + +         +SSF    ++   + +RL
Sbjct: 541 VSCSTFAVFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRL 596

Query: 407 F------ELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPG 459
           F      EL +   +  P    K I  +G ++  + +F +  +P  ++  K++NF  + G
Sbjct: 597 FAFLTNEELQNDAVLREPKV--KNIGDEG-VKVNDATFLWQRKPEYKVALKNINFVAKKG 653

Query: 460 SNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILM 519
              CIVG  G GKS +   LL       G  TV G D++             V Q P +M
Sbjct: 654 ELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHG-DVAN------------VSQVPWIM 700

Query: 520 SGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRI 579
           +G+++DNI +G  Y+   E  +   K C     ++  PD  QT++G  G  LSGGQK R+
Sbjct: 701 NGTVKDNILFGHKYDP--EFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARL 758

Query: 580 AIARALLKKPNVLILDEATSALDVE-SESAINYTFG---------KLMKKKEVTIISIAH 629
           ++ARA+  + +  +LD+  +A+D   ++  I +  G         K++   ++T++SIA 
Sbjct: 759 SLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIAD 818

Query: 630 RLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETP 689
            ++ +   EI+      GS  ++ +      +PLS+L         I E     KP  + 
Sbjct: 819 SITLMENGEII----QQGSYDQVNEST---NSPLSKL---------IAEFGKKGKPTPSQ 862

Query: 690 EQESQKNAANESI 702
              S    A+E I
Sbjct: 863 STTSLAKLASEGI 875

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 126/503 (25%), Positives = 220/503 (43%), Gaps = 50/503 (9%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            Q +K+ IH    F D   +G +++R   D   +   + + V                   
Sbjct: 971  QALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQFANIVGVCVMCIV 1030

Query: 251  ISPELS---AFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-EEQFSGVKTVQ 306
              P  +    FL+F    +       GR I+    +L+         +  E   G+ T++
Sbjct: 1031 YLPWFAIAVPFLVFIFVFIQNHYQSAGREIK----RLEAIQRSFVYNNFNEILGGMDTIK 1086

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLH-G 365
             + +E+R I + + +I  +   G  +  +   +  +   +     L++         H  
Sbjct: 1087 FYKSEERYIAKSDYLIDKMNEAGYLTVCVQRWVAILVDMIAVAFALIITLLCVTRQFHIS 1146

Query: 366  GLSIGDLTAYMMYTELTGSAVFG-LSSFYSEIMQGVGAASRLFELTDRIPMIS-----PT 419
              S+G L  Y++  +L G  +F  L    S++   + +  RL      +P+ +      T
Sbjct: 1147 ASSVGVLLTYVL--QLPG--LFNTLLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPET 1202

Query: 420  TGKKYIPGKGEIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTIASL 478
               +  P +G I+F+NV FAY  RPG  I  K++N +I     + I G +G GKSTI + 
Sbjct: 1203 APPESWPEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTA 1260

Query: 479  LLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE 538
            L +  + T+G+I +D  DI+KL    LR+ + I+ Q+P+L  G IR N+     +E T E
Sbjct: 1261 LYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNL--DPFHERTDE 1318

Query: 539  EI--------------------RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQR 578
            E+                    + +T+     + + KF      ++  +G   S G++Q 
Sbjct: 1319 ELWDVLVRGGAIAPEDLAETKAQHITEDGTSAD-LHKF--HLDKVVEEDGANFSLGERQI 1375

Query: 579  IAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSE 638
            +A+ RAL++   +LILDEATS++D E++  I             TI+ IAHRL TI   +
Sbjct: 1376 LALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYD 1433

Query: 639  IVIVLGNDGSVVEIGKFKTLFGN 661
             ++VL + G V E      LF +
Sbjct: 1434 RILVLEH-GEVAEFDTPMNLFKD 1455

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 114/206 (55%), Gaps = 20/206 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F +LNF+I+ G  V I GP G GK+++ +    + + T+GTI ++G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + ++RDNI +G  YE   ++ + V + C   + +   P   +T +G  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEE--DKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR + K+ ++ +LD+  SA+D    +  ++    KL+  K  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIG 653
            H+LS I ++  +IVLGNDGS VEIG
Sbjct: 774 THQLSLIDKASRIIVLGNDGS-VEIG 798

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 154/308 (50%), Gaps = 39/308 (12%)

Query: 400  VGAASRLFELTDRIPMIS-----PTTGKKYIPGKGEIEFKNVSFAYPTRPGSQI-FKSLN 453
            + +A RL     ++P+ +       T  +  P KG+I F+NV FAY  RPG  I  K+ N
Sbjct: 1177 MNSAERLVSYATKLPLEADYRKPEMTPPESWPSKGKIVFENVDFAY--RPGLPIVLKNFN 1234

Query: 454  FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513
              I+ G  + I G +G GKSTI S L +  + TAG I +D  DIS+L    LR+ + I+ 
Sbjct: 1235 LDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIP 1294

Query: 514  QEPILMSGSIRDNI------TYGLTYEATAE----------EIR-RVTKQCFCHNFITKF 556
            Q+P+L  G+IR N+      T    ++A             E+R +   +   H  + KF
Sbjct: 1295 QDPVLFRGTIRKNLDPFDERTDDELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKF 1354

Query: 557  PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY----T 612
                   +   G+  S G++Q +A+ RAL+++  +LILDEATS++D E++  I       
Sbjct: 1355 --HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEE 1412

Query: 613  FGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNE 672
            FG      + TI+ IAHRL TI   + ++VL   G V E      LF    S    + + 
Sbjct: 1413 FG------DCTILCIAHRLKTIVNYDRILVL-EKGEVAEYDTPWALFSQEDSIFKSMCS- 1464

Query: 673  KSTINERN 680
            +S I ER+
Sbjct: 1465 RSGIVERD 1472

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 104/211 (49%), Gaps = 20/211 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK LNF I+ G  + I GP G GKS++ + +    +   G I V+G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + ++RDNI +G  +    E+   V   C     +   P    T +G  G
Sbjct: 652 --LMCGYPWIQNATVRDNIIFGSPF--NKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR++ KK ++ + D+  SA+D    +  ++     ++  K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK--TRILA 765

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            H+LS I R+  VIVLG DG  V+IG  + L
Sbjct: 766 THQLSLIERASRVIVLGTDGK-VDIGTVEEL 795

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 139/569 (24%), Positives = 253/569 (44%), Gaps = 74/569 (13%)

Query: 147  AFGLSLYEFLGCIGAALLIG---TAANFGXXXXXXXXXXXXXXXXXSQVIKKTIHQDAEF 203
            A+ LS Y  +G I + L  G    A  FG                 ++++         F
Sbjct: 1039 AYFLSTYTIIGFISSFLTAGKVWVAVLFGTNATKKIF---------AKLLSSIFLAKLRF 1089

Query: 204  FDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELSAFLLFFT 263
             D   VG +++R   D  ++ + +       F +++           I+P    FLLF  
Sbjct: 1090 HDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPR---FLLFAI 1146

Query: 264  PPVMLSSMYF--GRLIRDNSRKLQEA----TGQLTRVSEEQFSGVKTVQAFVAEQREIKR 317
            P   L ++Y+  G L    SR+L+         + ++  E   GV T++A   E+R I +
Sbjct: 1147 P---LCALYYIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQ 1203

Query: 318  YNNVIKD----VYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLT 373
                I       + +   + +I  ++  I + +   S L+++    YL    GL+   L+
Sbjct: 1204 TLVAIDKSNAPFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYL--DAGLAGILLS 1261

Query: 374  AYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIP-----GK 428
                +TE T   +  + S    +M  V    R+ E  D +P+ S  +     P       
Sbjct: 1262 NAFSFTE-TAQWIIKVFSGVELLMSSV---ERIKEYVD-VPLESSESNNYATPLANWPQT 1316

Query: 429  GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488
            G+IEF+N++  Y     S+    ++FK++ G+ V IVG +G GKS+I + + +      G
Sbjct: 1317 GDIEFENLTLRYSPH-SSKALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDG 1375

Query: 489  TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA--EEIRRV--- 543
            TI +D +DI  +  + LR  I  + Q P L  G+IR N+     Y      E + +V   
Sbjct: 1376 TIIIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLI 1435

Query: 544  -TKQCFC------------HNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPN 590
               +  C            H    +F D   T++   G+ +S GQ+Q + +AR++L   N
Sbjct: 1436 EQSEGLCSLPGQKLSYPSNHKLRNRFID-LNTVVKSGGSNISQGQRQLLCLARSMLGARN 1494

Query: 591  VLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVV 650
            ++++DEAT+++D  S++ I  T  + M+    T+++IAHRL ++   + ++V+ + G V 
Sbjct: 1495 IMLIDEATASIDYVSDAKIQKTIRETMRN--TTVLTIAHRLRSVIDYDKILVM-DMGRVE 1551

Query: 651  EIGKFKTLFGNPLSELSQLLNEKSTINER 679
            E       + +P +    L+++K+TI  R
Sbjct: 1552 E-------YDHPYN----LISDKNTIFHR 1569

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 142/320 (44%), Gaps = 50/320 (15%)

Query: 418 PTTGKKYI--PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTI 475
           P T K  I    K ++ F+N +  +     S   K+++   +  +   I+GP+G GKS++
Sbjct: 650 PETRKYEILTQSKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSL 709

Query: 476 ASLLLKYYKPTAGTI---TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
              LL      +G I   TV  +D  ++    +   +    Q P L+SG+I+DNI +G  
Sbjct: 710 LLGLLGELNLRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEF 769

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
           +    ++   V K C     I       +T +G  G  LSGGQ+QRIA+ARA+      L
Sbjct: 770 F--NQQKFDDVIKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYL 827

Query: 593 ILDEATSALDVESESAI--NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSV- 649
           + D+  SA+D E+   I      G +MK +  T I  +H +S I +    +V+ ++G V 
Sbjct: 828 LFDDCLSAVDPETALHIYEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVK 885

Query: 650 ------------------------------VEIGKFKTLFGN----PLSELSQLLNEKST 675
                                         +++ +FKTL       P+ E  Q  +E++ 
Sbjct: 886 AQGKPSDLIESSKFLKESINNDPGDKSYNQIKLKQFKTLKKTENVLPIEEDPQ--DEENP 943

Query: 676 INERNPNEK--PAETPEQES 693
               NP E+  P ETPE E+
Sbjct: 944 QEAENPQEEEDPQETPEMEN 963

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 124/502 (24%), Positives = 223/502 (44%), Gaps = 52/502 (10%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            + +K+ +H    F D   +G +++R   D   +   +T+ V    +  L           
Sbjct: 964  KAVKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESV----RLFLFQASNIVGVVI 1019

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG-QLTRVSE---EQFSGVKTVQ 306
            +      +     P ++L         + +SR+++     Q + V     E  SG+ T++
Sbjct: 1020 MCIIYLPWFAIAVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIR 1079

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLH-- 364
            A+  E R + + + +I  +   G     I  +  +I   +  M+F L++   + L +   
Sbjct: 1080 AYRGEARFLTKSDFLINKMNEAGYVVVAIQ-RWVSIALDMIAMAFALII---TLLCVTRQ 1135

Query: 365  ---GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQG---VGAASRLFELTDRIPMISP 418
                  S+G L  Y++  +L G     L++    + QG   + +A RL      +P+ + 
Sbjct: 1136 FSISAASVGVLLTYVL--QLPGL----LNTLMRAMTQGENDMNSAERLISYATDLPLEAA 1189

Query: 419  -----TTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGK 472
                 T+  +  P +G I+F +VS AY  RPG   +   ++  +  G  + I G +G GK
Sbjct: 1190 YRRPETSPPESWPSEGAIDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGK 1247

Query: 473  STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIR-------- 524
            STI S L +  +   G+IT+DG DI++L    LR  + I+ Q+P+L  G +R        
Sbjct: 1248 STIMSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHE 1307

Query: 525  --DNITYGLTYE----ATAEEIRRVTKQCFCHNFITKFPD-QYQTILGPNGTLLSGGQKQ 577
              DN  +         AT +E             +T       +  +  +G+  S G++Q
Sbjct: 1308 RSDNELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQ 1367

Query: 578  RIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRS 637
             +A+ RAL++   +LILDEATS++D E+++ I           E T++ IAHRL+TI   
Sbjct: 1368 LLALTRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDY 1425

Query: 638  EIVIVLGNDGSVVEIGKFKTLF 659
            + ++VL + G V E      LF
Sbjct: 1426 DRILVL-DQGRVCEFDTPHALF 1446

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK+LN +I  G  V + G  G GKS++ + +  + K  +G I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 509 IGIVQQEPILMSGSIRDNITYGLTY-EATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
             ++   P + + +++DNI +G  + EA  +E  RV   C     +   P   +T +G  
Sbjct: 642 --LLCGYPWIQNTTVKDNILFGSPFDEARYKETIRV---CSLQADLDLLPAGDKTEIGER 696

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTII 625
           G  LSGGQK RI +AR++ KK ++ + D+  SA+D      I      G L  K  V   
Sbjct: 697 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGKTRVL-- 754

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSV 649
              H+LS I R+  VI +  DG+V
Sbjct: 755 -ATHQLSLIARASKVIFIDLDGTV 777

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  117 bits (292), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 156/305 (51%), Gaps = 47/305 (15%)

Query: 400 VGAASRLFELTDRIP-----MISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNF 454
           + +  R+ E TD IP      ISP       P  G++E KN+S  Y     S+   +++F
Sbjct: 1   MSSVERIKEYTD-IPSESNGYISPPAN---WPQTGDVELKNLSLRYSPH-SSKALDNVSF 55

Query: 455 KIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQ 514
           K++ G+ V IVG +G GKS+I + + +      GTIT+D +DI  +  + LR  I  + Q
Sbjct: 56  KVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQ 115

Query: 515 EPILMSGSIRDNIT----------YGLTYEATAEEIRRVTKQCF----------CHNFIT 554
           +P L  G++R N+           YG+  +     I    + C            H    
Sbjct: 116 DPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGL--IEECDELCLIFEQEQPNFSSHKLRN 173

Query: 555 KFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFG 614
           +F D   T++   G+ LS GQ+Q + +AR++L   N++++DEAT+++D  S++ I  T  
Sbjct: 174 RFID-LNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIR 232

Query: 615 KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674
           + MK    TI++IAHRL ++   + ++V+       E+G+ K  + +P +    L+++++
Sbjct: 233 ETMKN--TTILTIAHRLRSVIDYDKILVM-------EMGRVKE-YDHPYT----LISDRN 278

Query: 675 TINER 679
           TI  R
Sbjct: 279 TIFYR 283

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 115/398 (28%), Positives = 197/398 (49%), Gaps = 52/398 (13%)

Query: 297  EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV-- 354
            E   G+ T++A+ +++R + + + +I  +   G     +   +  +  S+  +  L++  
Sbjct: 1042 EVLGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAILLDSVAVVFALIITL 1101

Query: 355  LAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL-------- 406
            L       +  G S+G L  Y++  +L G     L +  ++    + +A RL        
Sbjct: 1102 LCVTRAFPISAG-SVGVLLTYVL--QLPGLLNTILRAL-TQTENDMNSAERLVTYATELP 1157

Query: 407  FELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIV 465
             E   R P +SP       P KG+I+F +V+FAY  RPG   + K++N KI  G  + I 
Sbjct: 1158 LEAAYRKPEVSPPES---WPEKGDIDFIDVNFAY--RPGLPVVLKNMNLKINNGEKIGIC 1212

Query: 466  GPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRD 525
            G +G GKSTI S L +  + + G I +DG DI K+    LR+ + I+ Q+P+L  G+IR 
Sbjct: 1213 GRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRK 1272

Query: 526  NI------TYGLTYEATAEEIRR-VTKQCFCHNFITKFPDQYQT-----------ILGPN 567
            N+      +  L ++A    IR  V ++   ++   + PD+  +           ++   
Sbjct: 1273 NLDPFKECSDDLLWDAL---IRTGVVERENLNDIKLEKPDENNSYSNMHKFHLDELVEEE 1329

Query: 568  GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES----ESAINYTFGKLMKKKEVT 623
            G+  S G++Q +A+ RAL++   +LILDEATS++D E+    +S I   FG      + T
Sbjct: 1330 GSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRIVSEFG------DCT 1383

Query: 624  IISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
            I+ IAHRL TI   + ++VL   G + E  K   LF +
Sbjct: 1384 ILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFND 1420

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 104/202 (51%), Gaps = 21/202 (10%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F  LN +I  G  + + GP G GK+++ + +  + K T+G + V+G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYE-ATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
             ++   P +++ ++RDNI +G  YE A   EI  V   C     +   P   +T +G  
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPYEEARYNEIVEV---CSLDADLKILPAGDRTEIGER 683

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIIS 626
           G  LSGGQK RI +ARA+ K  ++ + D+  SA+D    +  ++     ++K K  T I 
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRIL 741

Query: 627 IAHRLSTIRRSEIVIVLGNDGS 648
             H+LS I R++ +IV+G +GS
Sbjct: 742 ATHQLSVIERADRIIVVGPNGS 763

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 146/294 (49%), Gaps = 36/294 (12%)

Query: 412  RIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGR 470
            R P ++P       P KGEI FKNV F+Y  RPG   + K+LN  I+ G  + I G +G 
Sbjct: 1198 RKPEMAPPES---WPSKGEIAFKNVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGA 1252

Query: 471  GKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI--- 527
            GKSTI S L +  + + G I +D  +IS++    LRR + I+ Q+P+L  G+IR N+   
Sbjct: 1253 GKSTIMSALYRLNELSGGEILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNLDPF 1312

Query: 528  ---TYGLTYEATAE----------EIR-RVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573
               T    ++A             E++ +  ++   H  + KF       +   G+  S 
Sbjct: 1313 NERTEDELWDALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSL 1370

Query: 574  GQKQRIAIARALLKKPNVLILDEATSALDVESESAINY----TFGKLMKKKEVTIISIAH 629
            G++Q +A+ RAL+++  +LILDEATS++D E++  I       FG      + TI+ IAH
Sbjct: 1371 GERQLLALTRALVRQSKILILDEATSSVDYETDGKIQVRIVEEFG------DCTILCIAH 1424

Query: 630  RLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNE 683
            RL TI   + ++VL   G V E      LF    S    + +    + E   N+
Sbjct: 1425 RLKTIVNYDRILVL-EKGEVAEFDTPWALFSQEDSIFKNMCSRSGIVEEDFENK 1477

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 106/211 (50%), Gaps = 20/211 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK L+F+I+ G  + I GP G GKS++ + +    + T G I V+G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + +++DNI +G  +    E+   V   C     +   P    T +G  G
Sbjct: 652 --LMCGYPWIQNATVKDNIIFGSPF--NKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR++ K+ ++ + D+  SA+D    +  ++     L++ K  T +  
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVLA 765

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
            H+LS I ++  VIVLG DG  V+IG    L
Sbjct: 766 THQLSLIEKASRVIVLGTDGD-VDIGTVDEL 795

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  122 bits (306), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 120/497 (24%), Positives = 222/497 (44%), Gaps = 43/497 (8%)

Query: 192  VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSI 251
            V+ K +H    FFD    G +++RL  D   V + +       F A++           +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 252  SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311
            +P+     +F      L   ++    R+  R        + +   E   G+ +++A+  E
Sbjct: 1174 TPQFLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRAYGDE 1233

Query: 312  QR----EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGL 367
            +R     + R ++  +  + +   + ++  ++  + + +   S L +  Y +   L  GL
Sbjct: 1234 RRFMLENLSRIDDNNRPFFYLWIANRWLAFRVDLLGALVTFFSGLFI--YLNIGKLDAGL 1291

Query: 368  SIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD-------RIPMISPTT 420
            +   LT  + +TE  G+  F     YS +   + +  RL E  +           + P  
Sbjct: 1292 AGISLTYAIFFTE--GALWF--VRHYSNVEMTMNSFERLKEYMEIEQEPYNENAQLPPDN 1347

Query: 421  GKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL 479
                 P  G I+  ++S  Y P  P  ++ K++NF +EP   V IVG +G GKSTI + +
Sbjct: 1348 W----PQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTIITAM 1401

Query: 480  LKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY--EATA 537
             ++  P  G + +D  DI+ +    LR+ I I+ Q+P L +G+++  +     Y  +   
Sbjct: 1402 FRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDKQIY 1461

Query: 538  EEIRRVT-------------KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARA 584
            E ++RV                      I KF D    +    G  LS GQ+Q + +AR+
Sbjct: 1462 EALQRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEV-TEGGANLSQGQRQLVCLARS 1520

Query: 585  LLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG 644
            LL+ P +++LDEAT+++D  S+  I  T  +  + ++ TI++IAHRL +I   + V+V+ 
Sbjct: 1521 LLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLVM- 1577

Query: 645  NDGSVVEIGKFKTLFGN 661
            + G V E     +L  N
Sbjct: 1578 DAGEVKEYDHPYSLLLN 1594

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 124/271 (45%), Gaps = 23/271 (8%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F+N + A+   P S   ++++ +   G      GP+G GKS++   LL       G I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 491 TVDGQDISK---LNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQC 547
            V   D  +   + +  L   I    Q   L++ + R NI +   Y    +    V + C
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPY--NEQRYNDVLEAC 789

Query: 548 FCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESES 607
                         T +G  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +  
Sbjct: 790 GLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTAL 849

Query: 608 AI--NYTFGKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLS 664
            I  N   G LM+ +  T + ++H ++ T+R ++ V++L N       G+ K   G PL+
Sbjct: 850 LIYENCIIGPLMEGR--TCVLVSHNVALTMRNADWVVILEN-------GRVKAQ-GEPLA 899

Query: 665 ELSQ-LLNE----KSTINERNPNEKPAETPE 690
             ++ LL E    KS+I  R  +    +TP+
Sbjct: 900 LANEGLLGEDKLIKSSIASRTNSSLSLKTPQ 930

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 127/505 (25%), Positives = 220/505 (43%), Gaps = 56/505 (11%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            + +++ +H    F D   +G +++R   D   V   +T+ V    +  +           
Sbjct: 979  KAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESV----RLFVFQLSNIVGVIV 1034

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG-QLTRVSE---EQFSGVKTVQ 306
            +      +     P +ML  +      + +SR+++     Q + V     E   G+ T++
Sbjct: 1035 MCIIYLPWFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIR 1094

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL-VLH- 364
            A+  E+R + + + +   +   G     I  +   I   +  M+F L++         H 
Sbjct: 1095 AYRGERRFLTKSDFLTNKMNEAGYLVVAIQ-RWVAIALDMIAMAFALIVTLLCVTRQFHI 1153

Query: 365  GGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQG---VGAASRL--------FELTDRI 413
               S+G L  Y++  +L G     L+     + QG   + +  RL         E   R 
Sbjct: 1154 SAASVGVLLTYVL--QLPGL----LNMLLRAMTQGENDMNSTERLISYATELPLEAAYRR 1207

Query: 414  PMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGK 472
            P +SP       P  G IEF +VS AY  RPG   + K +   +  G  + I G +G GK
Sbjct: 1208 PEMSPPAE---WPTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGK 1262

Query: 473  STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
            STI S L +  +   G+IT+DG DIS L    LR  + I+ Q+P++  G +R N+     
Sbjct: 1263 STIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNL--DPF 1320

Query: 533  YEATAEEIRRV-------------TKQCFCHNFITKFPDQY----QTILGPNGTLLSGGQ 575
            +E T +E+                T +   H       + +    Q  +  +GT  S G+
Sbjct: 1321 HERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGE 1380

Query: 576  KQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIR 635
            +Q +A+ RAL+++  +LILDEATS++D E+++ I     +       TI+ IAHRL+TI 
Sbjct: 1381 RQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAFSN--CTILCIAHRLNTIL 1438

Query: 636  RSEIVIVLGNDGSVVEIGKFKTLFG 660
              + ++VL + G V E      L+ 
Sbjct: 1439 DYDRILVL-DQGRVCEFDTPAALYA 1462

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 115/253 (45%), Gaps = 28/253 (11%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F +LN +I  G  V + G  G GKS++   L  + K T G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 509 IGIVQQEPILMSGSIRDNITYGLTY-EATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
             ++   P + + ++RDNI +G  Y EA   EI RV   C     +   P   +T +G  
Sbjct: 650 -MLLCGYPWIQNATVRDNILFGSPYNEARYNEIIRV---CSLQADLELLPAGDRTEIGER 705

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTII 625
           G  LSGGQK RI +ARA+ KK ++ + D+  SA+D      I      GKL   +  T +
Sbjct: 706 GITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKL---EGSTRV 762

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKP 685
              H+LS I R+  VI +  DGS V++G  + L           +N     N     +KP
Sbjct: 763 LATHQLSLIARASKVIYIDLDGS-VDVGSVEEL----KKRKPGFVNLMQYSNHSESEKKP 817

Query: 686 AETPEQESQKNAA 698
            E  E++ Q+  A
Sbjct: 818 GEVEEEKRQEAGA 830

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 131/514 (25%), Positives = 240/514 (46%), Gaps = 53/514 (10%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXX 249
            S+++         F D   VG +++R   D  ++ + +       F +++          
Sbjct: 1063 SKLLSSIFEAKLRFHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWIVILIG 1122

Query: 250  SISPELSAFLLFFTPPVMLSSMYF--GRLIRDNSRKLQEA----TGQLTRVSEEQFSGVK 303
             ++P    FL+F  P   L  +Y+  G L    SR+L+         + ++  E   GV 
Sbjct: 1123 YVTPR---FLIFAIP---LCGLYYFVGALYLRASRELKRIDNINVSPIHQLFTEAIKGVV 1176

Query: 304  TVQAFVAEQREIKRYNNVIKD----VYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGS 359
            T++A   E+R I      I       + +   + +I  ++  I + +   S L+++A   
Sbjct: 1177 TIRALADERRFITHTLEAIDGSNAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARAP 1236

Query: 360  YLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPT 419
            YL    GL+   L+    +TE T   +  + S    +M  V       E+       + +
Sbjct: 1237 YL--DAGLAGILLSNAFSFTE-TAQWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDS 1293

Query: 420  -TGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASL 478
             T     P  GEIEFKN+S  Y     S+   +++FK+  G+ V IVG +G GKS+I + 
Sbjct: 1294 ATSPVDWPQTGEIEFKNLSLRYSPH-SSKALDNVSFKVRTGTKVGIVGRTGAGKSSIIAA 1352

Query: 479  LLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI------TYGLT 532
            + +     +GTI +D +DI  ++ + LR  I  + Q P L  G+IR N+      +    
Sbjct: 1353 IYRLSDWESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQV 1412

Query: 533  YEATA--------EEIRRVTKQCFCHNFI-TKFPDQYQTILGPNGTLLSGGQKQRIAIAR 583
            ++A A        E +  VT +    +F   KF D   +++   G+ LS GQ+Q + +AR
Sbjct: 1413 FDALAKVGLIERNEVLCLVTDRQQSSSFSPNKFSD-LNSVVRSGGSNLSQGQRQLLCLAR 1471

Query: 584  ALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRL-STIRRSEIVIV 642
            ++L    ++++DEAT+++D  S++ I  T  + M+    TI++IAHRL S I  ++I+  
Sbjct: 1472 SMLGSRKIMLIDEATASIDYISDAKIQKTIRETMEN--TTILTIAHRLRSVIDYNKIL-- 1527

Query: 643  LGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
                  V+++G+ K  + +P +    L+++K+TI
Sbjct: 1528 ------VMDMGRVKE-YDHPYN----LISDKNTI 1550

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 144/311 (46%), Gaps = 30/311 (9%)

Query: 427 GKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            K ++ FK+ +  +     S   K+++ + +  S   I+GP+G GKS++   LL      
Sbjct: 660 SKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLC 719

Query: 487 AGTI---TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRV 543
           +G I   +VD +D  ++    +   +    Q P L+SG+I DNI +G            V
Sbjct: 720 SGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAV 777

Query: 544 TKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
            K C     +       +T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D 
Sbjct: 778 IKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVD- 836

Query: 604 ESESAINYT----FGKLMKKKEVTIISIAHRLSTI-RRSEIVIVLGNDGSVVEIGKFKTL 658
             E+A+N       G +MK +  T I  +H +S I +++E +++L N G V   GK    
Sbjct: 837 -PETALNIYEKCLCGPIMKGR--TCIITSHNISLITKKAEWLVILDN-GEVKGQGK---- 888

Query: 659 FGNPLSELSQLLNEK-------STINERNPNEKPAETPEQESQKNAANESIVDVVLEEEI 711
             + L+E +  L E         + N+  P  K A T   ++      E I  V  E+ +
Sbjct: 889 -PSDLAESNNFLKESMNNGLADESGNQAKPKSKTAATL-HDTDNADVQEEISQV--EDAV 944

Query: 712 LQNDIRSQDEK 722
               I S +EK
Sbjct: 945 EPAQIESYEEK 955

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  119 bits (298), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 148/280 (52%), Gaps = 24/280 (8%)

Query: 418  PTTGKKYI-PGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTI 475
            P T   +I P  G+I+FK+ +F Y  + G   I K+ N  ++ G  + I G +G GKSTI
Sbjct: 788  PETSPGHIWPENGKIQFKDANFRY--KEGLPLILKNFNMLVQSGEKIGICGRTGAGKSTI 845

Query: 476  ASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-YGLTYE 534
             + L +  + T G I +D  DIS L    LR+++ I+ Q+PIL  G+IR N+  +    +
Sbjct: 846  MNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDD 905

Query: 535  ATAEEIR----RVTKQCFCH--------NFITKFPDQYQTILGPNGTLLSGGQKQRIAIA 582
            AT  E       + +  F H          +TKF       +  +GT  S G+KQ +A  
Sbjct: 906  ATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKF--HLTAHVEEDGTNYSLGEKQLLAFT 963

Query: 583  RALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIV 642
            RA++    V++LDEA+S++D E+++ I     K       TI+ IAHRL+TI + + ++V
Sbjct: 964  RAIIHHSKVVVLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRILV 1021

Query: 643  LGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPN 682
            L + G+++     + LF N  +EL + +  ++ I E + N
Sbjct: 1022 L-DHGNIIGFENPRVLFEN--NELFRQMCFQANIEEADFN 1058

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 127/259 (49%), Gaps = 24/259 (9%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F +LNF I  G  + I GP G GK+++   +    K   GTI +DG         +L+  
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDG---------NLQ-- 252

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
              +   P + + ++RDNI +G  YE   E+   V + C     +  F  +  T +G  G
Sbjct: 253 ---LCGYPWVQNTTVRDNIIFGSKYEK--EKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIIS 626
             LSGGQK RI +ARA+ K  ++ + D+  SA+D    + I  N   G L  K     I 
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGALSGK--TXXIL 365

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPA 686
             H+LS I++++ ++VLGND S  EIG +K L  +  + ++ L+   S +      +   
Sbjct: 366 ATHQLSLIKKADRIVVLGNDNS-FEIGPYKELIQSNKTFIN-LIEYSSQMELEKIKKTKG 423

Query: 687 ETPEQESQKNA-ANESIVD 704
              EQE  K +  +ESI+D
Sbjct: 424 SIVEQEKYKGSRISESILD 442

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 124/532 (23%), Positives = 218/532 (40%), Gaps = 78/532 (14%)

Query: 190  SQVIKKTIHQDAEFFDNNKVGDLISRLGSDAY----VVSRSMTQKVSDGFKALLCXXXXX 245
            SQ++   +     FF+   +G +++R  +D Y    ++ R+ +Q  S+  K         
Sbjct: 1011 SQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVVIC 1070

Query: 246  XXXXSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVS-----EEQFS 300
                          +FF  P+    +Y+ +     SR+L+     +TR       +E   
Sbjct: 1071 VSTWQ--------FIFFIVPMSFLYIYYQQYYMRTSRELRRLDS-VTRSPTISHFQETLG 1121

Query: 301  GVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSY 360
            G+ T++ +  E R I      + +  +    S   N  L      LG +  L     G Y
Sbjct: 1122 GISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLGIY 1181

Query: 361  LVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRL---FELTDRIP-MI 416
             +  G ++ G +   + Y      ++  +     E+   + +  R+    EL    P ++
Sbjct: 1182 RLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIV 1241

Query: 417  SPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQ---IFKSLNFKIEPGSNVCIVGPSGRGKS 473
                     P  G ++F +    Y TR  +    + K +   I+P   + IVG +G GKS
Sbjct: 1242 EDKRPDVNWPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKS 1297

Query: 474  TIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTY 533
            ++   L +  + + G I VDG +  ++    LR  + I+ Q+  +  G++RDNI    T 
Sbjct: 1298 SLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNI--DPTG 1355

Query: 534  EATAEEIRRVTKQCFCHNFITKF------------------------------------- 556
            + T EEI +  +     + I                                        
Sbjct: 1356 QYTDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSDGLTS 1415

Query: 557  -------PDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI 609
                    +   T L   G+ LS GQ+Q + +ARALL   N+L+LDEAT+A+DVE++  I
Sbjct: 1416 SGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLI 1475

Query: 610  NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
              T     K +  TI++IAHRL+TI  S+ ++VL + G + E    +TL G+
Sbjct: 1476 QETIRSAFKNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGD 1524

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 112/502 (22%), Positives = 216/502 (43%), Gaps = 81/502 (16%)

Query: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFV-- 309
           S  +  F+L F  P+   + Y  R+ +   +   +   + TR+  E  + +K+++ +   
Sbjct: 431 SMWIGVFILIFMMPI---NSYLMRIQKKLQKIQMKNKDERTRLISEILNNIKSLKLYAWE 487

Query: 310 ---AEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGG 366
               E+ E  R    +K++  +G   AF + + F I   L   S   V  +     L   
Sbjct: 488 APYKEKLEYVRNEKELKNLTKMGCYVAFTHFQ-FNIVPFLVSCSTFAVFVWTQDRPLTTD 546

Query: 367 LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFEL----------TDRIPMI 416
           L    LT + + +    +    ++SF    ++   + +RLF              R+P +
Sbjct: 547 LVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRLFSFLTNEELQKDAVQRLPNV 602

Query: 417 SPTTGKKYIPGKGEIEFK---NVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGK 472
             T         G++  K   + +F +  +P  ++  K++NF+   G   CIVG  G GK
Sbjct: 603 KNT---------GDVSIKLGDDATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGK 653

Query: 473 STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
           S +   +L       G  TV G              +  V Q P +M+G++++NI +G  
Sbjct: 654 SALIQSILGDLFRVKGFATVHGD-------------VAYVSQVPWIMNGTVKENILFGHK 700

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
           ++    E  +  K C     ++  PD   T++G  G  LSGGQK R+++ARA+  + +  
Sbjct: 701 FDKKFYE--KTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTY 758

Query: 593 ILDEATSALDVE-SESAINYTFG---------KLMKKKEVTIISIAHRLSTIRRSEIVIV 642
           + D+  +A+D    +  I +  G         K++   ++T+++IA            I 
Sbjct: 759 LFDDPLAAVDEHVGKHLIEHVLGPNGLLHSKTKVLATNKITVLNIAD----------YIT 808

Query: 643 LGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNAANESI 702
           L ++G +++ GK++ +  +P S L +L+NE    +E  P    + +  +E   N      
Sbjct: 809 LLDNGEIIQRGKYEEVTSDPGSPLCKLINEYGKKHESTPGTMVSSSMSKEPSPN------ 862

Query: 703 VDVVLEEEILQNDIRSQDEKDI 724
             V LE+E+   ++   D+ D+
Sbjct: 863 --VPLEDEL--RELHKLDDLDL 880

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 134/234 (57%), Gaps = 23/234 (9%)

Query: 427  GKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
            G  EI F +V   Y P  P   + K+++F + P S V IVG +G GKST+   L +  + 
Sbjct: 1234 GGAEISFDHVYVRYAPHLP--DVLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIEL 1291

Query: 486  TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-YGLTYEATAEEIRRVT 544
            T GTI + G DI+ LN ++LRR + ++ Q+P L SG+I+ NI  +G     + +E+    
Sbjct: 1292 TNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFA 1348

Query: 545  KQ--CFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALD 602
            ++   F      +  +   +++   G  +S GQ+Q + +ARALL+K  +LILDEAT+++D
Sbjct: 1349 RRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASID 1408

Query: 603  VESESAI-----NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVE 651
             E+++ I     +++ G +       +I++AHR+STI   + VIVL  D  +V+
Sbjct: 1409 HETDATIQQVVRDFSSGGI-------VITVAHRMSTIIDYDQVIVL--DSGIVK 1453

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 117/258 (45%), Gaps = 13/258 (5%)

Query: 430 EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
           E+ F+N S  +       + K+L    E      I+GPSG GKS++   LL       G+
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 490 ITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFC 549
           I V      +      R       Q P + + ++++NI +   +    +  + V   C  
Sbjct: 694 IRV-----PRGYMHDDRCSFAFCSQTPWITNATVKENIVFSSQFNT--KRYQEVLHACGL 746

Query: 550 HNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI 609
              I +  +  +T++G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D      I
Sbjct: 747 EEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWI 806

Query: 610 --NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELS 667
                 G LMK K  T I   H ++ +++   +I+L ++G V +IGK +    N  SE  
Sbjct: 807 FQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDF--NFDSEFD 862

Query: 668 QLLNEKSTINERNPNEKP 685
                K    E  PN+KP
Sbjct: 863 YSKPSKLEKAEMKPNKKP 880

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 137/246 (55%), Gaps = 27/246 (10%)

Query: 426  PGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P +G+I+F+ VSFAY  RPG   + K+L+  I  G  + I G +G GKSTI S L +  +
Sbjct: 1193 PQEGKIDFEEVSFAY--RPGLPAVLKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLNE 1250

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT-YG-----LTYEATA- 537
              +G I +DG +IS +    LRR + I+ Q+P+L  G+IR N+  +G       ++A + 
Sbjct: 1251 LESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSDDELWDALSR 1310

Query: 538  ------EEIRRVTKQCFCHNFITKFPDQYQTILG----PNGTLLSGGQKQRIAIARALLK 587
                  E +  V  Q    N  +K  + ++  L       G+  S G++Q +A+ARAL++
Sbjct: 1311 GGSIDKESLEEVKTQKSTGN--SKVQELHKFHLDQEVEEEGSNFSLGERQLLALARALVR 1368

Query: 588  KPNVLILDEATSALDVESESAINYTFGKLMKK-KEVTIISIAHRLSTIRRSEIVIVLGND 646
               VLILDEATS++D E+++ I     ++++   E TI+ IAHRL TI   + ++VL   
Sbjct: 1369 NSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNYDRILVL-EK 1424

Query: 647  GSVVEI 652
            G + E 
Sbjct: 1425 GEIAEF 1430

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 104/216 (48%), Gaps = 30/216 (13%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK +N +I  G  + I GP G GK+++ + +    + T G++ ++G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + ++RDNI +G  ++ +   +  V K C     +   P    T +G  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALD------VESESAINYTFGKLMKKKEV 622
             LSGGQK RI +AR + K  ++ + D+  SA+D      +  E  +    GK       
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK------- 760

Query: 623 TIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL 658
           T +   H+LS +  +  VIVLGNDGS V+IG  + L
Sbjct: 761 TRVLATHQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 123/518 (23%), Positives = 217/518 (41%), Gaps = 48/518 (9%)

Query: 197  IHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELS 256
            ++    FF+   +G +I+R   D   V   +    S  F++LL             P   
Sbjct: 1059 VYSPMSFFETTPIGRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFF 1118

Query: 257  AFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR--- 313
             F +F          Y+    R+  R        +  +  E  +G   + A+   +R   
Sbjct: 1119 VFNIFLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSY 1178

Query: 314  ---EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG----SYLVLHGG 366
               E  ++N  I  ++N    + +++ +L  I +       L+VLA G    S +     
Sbjct: 1179 FNFESVQFN--IDCLFNFRSTNRWLSVRLQAIGA-------LIVLATGLLSLSTIGTSKQ 1229

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISP----TTGK 422
            L+ G +   M Y+    +++  +     +I   + +  R+ E  +  P        T  +
Sbjct: 1230 LTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPE 1289

Query: 423  KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
            K  P  G I+F + S  Y  +    +   +N +IEP   + IVG +G GKST+   L + 
Sbjct: 1290 KSWPAHGSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRI 1348

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             + T G I +DG DIS L    LR ++ I+ Q+     G+IR N+      + + EE+ +
Sbjct: 1349 LEATDGKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNL--DPFDQHSDEELWK 1406

Query: 543  VTKQCFCH-------------------NFITKFPDQYQTILGPNGTLLSGGQKQRIAIAR 583
              +                        N   K  +  +  +  NG+ LS GQ+Q + ++R
Sbjct: 1407 AIEASHLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSR 1466

Query: 584  ALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVL 643
            ALL    +L+LDEAT+++D+E++  I  T       +  TI++IAHR+ T+   + ++VL
Sbjct: 1467 ALLNHSKILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL 1524

Query: 644  GNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNP 681
             + G V E     TL  N  S    L  +   +N+  P
Sbjct: 1525 -DKGEVREFDSPDTLLENKNSIFYNLCEKGGYLNKALP 1561

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 150/275 (54%), Gaps = 26/275 (9%)

Query: 449 FKSLN-FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI-TVDGQDISKLNSKSLR 506
           FK++N F+++ GS  CIVG  G GK+T+   +L      +G   ++  + I + NS    
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS---- 699

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT-KQCFCHNFITKFPDQYQTILG 565
             I    Q+  +M+ S+++NI +G  Y+   E    +T + C     +   PD  +TI+G
Sbjct: 700 --IAYCPQQAWIMNSSVKENILFGHKYD---EHYYNLTIEACQLTEDLKMLPDGDETIVG 754

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKE 621
             G  LSGGQK R+++ARA+  + ++ +LD+  SA+D E S++ I     +   L+K K 
Sbjct: 755 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 813

Query: 622 VTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNP 681
            TII   + +S ++ S+ +  L N   ++E G +  +  +  SE S+L   K+ INE + 
Sbjct: 814 -TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNS--SEDSKL---KALINEFD- 865

Query: 682 NEKPAETPEQESQKNAANESIVDVV-LEEEILQND 715
           N++   + E+ S++   +E   DVV +++ +++ND
Sbjct: 866 NDRDNNSKEEVSEERKTSEETSDVVPIDDNLIEND 900

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 144/281 (51%), Gaps = 42/281 (14%)

Query: 426  PGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
            P KGEI F++VSFAY  RPG   + K ++  I+    + I G +G GKSTI S L +  +
Sbjct: 1199 PSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNE 1256

Query: 485  PTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT------YGLTYEA--- 535
             + G I +D  DI ++    LR+ + I+ Q+P+L  G+IR N+         L +++   
Sbjct: 1257 LSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQEHPDELLWKSLVS 1316

Query: 536  ----TAEEIRRVTKQ--------CFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIAR 583
                +AEE+  V  Q           H F     DQ     G N +L   G++Q +A+ R
Sbjct: 1317 GGAISAEEVEVVKGQKPDSIGSLSSMHKF---HLDQKVEEEGANFSL---GERQLLALTR 1370

Query: 584  ALLKKPNVLILDEATSALDVES----ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEI 639
            AL+++  +LILDEATS++D E+    +S I   FG      + TI+ IAHRL TI   + 
Sbjct: 1371 ALVRQSKILILDEATSSVDYETDNKIQSRIAAAFG------DCTILCIAHRLKTILTYDR 1424

Query: 640  VIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERN 680
            ++VL   G + E    ++L+        Q+   KS INE +
Sbjct: 1425 ILVL-EQGEIEEFDTPRSLYEKKDGIFRQMCI-KSGINESD 1463

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 136/283 (48%), Gaps = 30/283 (10%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           FK+LN  I+ G  V I GP G GKS++ S +  + + T+GT+ VDG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + ++RDNI +G  Y+   E    V + C     I   P    T +G  G
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIIS 626
             LSGGQK RI +AR++ K  ++ + D+  SA+D      I      G+L  K   T I 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRLKGK---TRIL 756

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL--FGNPLSELSQLLNEKSTINERNPNEK 684
             H+LS I ++ +VIVLG DGS  E GK + L      L  L    ++KS+  E + +EK
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDLKRSNKTLINLLHFSSQKSSSKEADTSEK 815

Query: 685 P-AETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKDILD 726
             A     E  K   +ES      E E LQ  +  +   +++D
Sbjct: 816 DLALKTSIEEVKTHDSES-----KEWEELQKQLSKKSRDELVD 853

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 123/518 (23%), Positives = 217/518 (41%), Gaps = 48/518 (9%)

Query: 197  IHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISPELS 256
            ++    FF+   +G +I+R   D   V   +    S  F++LL             P   
Sbjct: 1087 VYSPMSFFETTPIGRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFF 1146

Query: 257  AFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQR--- 313
             F +F          Y+    R+  R        +  +  E  +G   + A+   +R   
Sbjct: 1147 VFNIFLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSY 1206

Query: 314  ---EIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG----SYLVLHGG 366
               E  ++N  I  ++N    + +++ +L  I +       L+VLA G    S +     
Sbjct: 1207 FNFESVQFN--IDCLFNFRSTNRWLSVRLQAIGA-------LIVLATGLLSLSTIGTSKQ 1257

Query: 367  LSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISP----TTGK 422
            L+ G +   M Y+    +++  +     +I   + +  R+ E  +  P        T  +
Sbjct: 1258 LTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPE 1317

Query: 423  KYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKY 482
            K  P  G I+F + S  Y  +    +   +N +IEP   + IVG +G GKST+   L + 
Sbjct: 1318 KSWPAHGSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRI 1376

Query: 483  YKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRR 542
             + T G I +DG DIS L    LR ++ I+ Q+     G+IR N+      + + EE+ +
Sbjct: 1377 LEATDGKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNL--DPFDQHSDEELWK 1434

Query: 543  VTKQCFCH-------------------NFITKFPDQYQTILGPNGTLLSGGQKQRIAIAR 583
              +                        N   K  +  +  +  NG+ LS GQ+Q + ++R
Sbjct: 1435 AIEASHLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSR 1494

Query: 584  ALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVL 643
            ALL    +L+LDEAT+++D+E++  I  T       +  TI++IAHR+ T+   + ++VL
Sbjct: 1495 ALLNHSKILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL 1552

Query: 644  GNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNP 681
             + G V E     TL  N  S    L  +   +N+  P
Sbjct: 1553 -DKGEVREFDSPDTLLENKNSIFYNLCEKGGYLNKALP 1589

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 150/275 (54%), Gaps = 26/275 (9%)

Query: 449 FKSLN-FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI-TVDGQDISKLNSKSLR 506
           FK++N F+++ GS  CIVG  G GK+T+   +L      +G   ++  + I + NS    
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS---- 727

Query: 507 RHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT-KQCFCHNFITKFPDQYQTILG 565
             I    Q+  +M+ S+++NI +G  Y+   E    +T + C     +   PD  +TI+G
Sbjct: 728 --IAYCPQQAWIMNSSVKENILFGHKYD---EHYYNLTIEACQLTEDLKMLPDGDETIVG 782

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGK---LMKKKE 621
             G  LSGGQK R+++ARA+  + ++ +LD+  SA+D E S++ I     +   L+K K 
Sbjct: 783 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 841

Query: 622 VTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNP 681
            TII   + +S ++ S+ +  L N   ++E G +  +  +  SE S+L   K+ INE + 
Sbjct: 842 -TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNS--SEDSKL---KALINEFD- 893

Query: 682 NEKPAETPEQESQKNAANESIVDVV-LEEEILQND 715
           N++   + E+ S++   +E   DVV +++ +++ND
Sbjct: 894 NDRDNNSKEEVSEERKTSEETSDVVPIDDNLIEND 928

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 142/291 (48%), Gaps = 44/291 (15%)

Query: 399 GVGAASRLF--------ELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIF 449
           G+ +A RL         E   R P +SP       P +GEI+F+ VSFAY P+ P   + 
Sbjct: 691 GMNSAERLVTYALDLPQEAEYRRPEMSPPEN---WPDRGEIKFEGVSFAYRPSLP--PVL 745

Query: 450 KSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHI 509
           K+ +  I  G  + I G +G GKSTI S L +  +   G I +D  +I+ L    LR  +
Sbjct: 746 KNFSLNIGSGEKIGICGRTGAGKSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSKL 805

Query: 510 GIVQQEPILMSGSIRDNI------TYGLTYEA-------TAEEIRRVTKQ----CFCHNF 552
            I+ Q+P+L  G+I+ N+      T    +E+         E+I     Q       H+ 
Sbjct: 806 AIIPQDPVLFRGTIKKNLDPFGEKTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHSK 865

Query: 553 ITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES----ESA 608
           + KF    +  +   G   S G+KQ +A+ RAL++   +LILDEATS++D E+    +S 
Sbjct: 866 MHKF--HLEQKVEEEGGNFSLGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSR 923

Query: 609 INYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF 659
           I   FG      + TI+ IAHRL+TI   + ++VL   G V E      LF
Sbjct: 924 IVEAFG------DCTILCIAHRLNTILNYDRILVL-EQGEVAEFDTPWNLF 967

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 127/245 (51%), Gaps = 21/245 (8%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F++LNF I+ G  + + GP G GK+++ S +  +   + G++ V+G+ +S          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
            G     P + + ++RDNI +G  YE    + R+V K C   + +   P    T +G  G
Sbjct: 156 CGY----PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RI +AR + K  ++ + D+  SA+D    +  ++     L+ +K  T I  
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK--TRILA 267

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAE 687
            H+L+ I ++  +IVLGNDGS   IG ++ L     S+L +LL   S  +E + N++   
Sbjct: 268 THQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLLQFTSDKSEEDDNDQKQN 325

Query: 688 TPEQE 692
             ++E
Sbjct: 326 ENDKE 330

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 123/501 (24%), Positives = 230/501 (45%), Gaps = 46/501 (9%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            + +++ +H    F D   +G +++R   D   +   +T+ V    + L+           
Sbjct: 947  KALQRLLHAPMSFMDVTPIGRVMNRFTKDTDTLDNEITESV----RLLIFQIANLTGIII 1002

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG-QLTRVSE---EQFSGVKTVQ 306
            +      +     P ++   ++     + + R+++     Q + V     E   G+ T++
Sbjct: 1003 LCIIYIPWFAIAMPFLVFLYVFVADHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTIK 1062

Query: 307  AFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAY----GSYLV 362
            A+ +EQR + + + +I  +   G     I  +   I+  +  + F L++A       + V
Sbjct: 1063 AYRSEQRFLMKSDFLINKMNEAGYLVTSIQ-RWVAISLDMLAVIFALIIALLCVTRQFHV 1121

Query: 363  LHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPM-----IS 417
              G  S+G +  Y++  +L G     L S  ++    + +A RL      +P+     I 
Sbjct: 1122 SAG--SVGVMVTYVL--QLPGLLNALLRS-QTQTENDLNSAERLVNYAYDLPIEAKYRIL 1176

Query: 418  PTTGKKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIA 476
             T   +  P +G I+F+NVS AY P  P +   K+++  I     + I G +G GKSTI 
Sbjct: 1177 ETQPPEQWPSEGRIKFENVSLAYRPELPVA--LKNVSIDIGSNEKIGICGRTGAGKSTIM 1234

Query: 477  SLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI------TYG 530
            S L +  +   G IT+D  DIS L    LR  + I+ Q+P+L  G IR N+      T  
Sbjct: 1235 SALYRLVELKTGKITIDDIDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDPFQECTDE 1294

Query: 531  LTYEATA-------EEIRRVTKQCFCHNFIT--KFPDQYQTILGPNGTLLSGGQKQRIAI 581
              ++A         +++  +  Q    N ++   F      ++  +G+  S G++Q +A+
Sbjct: 1295 QLWDALVRGGAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVEDDGSNFSLGERQLLAL 1354

Query: 582  ARALLKKPNVLILDEATSALDVESESAINYTFGKLMKK-KEVTIISIAHRLSTIRRSEIV 640
             RAL++   +LILDEATS++D  +++ I     +++++    TI+ IAHRL TI     +
Sbjct: 1355 TRALVRGSKILILDEATSSVDYATDAKIQ---SRIVEEFSNCTILCIAHRLKTILAYNRI 1411

Query: 641  IVLGNDGSVVEIGKFKTLFGN 661
            +VL + G VVE    K L+ +
Sbjct: 1412 LVL-DQGQVVEFDTPKKLYND 1431

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 127/266 (47%), Gaps = 34/266 (12%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F  LNF ++    + I GP G GKS++ + L  + + ++G++T+ G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             ++   P + + +++DNI +G  ++    + ++V + C     +   P   +T +G  G
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFDKP--KYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISI 627
             LSGGQK RIA+AR++ K  ++ + D+  SA+D    +  ++      +K+K  T I  
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQK--TRILA 753

Query: 628 AHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF--GNPLSELSQLLNEKSTINERNPNEKP 685
            H+LS I ++  VI LG DGS  +IG    L       S+L Q             N  P
Sbjct: 754 THQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQF-----------QNSAP 801

Query: 686 AETPEQESQKNAANESIVDVVLEEEI 711
           AE  E +  K A N  I  +  + +I
Sbjct: 802 AEELEDDDTK-AQNMEITAISSQTDI 826

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 118/512 (23%), Positives = 228/512 (44%), Gaps = 70/512 (13%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            Q + + IH    F ++  +G +++R   D    + S+  ++ D  + ++           
Sbjct: 876  QAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVG--- 928

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFS---------- 300
                +S   + + P   ++    G ++       Q +  ++ R+   Q S          
Sbjct: 929  ----ISVLCIIYLPWFAIAIPGLGLILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVL 984

Query: 301  -GVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINA---KLFTITSSLGDMSFLLVLA 356
             GV T++A+ AE+R   + + +I        E++++     +   I  +L  +SF L+++
Sbjct: 985  GGVDTIRAYGAEERFSYKLDYLIDKT----NEASYLYTAVQRWINIVINLVGISFTLIVS 1040

Query: 357  YGSYLVLHG--GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414
                  +    G S G + +Y++   L    +    +  ++    + +  RL      +P
Sbjct: 1041 LLCVTKVFNLSGASTGVVLSYVL---LIPDLLNNTLTMVTQTENDMNSVERLVTYATELP 1097

Query: 415  MISPTTGK----KYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSG 469
                + G+    K  P  GEI+F+NV   Y  R G   +      KI  G  V I G +G
Sbjct: 1098 Q-EASHGEEVPSKTWPENGEIKFENVR--YTHRDGLPAVLDKFTLKIAAGERVGICGRTG 1154

Query: 470  RGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNIT- 528
             GKST+   L +  +  +G + +D  D+SKLN  +LR  + I+ Q+P+L  GS+R N+  
Sbjct: 1155 AGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNLDP 1214

Query: 529  YGLTYEATAEEIRRVTKQCFCHNF-------------------ITKFPDQYQTILGPNGT 569
            +G   E   + ++    +C    F                   + KF  +    +  NG 
Sbjct: 1215 FG---EYDDDVLKNALMRCTVGKFNKTGNESTEGIDTDADNGLVGKF--RLDQDVEENGC 1269

Query: 570  LLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
              S G++Q +A+ARAL++  ++L+LDEAT+A+D  +++ +     +  K +  T++ +AH
Sbjct: 1270 NFSVGERQVLALARALIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAH 1327

Query: 630  RLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661
            RL TI   + ++VL N G ++ +   K+L  N
Sbjct: 1328 RLDTILNYDRILVLEN-GKIIGLDTPKSLLDN 1358

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 120/469 (25%), Positives = 205/469 (43%), Gaps = 70/469 (14%)

Query: 255 LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQRE 314
           +S   LFF   +++  + FG ++      + + T Q   +  E  + +K V+ +  EQ  
Sbjct: 328 MSGVGLFFVTIIVVIFL-FG-IVMKMRLNINQVTDQRVSILREVLNNIKMVKLYCWEQA- 384

Query: 315 IKRYNNVIKDVYNVGKES----AFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIG 370
              Y   IK + ++          +   +F++T SL ++  L+   + +   +HGGL   
Sbjct: 385 ---YEKSIKKIRSLETSKLTRMEILKNVIFSVTFSLPNICSLM--TFLALFKIHGGLK-- 437

Query: 371 DLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP------------MISP 418
              A  +++ L+   +  L SFY  I   +G A  +    DR              +I  
Sbjct: 438 --NAATIFSSLSLFKILSLLSFY--IPLSLGTAIDIVTSLDRFQEFLEAEESKETRIIRE 493

Query: 419 TTGKKYIPGKGEIEFKNVSFAYPTRPGSQI-------FKSLNFKIEPGSNVCIVGPSGRG 471
           T  + Y      I+  + SF + T             F  LNF+I  G  + IVGP G G
Sbjct: 494 TNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIMKGELIIIVGPIGSG 553

Query: 472 KST----IASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI 527
           K++    I  L+ +Y     G + VDG  +S                 P + + ++RDNI
Sbjct: 554 KTSLLNAICGLMPQY--GNEGELEVDGSLVS--------------CGYPWIQNTTVRDNI 597

Query: 528 TYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLK 587
            +G  Y+ +  + +RV + C     + K      T +G  G  LSGGQK RI +AR+L K
Sbjct: 598 LFGSKYDES--KFKRVIRMCSLEEDLEKLSAYDMTEIGERGVTLSGGQKSRINLARSLYK 655

Query: 588 KPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGND 646
           + ++ + D+  SA+D    +S +     + +K K  T +   H+LS I +++ +IVLGND
Sbjct: 656 EKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNK--TRVLATHQLSLIGKADQLIVLGND 713

Query: 647 GSVVEIGKFKTLF--GNPLSELSQLLNEKSTINE-----RNPNEKPAET 688
           G   ++G+++ L      L  L Q    +  I E     ++ NEK   T
Sbjct: 714 GK-FDMGRYEDLIKTNETLINLMQYAKLQEEIQEKEEVIKDKNEKTETT 761

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 130/501 (25%), Positives = 217/501 (43%), Gaps = 48/501 (9%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            Q + K +H    F D N +G +++R   D   +   +T+ +      +            
Sbjct: 979  QALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQIANIIGVGAMCII 1038

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVA 310
              P  +  + F     +L + ++    R+  R        +     E  +G+ T++A+ A
Sbjct: 1039 YLPWFAIAIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNA 1098

Query: 311  EQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVL------- 363
            + R   +   +I  +     E+A+I+     +    G    L+ +A+   + L       
Sbjct: 1099 QDRFATKSEFLIDKM----NEAAYIS---IAVQRWAGIFLDLVAVAFALIITLLCVTRQF 1151

Query: 364  H-GGLSIGDLTAYMMYTE-LTGSAVFGLSSFYSEIMQG---VGAASRL-FELTDRIPMIS 417
            H  G   G L  Y++    L  + +  L+   +++      V  A++L  E   R P  S
Sbjct: 1152 HISGADTGVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQYRKPECS 1211

Query: 418  PTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIA 476
            P       P  G I F+N++FAY  RPG   I K+ N  I+P   + I G +G GKSTI 
Sbjct: 1212 PPID---WPQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRTGAGKSTIM 1266

Query: 477  SLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI------TYG 530
            + L +  + T G I +D  DIS L    LR  + I+ Q+P+L  G+IR N+         
Sbjct: 1267 NALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDD 1326

Query: 531  LTYEATA----------EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIA 580
            L +E+            E ++   K     N + KF       +  +G   S G++Q +A
Sbjct: 1327 LLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGERQVLA 1383

Query: 581  IARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIV 640
            + RAL+++  +LILDEATS++D E+++ I             TI+ IAHRL TI   + +
Sbjct: 1384 LTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRI 1441

Query: 641  IVLGNDGSVVEIGKFKTLFGN 661
            +VL   G V E      LF N
Sbjct: 1442 LVL-EKGEVAEFDTPWNLFNN 1461

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 21/214 (9%)

Query: 448 IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRR 507
           +  ++NF I  G  V + GP G GK+++   L    +  +G +   G  +          
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGDLLL--------- 674

Query: 508 HIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
             GI    P + + +IRDNI +G  Y+ T    +RV   C   + +   P   +T +G  
Sbjct: 675 -CGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVE-SESAINYTFGKLMKKKEVTIIS 626
           G  LSGGQK RI++ARA+ K  ++ + D+  SA+D       ++Y     +  K  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 627 IAHRLSTIRRSEIVIVLGN--DGSVVEIGKFKTL 658
             H+LS + +++ +IVL    D    EIG FK L
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 115/492 (23%), Positives = 223/492 (45%), Gaps = 50/492 (10%)

Query: 194  KKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXSISP 253
            K+ ++    F D   +G +++R   D  V+   +T    D  +  +           +S 
Sbjct: 905  KRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELT----DSTRMFVFQMANVVGVFILSI 960

Query: 254  ELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG-QLTRVSE---EQFSGVKTVQAFV 309
                ++    P  +L  ++ G   +   R+++     Q + V     E   G+ T++A+ 
Sbjct: 961  AYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSFVYNNLGEVLDGLDTIRAYN 1020

Query: 310  AEQREIKRYNNVIKDVYNVGKESAFINAKLFT-ITSSLGDMSFLLVLAYGSYLVLHGGLS 368
            A+ R +++ +  +      G     I A+ +  +T+ L  ++  L++   + L +   + 
Sbjct: 1021 AQSRFLRKSDYFLNRTNEAGY--LVIGARCWVALTTDLVAIAIALIV---TLLCVTRVIH 1075

Query: 369  IGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMIS---PTTGKKYI 425
            I   +A ++ T      V  + ++++ +++G          T R+   +   P    +Y+
Sbjct: 1076 ITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATALPQEAPQYL 1130

Query: 426  PGKG---------EIEFKNVSFAYPTRPGSQI-FKSLNFKIEPGSNVCIVGPSGRGKSTI 475
            PG           EI F+ VSFAY  RPG  +    ++F +  G  + I G +G GK+++
Sbjct: 1131 PGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRTGAGKTSV 1188

Query: 476  ASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI------TY 529
             + L +  +  +G+I +DG DI+ L    LR  + I+ Q+P+L  G++R N+      T 
Sbjct: 1189 TTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLDPFAEHTD 1248

Query: 530  GLTYEATAEE-IRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKK 588
            G  + A     +         H F     DQ     G N +L   G++Q +A+ARAL++ 
Sbjct: 1249 GTLWSALVRSGVVPAGVVPTSHKF---HLDQEVDEGGANFSL---GERQLLALARALVRS 1302

Query: 589  PNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGS 648
              +LILDEATS++D  +++ +        + ++ T++ +AHRL TI   + ++VL + G 
Sbjct: 1303 TRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-DQGR 1359

Query: 649  VVEIGKFKTLFG 660
            V E      LF 
Sbjct: 1360 VAEFDTPYRLFA 1371

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 134/281 (47%), Gaps = 28/281 (9%)

Query: 449 FKSLN---FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSL 505
           F  LN   F I+ G  + ++G  G GK+++ + +  Y K T G++ V+G  +        
Sbjct: 548 FTGLNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLL-------- 599

Query: 506 RRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILG 565
               G+    P + + +IRDNI +G +++ T  +   V   C        FP   +T +G
Sbjct: 600 --FCGV----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVG 651

Query: 566 PNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTII 625
             G  LSGGQK RI++ARA+ K  ++ + D+  SA+D    + I      L + +  T I
Sbjct: 652 ERGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRI 710

Query: 626 SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLF-GNPLSELSQLLNEKSTINERNPNEK 684
              H+L+ ++ +  VI LG DGS  ++G    L   NP     Q  N  S  ++ N  E 
Sbjct: 711 LATHQLALVQEASRVIFLGQDGS-FDMGTPAELHEKNP-----QFRNLMSLSSQTNAEES 764

Query: 685 PAETPEQESQKNAANESIVDVV-LEEEILQNDIRSQDEKDI 724
             E+   +S+   A+ + V +    EEI    I S++E+ +
Sbjct: 765 EMESIRSQSKSKKASTAPVSMPDFNEEIDDGRITSKEERAV 805

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
            similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 126/247 (51%), Gaps = 30/247 (12%)

Query: 297  EQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLA 356
            E  SGV T++A+ AE R +K+ ++++ D  N      + + +  +I   +  + F L++ 
Sbjct: 1063 EVISGVDTIKAYHAEARFLKK-SDILIDRMNEMTFPLYASQRWVSILIGMIAVLFALII- 1120

Query: 357  YGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGV-------GAASRLFEL 409
              S L + G  +I   +  ++ T      V  L + ++ +++ +        +A R+   
Sbjct: 1121 --SILCVTGWFNISPASTGVLLT-----YVLQLPNLFNTLLRAMTQLENDMNSAERVLSY 1173

Query: 410  TD--------RIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGS 460
             +        RIP ++P    K  P +G I F NV+ AY  RPG   + + ++F I  G 
Sbjct: 1174 ANSLPKEAPYRIPEMAP---PKAWPERGAITFDNVALAY--RPGLPLVLQDVSFHISSGE 1228

Query: 461  NVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMS 520
             + I G +G GKSTI + L +  + + G++T+DG DI+ +   +LR  + I+ Q+P+L  
Sbjct: 1229 KIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFR 1288

Query: 521  GSIRDNI 527
            G+IR N+
Sbjct: 1289 GTIRKNL 1295

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 110/237 (46%), Gaps = 28/237 (11%)

Query: 449 FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH 508
           F  L+F+++ G  + I G  G GK+++ + L  +   T G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 509 IGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG 568
             +    P + + +IRDNIT+G  Y+      R V + C     ++  P   +T +G  G
Sbjct: 637 -MLFCGAPWIQNATIRDNITFGSPYDENL--YREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI--NYTFGKLMKKKEVTIIS 626
             LSGGQK RI +AR + K  ++ + D+  SA+D    ++I  +   GKL  K   T I 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKLGDK---TRIL 750

Query: 627 IAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTL------FGNPLSELSQLLNEKSTIN 677
             H++S   ++  VI LG DGS  +IG    L      F N +   SQ  +E    N
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESESKDDN 806

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 16/111 (14%)

Query: 567  NGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKK-KEVTII 625
            +G+  S G++Q +A+ARAL+++  +LILDEATS++D E+++ I     +++++ +  TI+
Sbjct: 1424 DGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQ---ARIVQEFQHATIM 1480

Query: 626  SIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTI 676
             +AHRL TI   + ++V+   G V E       F  PL    +L NE+ +I
Sbjct: 1481 CVAHRLKTILHYDRILVM-EKGRVAE-------FDTPL----RLYNEQGSI 1519

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 122/278 (43%), Gaps = 58/278 (20%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++VSF Y     S + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEEEKSINFKFPDCEKLSPPIIQLQDVSFGY--EENSPLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +PT G +           S++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q                  +   + ++           F  K  ++Y+  LG  G    
Sbjct: 601 TQ------------------HHVDSMDLNTSAVDWMSKTFPGKTDEEYRRHLGAFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+     N+T G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALIDALKNFTGGVLM 702

Query: 618 KKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKF 655
              ++++I   H  S I  SE   V   DG++ +   +
Sbjct: 703 VSHDISVID--HVCSEIWVSEDGTVKRFDGTIYDYRSY 738

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 114/248 (45%), Gaps = 56/248 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++VSF Y   P S + K +
Sbjct: 498 AQSRIKKL-EKLPVLEPPEEEKTISFKFPDCEKLSPPIIQLQDVSFGYD--PESLLLKDV 554

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +PT G ++ +G           R  IG  
Sbjct: 555 NLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFVSRNG-----------RLRIGYF 603

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +       D     + + +TA              +  K  ++Y+  LG  G    
Sbjct: 604 TQHHV----DSLDLTKSAVDWMSTA--------------YPGKNDEEYRRHLGSFGITGS 645

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEA-----TSALDVESESAINYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE      TS LD   +S  N++ G LM
Sbjct: 646 LGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGLDALEDSLKNFSGGVLM 705

Query: 618 KKKEVTII 625
              +++II
Sbjct: 706 VSHDISII 713

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/370 (22%), Positives = 156/370 (42%), Gaps = 68/370 (18%)

Query: 321 VIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTE 380
           +I   +  G  +  +N + F +   L     +L LA     ++H    I  LT Y     
Sbjct: 442 IIVTTFTSGINNEEVNMREFIVNKRL-----MLSLADAGSRLMHSFKDIAQLTGYT---- 492

Query: 381 LTGSAVFGLSSFYSEIMQGVGAASRLFELT-DRIPMISPTTGKKYIPGKGE-----IEFK 434
              + +F L +    +   V +   L E   D +  I P+   + + G  +     I F+
Sbjct: 493 ---NRIFTLLTVLHRVHSSVYSYGALAEDDGDSVDSIDPSANSELVCGTVQRNFNGIRFE 549

Query: 435 NVSFAYPT---RPGSQIFKSLNFKIEP------------------------GSNVCIVGP 467
           N+    P+   R G ++   L F++ P                        GS++ I+GP
Sbjct: 550 NIDVVIPSKFGRDGIKLINRLRFQVPPVIGLDNNNSDSQINLSQKLMFKGPGSSMLILGP 609

Query: 468 SGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRD 525
           +G GK++I  ++ + +      G ++V  +          R  I I Q+   +  G+ R+
Sbjct: 610 NGSGKTSIQRIIAEIWPIYNKNGLLSVPAE----------RELICIPQKPYFIQGGTFRE 659

Query: 526 NITYGLTYEATAE------EIRRVTKQCFCHNFITKFPD-QYQTILGPNGTLLSGGQKQR 578
            I Y ++ +   +      E+  V K+      + +    +Y   +     +LSGG++QR
Sbjct: 660 QIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDVLSGGERQR 719

Query: 579 IAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSE 638
           +  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K+     I+I+ R S I+  +
Sbjct: 720 MNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQRPSLIKYHD 775

Query: 639 IVIVLGNDGS 648
           + + +G D S
Sbjct: 776 LALEIGADES 785

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 175/417 (41%), Gaps = 57/417 (13%)

Query: 255 LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQE---ATGQLTRVSEEQFSGVKTVQAFVAE 311
           L   LL F   V L+        R  SR   E    T +  +   E FS +K ++ F  E
Sbjct: 522 LCVLLLIFPLNVFLA--------RSTSRFQHEGLLVTDKRIQNLNELFSSIKIIKCFTWE 573

Query: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV------LAYGSYLVLHG 365
              I   N++++      ++S     KL ++  S   + + L       +++  ++    
Sbjct: 574 DNFI---NHILR-----TRDSEVRKMKLISVIWSCNAIIWYLTPTLITSISFAYFIFCER 625

Query: 366 GLSIGDLTAYMMYTELTGSAVFGL--------SSFYSEIMQGVGAASRLFELTDRIPMIS 417
                 LTA + +T L   ++FGL        SS  + I+Q V +  R+    D   M  
Sbjct: 626 A----TLTAPIAFTAL---SLFGLLKMPLDQLSSTINYIVQSVISLRRIQSFLDEPDM-- 676

Query: 418 PTTGKKYIPGKG--EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTI 475
               K  +  K      F   +  +       I ++LN K +      + GP+G GKS +
Sbjct: 677 -DKQKNLLLSKDGTYFMFSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLL 735

Query: 476 ASLLLKYYKPTAGTITV---DGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532
              LL       G I V     +    ++   L   I    Q P +++ SI++NI +G  
Sbjct: 736 LMSLLGETHLFKGEIHVPSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFG-- 793

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
            E   +    V + C   N +    D   +I+G  G  LSGGQ+QR+++ARA+  K   +
Sbjct: 794 SEFNLKRYNDVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHI 853

Query: 593 ILDEATSALDVESESAINYTF---GKLMKKKEVTIISIAHRLS-TIRRSEIVIVLGN 645
           ILD+  SA+D +    I Y     G LMK +  T I ++H +   I+++  +++L N
Sbjct: 854 ILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR--TCILVSHNVELVIKKAAYLLILDN 907

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 124/299 (41%), Gaps = 34/299 (11%)

Query: 191  QVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCXXXXXXXXXS 250
            ++++  +     FF+   +G +++    D   +   ++  +   F   L           
Sbjct: 1096 KILRNVVSSKLIFFEKTPIGSIMNNFSKDIRSLDFELSPFIEGTFSCTLQTLMSLILITY 1155

Query: 251  ISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATG----QLTRVSEEQFSGVKTVQ 306
            ++P      +F    + L   + G      SR+L+         + +   E  +G+ +++
Sbjct: 1156 VNPNF----IFPAIFIFLFCCFIGHSYLCCSRELKRYESITKTPIYQHFSESLAGLVSIR 1211

Query: 307  AFVAEQREIK----RYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLV 362
            AF  E R IK    R +   K  + + + + +++ ++  I S       + +LA G +L+
Sbjct: 1212 AFGDELRFIKVIFTRVDEYNKSFFYLWEANNWLSFRIELIGS-------ITILATGLFLL 1264

Query: 363  -----LHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTD--RIPM 415
                 +  GL+    T  + +TE    +   +  FY+ +   + +  RL+E T+  + P 
Sbjct: 1265 SNANMVDSGLAGITFTYAIAFTE----SALWMIKFYATMEMNMNSVERLYEYTNLEQEPY 1320

Query: 416  ISPTTG-KKYIPGKGEIEFKNVSFAY-PTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGK 472
                T      P  G+I+FKNV+  Y P  P  ++ + + F I     + +VG +G GK
Sbjct: 1321 SRCITNVDNQWPNSGDIKFKNVTLRYSPELP--KVLQDVTFVIGDKEKIGVVGRTGAGK 1377

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 111/249 (44%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++VSF Y   P   + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEQEKSIDFKFPDCEKLSPPIIQLQDVSFGYS--PDKLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  I+  S + +VG +G GK+T+  ++L+  +P +G +           S++ R  IG  
Sbjct: 552 NLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q                  +   + ++           F  K  ++Y+  LG  G    
Sbjct: 601 TQ------------------HHVDSMDLSTSAVDWMSKTFPGKTDEEYRRHLGSFGITGT 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++LILDE ++ LD     A+     N+T G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGIDALVDAMKNFTGGILM 702

Query: 618 KKKEVTIIS 626
              ++++I+
Sbjct: 703 VSHDISVIN 711

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 86/176 (48%), Gaps = 11/176 (6%)

Query: 481 KYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEI 540
           K Y PT     V+ +D  ++    +   +    Q P L+SG+I+DN+ +G  +    ++ 
Sbjct: 709 KIYVPT-----VESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFNK--QKF 761

Query: 541 RRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
             V K C     I       +T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA
Sbjct: 762 DDVMKSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSA 821

Query: 601 LDVESESAI--NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGK 654
           +D E+   I      G +MK +  T I  +H +S + +    +V+ + G V   GK
Sbjct: 822 VDPETALYIYEECLCGPMMKGR--TCIITSHNISLVTKRADWLVILDRGEVKSQGK 875

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 104/214 (48%), Gaps = 32/214 (14%)

Query: 458 PGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPI 517
           PGS++ I+GP+  GKS+I  +L + +     T  V     S L        + I Q+   
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDL--------MCIAQRPYF 648

Query: 518 LMSGSIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITKFPD--QYQTILGPNGT 569
           +  G+ RD I Y ++ +   E      E+ R+ K+    +++ K  +   Y   +     
Sbjct: 649 IQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL-DYLLKRSEGLSYLDFVADWKD 707

Query: 570 LLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  +++K     ISI+ 
Sbjct: 708 ILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFN-MLRKCRFNFISISQ 763

Query: 630 RLSTIRRSEIVI-----------VLGNDGSVVEI 652
           R S I+  + ++            LG+D ++  I
Sbjct: 764 RPSLIKYHDYLLEITSGTQWQYQTLGSDEAITSI 797

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 115/247 (46%), Gaps = 35/247 (14%)

Query: 444 PGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSK 503
           P S      N  + PGS++ I+GP+  GKS+I  ++ + +     T          L+  
Sbjct: 583 PASSNLTQANVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKT--------GLLSIP 634

Query: 504 SLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITKFP 557
           S    + I Q+   +  G+ RD I Y +  +   E      E+ RV K+    +++ K  
Sbjct: 635 SESDMMCIAQRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRA 693

Query: 558 D--QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGK 615
           D   Y   +     +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  
Sbjct: 694 DALNYLDHVADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFN- 749

Query: 616 LMKKKEVTIISIAHRLSTIRRSEIVI-----------VLGNDGSVVEIGKFKTLFGNPLS 664
           ++KK     ISI+ R S I+  + ++            LG+D ++  I    T   +  S
Sbjct: 750 MLKKFRFNFISISQRPSLIKYHDYLLEITTNSNWQYQTLGSDEAITSID---TEIESLES 806

Query: 665 ELSQLLN 671
           +LSQ+ N
Sbjct: 807 KLSQIHN 813

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 111/249 (44%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P  G+K +  K           I+ ++V+F Y     + + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGY--NENNLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++   P  G +           S++ R  +G  
Sbjct: 552 NLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYV-----------SRNPRLRLGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q                  +   A ++     +     F  +  ++Y+  LG  G    
Sbjct: 601 AQ------------------HHVDAMDLNASAVEWMSKTFPGRSDEEYRRHLGSFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P+VLILDE ++ LD     A+     N+T G LM
Sbjct: 643 LGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALKNFTGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I+
Sbjct: 703 VSHDISVIN 711

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 123/278 (44%), Gaps = 58/278 (20%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++VSF Y       + K +
Sbjct: 496 AQSRIKKL-EKLPVLEPPEEEKSITFKFADCEKLSPPIIQLQDVSFGYD--ESQLLLKDV 552

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +P  G +           S++ R  IG  
Sbjct: 553 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV-----------SRNPRLRIGYF 601

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  I              + +  A  +  ++K      F  K  ++Y+  LG  G    
Sbjct: 602 TQHHID-------------SMDLNASAVDWMSK-----TFPGKTDEEYRRHLGAFGITGS 643

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++LILDE ++ LD     A+     N++ G LM
Sbjct: 644 LGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHLDTAGLDALVQALKNFSGGVLM 703

Query: 618 KKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKF 655
              ++++I        I  SE   V   DG++ +  K+
Sbjct: 704 VSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 423

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 120/271 (44%), Gaps = 55/271 (20%)

Query: 402 AASRLFELTDRIPMISP----TTGKKYIPGKGE-----IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    T+   + P   +     I+ ++VSF Y  +  S + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEVETSINFHFPDCEKLSPPIIQLQDVSFGYEEQ--SLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +PT+G ++ +G                  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYVSRNG------------------ 593

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
                      R  I Y   +   + ++           +  K  ++Y+  LG  G    
Sbjct: 594 -----------RLRIGYFTQHHVDSMDLNTSAVDWMSKTYPGKTDEEYRRHLGAFGITGT 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEV 622
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+       +KK   
Sbjct: 643 LGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLEAL----VDALKKFTG 698

Query: 623 TIISIAHRLSTIRRSEIVIVLGNDGSVVEIG 653
            ++ ++H +S I      I +  DG+V + G
Sbjct: 699 GVLMVSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.366
           YFR009W
          Length = 752

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 111/249 (44%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++V F Y  +    +   +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEEEKSISFKFPDCEKLSPPIIQLQDVDFGYDNK--ELLLNDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  I+  S + +VG +G GK+T+  ++++  +P  G ++ +G           R  IG  
Sbjct: 552 NLDIQMDSRIALVGANGCGKTTLLKVMMEQLRPVKGYVSRNG-----------RLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +       D     + + +TA              F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV----DSMDLDKSAVDWMSTA--------------FPGKTDEEYRRHLGAFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L+ P++L+LDE ++ LD     A+     N+T G LM
Sbjct: 643 LSLQKIQLLSGGQKSRVAFAALCLENPHILVLDEPSNHLDTAGIDALVDALKNFTGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 703 VSHDISVID 711

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 128/288 (44%), Gaps = 70/288 (24%)

Query: 402 AASRLFELTDRIPMISPTTGKK----YIPGKGE-----IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    K    + P   +     I+ ++VSF Y  +  + + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEEDKSVTFHFPECEKLSPPIIQLQDVSFGYDEK--NLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +P  G ++ +G           R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYVSRNG-----------RLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +          +  LT  A                F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV---------DSMDLTTSAV---------DWMSKTFPGKNDEEYRRHLGAFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++LILDE ++ LD     A+     N++ G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGLDALIDALKNFSGGVLM 702

Query: 618 KKKEVTII-SIAHRL-----STIRR--------SEIVIVLGNDGSVVE 651
              ++++I S+ + +      T+++         + +I L ND  VV+
Sbjct: 703 VSHDISVINSVCNEIWVSEEGTVKKFGGSIYDYRDHIISLANDAGVVK 750

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 110/249 (44%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    K I  K           I+ ++VSF Y  +  + + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEQDKIIDFKFPECDKLSPPIIQLQDVSFGYDEK--NLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +P  G +           S++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +          +  LT  A               +F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV---------DSMDLTTSAV---------DWMSKSFPGKTDEEYRRHLGSFGITGT 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+     N+  G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVDALKNFNGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 703 VSHDISVID 711

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 110/248 (44%), Gaps = 54/248 (21%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    K I  K           I+ ++VSF Y  +  + + K +
Sbjct: 494 AQSRIKKL-EKLPVLEPPEEDKSIHFKFPDCENLSPPIIQLQDVSFGYDEK--NLLLKDV 550

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  +++   KP  G ++ +G           R  IG  
Sbjct: 551 NLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYVSSNG-----------RLRIGYF 599

Query: 513 QQEPILMSGSIRDNITY-GLTYEA-TAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL 570
            Q  +      +  + +  + Y   T EE RR                 +    G  GTL
Sbjct: 600 TQHHVDSMDLTKSAVDWMSVKYPGKTDEEYRR-----------------HLGSFGITGTL 642

Query: 571 -------LSGGQKQRIAIARALLKKPNVLILDEAT-----SALDVESESAINYTFGKLMK 618
                  LSGGQK R+A A   L  P++L+LDE +     + LD   ES  N++ G LM 
Sbjct: 643 GLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLDALVESLKNFSGGVLMV 702

Query: 619 KKEVTIIS 626
             ++++I 
Sbjct: 703 SHDISVID 710

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 115/243 (47%), Gaps = 33/243 (13%)

Query: 431 IEFKNVSFAYPTRPGSQI----FKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP- 485
           + F+N+S+  P    S+I      S+   ++PG  + I+G SG GK+T+  +L    K  
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 486 -TAGTITVDGQDI-SKLNSKSLRRHIGIVQQ-----------EPILMSGSIRDNITYGLT 532
              GTI V+G  I +KL SK     IG V Q           E +L S  +R  +   + 
Sbjct: 456 RVQGTIAVNGHSILNKLYSK----MIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMP 509

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNV 591
           + A  + + RV ++        +  D    I+G +    +SGG+K+R++IA  L+  P +
Sbjct: 510 FTAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAI 562

Query: 592 LILDEATSALDVESESAINYTFGKLMKKKEVT-IISIAHRLSTIRRSEIVIVLGNDGSVV 650
           L LDE TS LD  + + +     +L K    T ++SI    S I      +VL +DG ++
Sbjct: 563 LFLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMI 622

Query: 651 EIG 653
             G
Sbjct: 623 YSG 625

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 109/249 (43%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    K I  K           I+ ++VSF Y     + + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEQDKTIDFKFPECDKLSPPIIQLQDVSFGYD--ENNLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +P  G +           S++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +          +  LT  A               +F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV---------DSMDLTTSAV---------DWMSKSFPGKTDEEYRRHLGSFGITGT 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEA-----TSALDVESESAINYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE      T+ LD   E+  N+  G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVEALKNFNGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 703 VSHDISVID 711

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 134/328 (40%), Gaps = 67/328 (20%)

Query: 305 VQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG----SY 360
           ++A V  +  +KR++  +     V     F+N     + +++ DM    + AYG    SY
Sbjct: 258 LEACVWLEEYLKRFDRTL---VLVSHSQDFLNG----VCTNMLDMRLQKLTAYGGNYDSY 310

Query: 361 LVLHGGLSIGDLTAYMMYTELTGS--AVFGLSSFYSEIMQGVGAASRLFELTDRIPMISP 418
           +     L    +  Y    E           +  Y+ +++   +  ++ +  +   ++ P
Sbjct: 311 VKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLVQP 370

Query: 419 TTGKKYIPGK-GEIE--------FKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSG 469
               +    +  E+E        F  +SF+Y  +P + ++++LNF ++  S V +VGP+G
Sbjct: 371 VVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNG 430

Query: 470 RGKSTIASLLLKYYKPTAGTI--------------TVDGQDISKLNSKSLRRHIGIVQQE 515
            GKST+  ++     P  G +              + D  D++K   + +R   G + ++
Sbjct: 431 VGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYGHISED 490

Query: 516 PILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQ 575
                G +     YGLT E    ++                           GT LS GQ
Sbjct: 491 FQYWRGQLG---RYGLTGEGQTVQM---------------------------GT-LSEGQ 519

Query: 576 KQRIAIARALLKKPNVLILDEATSALDV 603
           + R+  A   L +PNVL+LDE T+ LD+
Sbjct: 520 RSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 280

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 118/248 (47%), Gaps = 17/248 (6%)

Query: 417  SPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTI 475
            S T G + +  +    ++N+ +  P + G++ +  +++  ++PG+   ++G SG GK+T+
Sbjct: 837  SSTNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

Query: 476  ASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPI-LMSGSIRDNITYGLTYE 534
               L +  + T G IT D     +   +S  R IG  QQ+ + L + ++R+++ +   Y 
Sbjct: 897  LDCLAE--RVTMGVITGDVLVDGRPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYL 953

Query: 535  ATAEEIRRVTKQCFCHNFIT-----KFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKP 589
                E+    K  +    I      K+ D    ++G  G  L+  Q++R+ I   L  KP
Sbjct: 954  RQPAEVSVEEKDAYVEEVIKILEMEKYAD---AVVGVAGEGLNVEQRKRLTIGVELAAKP 1010

Query: 590  NVLI-LDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEI--VIVLGND 646
             +L+ LDE TS LD ++  +I     KL    +  + +I H+ S I   E   ++ L + 
Sbjct: 1011 KLLVFLDEPTSGLDSQTAWSICQLMRKLASHGQAILCTI-HQPSAILMQEFDRLLFLQDG 1069

Query: 647  GSVVEIGK 654
            G     G+
Sbjct: 1070 GQTTYFGE 1077

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 100/230 (43%), Gaps = 58/230 (25%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF+Y   P + +++ LNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT EA 
Sbjct: 451 SRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYPNISQDFQYWRGQLG---RYGLTGEAQ 507

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 508 TSQM---------------------------GT-LSEGQRSRVVFALLALEQPNVLLLDE 539

Query: 597 ATSALDVES----ESAINYTFG---------KLMKKKEVTIISIAHRLST 633
            T+ LD+ +      AIN   G         +L+ K    I  + H+ +T
Sbjct: 540 PTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVVEHKTAT 589

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 279

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 124/273 (45%), Gaps = 37/273 (13%)

Query: 434 KNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVD 493
           K VS A    P  Q    +N  +  GS++ I+GP+  GKS+I  +L + + P        
Sbjct: 592 KQVSLANVRDPLDQSRFMINHGM--GSSLLILGPNSCGKSSIERILTEIW-PIYNK---- 644

Query: 494 GQDISKLNSKSLRRHIGIVQQEPILMSG-SIRDNITYGLTYEATAEE------IRRVTKQ 546
               + L S      +  V Q P  + G + RD I Y +TYE   E       + ++ ++
Sbjct: 645 ----NGLLSTPPSHDLFCVPQRPYFIQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILRE 700

Query: 547 CFCHNFITKFPDQ---YQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDV 603
                 + +  D+   Y   +     +LSGG+KQR+   R +  +P  ++LDEAT+A+ V
Sbjct: 701 VRLDYLLKR--DRGLNYFDAIADWKDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISV 758

Query: 604 ESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVL--GNDGSVVEIGKFKTLFGN 661
           + E  + +T   ++K+     ISI+ R S I+  + ++ L  G D S+  +G  + +   
Sbjct: 759 DMEDHL-FT---MLKRYRFNFISISQRPSLIKYHDYLLELTNGTDWSLQALGSDEAILS- 813

Query: 662 PLSELSQLLNEKSTINERNPNEKPAETPEQESQ 694
                  + NE  T+N++    K  E    E Q
Sbjct: 814 -------IENEIETLNQKLTKVKEWERQRDELQ 839

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 129/268 (48%), Gaps = 39/268 (14%)

Query: 446 SQIFKSLN------FKIEPGSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDI 497
           +Q FK +N      F    GS++ I+GP+  GK++I  ++ + +      G ++V  Q+ 
Sbjct: 646 TQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIWPIYNKNGLLSVPSQE- 704

Query: 498 SKLNSKSLRRHIGIVQQEPILMS-GSIRDNITYGLTYEATAEE------IRRVTKQCFCH 550
                     +I  + Q P   S G++RD I Y ++ +   +       + ++ K+    
Sbjct: 705 ----------NIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLK 754

Query: 551 NFITKFPD-QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI 609
             + +     Y   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E   
Sbjct: 755 YLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME--- 811

Query: 610 NYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG--NDGSVVEIGKFKTLFGNPLSELS 667
           +Y F  ++KK     I+I+ R S I+  ++++ +   NDG+     + +TL  +    ++
Sbjct: 812 DYLFN-ILKKYRFNFITISQRPSLIKYHDLLLEISDHNDGT----WQIQTLGTD--EAIT 864

Query: 668 QLLNEKSTINERNPNEKPAETPEQESQK 695
            + +E  ++ ++  N    ET  +E QK
Sbjct: 865 SIDHEIESLEKKLKNVNHWETERRELQK 892

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 108/248 (43%), Gaps = 56/248 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKK----YIPGKGE-----IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K    + P   +     I+ ++VSF +   P   + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEEEKNIDFHFPDCEKLSPPIIQLQDVSFGFD--PSQLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + IVG +G GK+T+  +L++  +P  G +                      
Sbjct: 552 NLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQGYV---------------------- 589

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
                  S + R  + Y   +   + ++         + F  +  ++Y+  LG  G    
Sbjct: 590 -------SRNPRLRVAYFTQHHVDSMDLNASAVDWMSNTFPGRTDEEYRRHLGAFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+      +T G LM
Sbjct: 643 LGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALMDALKKFTGGVLM 702

Query: 618 KKKEVTII 625
              ++++I
Sbjct: 703 VSHDISVI 710

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 97/209 (46%), Gaps = 31/209 (14%)

Query: 451 SLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRH 508
           +L F   PGS++ I+GP+  GKS+I  ++ + +      G +++  +D            
Sbjct: 675 TLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKNGLMSIPAED-----------E 723

Query: 509 IGIVQQEPIL-MSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPN 567
           +  + Q P     G+ RD I Y +    + E   R  K       +     +Y       
Sbjct: 724 LMCIPQRPYFSKGGTFRDQIIYPM---GSDEFFDRGLKDKLLVQILADVKLEYLLKRDKG 780

Query: 568 GT----------LLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLM 617
            +          +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F K++
Sbjct: 781 WSYFDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KML 836

Query: 618 KKKEVTIISIAHRLSTIRRSEIVIVLGND 646
           KK     ISI+ R S ++  ++++ +  D
Sbjct: 837 KKYRFNFISISQRPSLVKYHDLLLEISED 865

>Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    K +  K           I+ ++V F Y     + + + +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEQDKTVDFKFPECDKLSPPIIQLQDVFFGY--NENNLLLRDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +PT G +           S++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPTKGFV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +          +  LT  A              ++F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV---------DSMDLTTSAV---------DWMSNSFPGKTDEEYRRHLGSFGITGT 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+     N+  G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVDALKNFNGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 703 VSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    TI++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPNTILTVSH 422

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 123/257 (47%), Gaps = 27/257 (10%)

Query: 443  RPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT----VDGQDIS 498
            R   +I  +++  ++PG+   ++G SG GK+T+   L +  + T G IT    VDG    
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTTGVITGGIFVDG---- 919

Query: 499  KLNSKSLRRHIGIVQQEPI-LMSGSIRDNITYGLTYE----ATAEEIRRVTKQCFCHNFI 553
            KL  +S  R IG  QQ+ + L + ++R+++ +           A E R+  ++      +
Sbjct: 920  KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVINVLEM 979

Query: 554  TKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYT 612
              + D    I+G  G  L+  Q++R+ I   L+ KP +LI LDE TS LD ++  +I   
Sbjct: 980  EPYAD---AIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQL 1036

Query: 613  FGKLMKKKEVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIGKFKTLFGNPLSELSQLL 670
              KL  + +  + +I H+ S +   E   ++ L   G  V  G+     G+  + +    
Sbjct: 1037 IRKLANRGQAILCTI-HQPSAVLIQEFDRLLFLQKGGETVYFGE----LGDECNIMVDYF 1091

Query: 671  NEKSTINERNPNEKPAE 687
             E++  ++  PN  PAE
Sbjct: 1092 -ERNGAHKCPPNANPAE 1107

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 108/244 (44%), Gaps = 60/244 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF+Y  +P + +++ LNF ++  S + +VGP+G GKST+  ++       +G +
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT EA 
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG---RYGLTGEA- 508

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
                                   QT+L   GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 509 ------------------------QTVL--MGT-LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDVES----ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN-----DG 647
            T+ LD+ +      AIN   G       V ++S   RL      +I +V        DG
Sbjct: 542 PTNGLDIPTIDSLADAINEFNGG------VVVVSHDFRLLDKIAKDIFVVEHKTATRWDG 595

Query: 648 SVVE 651
           S++E
Sbjct: 596 SILE 599

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 103/244 (42%), Gaps = 60/244 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F  +SFAY   P   ++++LNF ++  S + +VGP+G GKST+  ++     P AG +
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT +  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDGQ 509

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L+ PN+L+LDE
Sbjct: 510 KAQM---------------------------GT-LSEGQRSRVVFALLALQAPNILLLDE 541

Query: 597 ATSALDVES----ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN-----DG 647
            T+ LD+ +      AIN   G       V ++S   RL      +I +V        DG
Sbjct: 542 PTNGLDIPTIDSLAEAINTFNGG------VVVVSHDFRLLDKIAQDIFVVENKTAYRWDG 595

Query: 648 SVVE 651
           S++E
Sbjct: 596 SILE 599

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 101/198 (51%), Gaps = 25/198 (12%)

Query: 459 GSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEP 516
           GS++ I+GP+G GKS+I  ++ + +      G +++  ++           +I  + Q+P
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYNKNGLLSIPSEN-----------NIFFIPQKP 686

Query: 517 IL-MSGSIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITK-FPDQYQTILGPNG 568
                G++RD I Y ++ +   +      E+ ++  +      + +     Y   +    
Sbjct: 687 YFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWK 746

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
            LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     ISI+
Sbjct: 747 DLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISIS 802

Query: 629 HRLSTIRRSEIVIVLGND 646
            R + I+  E+++ +G +
Sbjct: 803 QRPTLIKYHEMLLEIGEN 820

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 112/249 (44%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   ++ I  K           I+ ++VSF Y  +  + +   +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEEERSISFKFPECEKLSPPIIQLQDVSFGYNEK--NLLLADV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +P  G ++ +G           R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYVSQNG-----------RLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +       D     + + +TA              +  K  ++Y+  LG  G    
Sbjct: 601 TQHHV----DSLDLTKSAVDWMSTA--------------YPGKTDEEYRRHLGAFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++LILDE ++ LD     A+      +T G LM
Sbjct: 643 LSLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGIDALVDAMKKFTGGILM 702

Query: 618 KKKEVTIIS 626
              ++++IS
Sbjct: 703 VSHDISVIS 711

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE T+ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF Y + P   +++ LNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG- 508

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
                                   QT+       LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 509 ------------------------QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF Y + P   +++ LNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG- 508

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
                                   QT+       LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 509 ------------------------QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF Y + P   +++ LNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG- 508

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
                                   QT+       LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 509 ------------------------QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF Y + P   ++++LNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     V Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLTGEG- 508

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
                                   QT+       LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 509 ------------------------QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 104/210 (49%), Gaps = 22/210 (10%)

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            I K L F+  PGS++ I+GP+G GK++I  ++ + + P            + L S    
Sbjct: 589 NINKKLAFQ-GPGSSMLILGPNGSGKTSIQRIIAEIW-PIYNK--------NGLLSIPPA 638

Query: 507 RHIGIVQQEPILMSG-SIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITKFPD- 558
             +  V Q+P  + G + R+ I Y ++ +   +      E+  +  +      + +    
Sbjct: 639 SDLFCVPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGW 698

Query: 559 QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMK 618
           +Y   +     +LSGG++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L+K
Sbjct: 699 RYLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLK 754

Query: 619 KKEVTIISIAHRLSTIRRSEIVIVLGNDGS 648
           +     I+I+ R S I+  ++ + +  DG+
Sbjct: 755 RYRFNFITISQRPSLIKYHDLALDISTDGT 784

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 139/308 (45%), Gaps = 42/308 (13%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            +I  +++  ++PG+   ++G SG GK+T+   L +  + T G IT D     KL  +S  
Sbjct: 865  RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAE--RVTMGVITGDIFVNGKLRDESFP 922

Query: 507  RHIGIVQQEPI-LMSGSIRDNITYGLTYE----ATAEEIRRVTKQCFCHNFITKFPDQYQ 561
            R IG  QQ+ + L + ++R+++ +           A E R+  ++      +  + D   
Sbjct: 923  RSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVIKILEMEPYAD--- 979

Query: 562  TILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLMKKK 620
             I+G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     KL    
Sbjct: 980  AIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLSNHG 1039

Query: 621  EVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIGKFKTLFGNPLSELSQLL---NEKST 675
            +  + +I H+ S +   E   ++ L   G  V  G+        L E  +++    E++ 
Sbjct: 1040 QAILCTI-HQPSAMLMQEFDRLLFLQKGGKTVYFGE--------LGEGCKVMIDYFERNG 1090

Query: 676  INERNPNEKPAET---------------PEQESQKNAANESIVDVVLEEEILQNDIRSQD 720
             N   P+  PAE                   E+ KN+    +V   L+   L+N+++  D
Sbjct: 1091 ANPCPPDANPAEWMLEVVGAAPGSHANRDYHEAWKNSEEYKVVHQELDR--LENELQGID 1148

Query: 721  EKDILDKQ 728
            + D  +K 
Sbjct: 1149 DGDDAEKH 1156

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 127/272 (46%), Gaps = 27/272 (9%)

Query: 428  KGEIEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            KG   ++NV +  P   G  Q+  +++   +PG+   ++G SG GK+T+ + L    +  
Sbjct: 854  KGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLA---QRN 910

Query: 487  AGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSG-SIRDNITY--------GLTYEATA 537
             G IT D     K    S  R  G VQQ+ I +S  ++R+++ +         +  E   
Sbjct: 911  VGIITGDMLVNGKPIDISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEEKM 970

Query: 538  EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDE 596
            E + R+ K       +    +    ++G  G  L+  Q+++++I   L+ KP++L+ LDE
Sbjct: 971  EHVERIIK-------VLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDE 1023

Query: 597  ATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTI-RRSEIVIVLGNDGSVVEIGKF 655
             TS LD +S  AI     KL K  +  + +I    +T+    + +++L   G  V  G  
Sbjct: 1024 PTSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGDI 1083

Query: 656  KTLFGNPLSELSQLLNEKSTINERNPNEKPAE 687
                 N  + LS    E++   + +P+E PAE
Sbjct: 1084 GD---NSKTLLSYF--ERNGARKCSPSENPAE 1110

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 100/198 (50%), Gaps = 25/198 (12%)

Query: 459 GSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEP 516
           GS++ I+GP+G GKS+I  ++   +      G +++  ++           +I  + Q+P
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIADVWPVYNKNGLLSIPSEN-----------NIFCIPQKP 686

Query: 517 IL-MSGSIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITK-FPDQYQTILGPNG 568
                G++RD I Y ++ +   +      E+ ++  +      + +     Y   +    
Sbjct: 687 YFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVADWK 746

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
            LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     ISI+
Sbjct: 747 DLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISIS 802

Query: 629 HRLSTIRRSEIVIVLGND 646
            R + I+  E+++ +G +
Sbjct: 803 QRPTLIKYHEMLLEIGEN 820

>Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009W
           (GCN20) - 1:1 [contig 265] FULL
          Length = 752

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 107/249 (42%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKK----YIPGKGE-----IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K    + P   +     I+ ++VSF +   P   + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEEEKNIDFHFPECEKLSPPIIQLQDVSFGFD--PKQLLLKDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  +L++  +P  G +                      
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKILMEQLRPIQGYV---------------------- 589

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
                  S + R  + Y   +   + ++           F  K  ++Y+  LG  G    
Sbjct: 590 -------SRNPRLRVAYFTQHHVDSMDLNTSAVDWMSTTFPGKTDEEYRRHLGAFGITGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+      +T G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALMDALKKFTGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 703 VSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 101/198 (51%), Gaps = 25/198 (12%)

Query: 459 GSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEP 516
           GS++ I+GP+G GKS+I  ++ + +      G +++  ++           +I  + Q+P
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYNKNGLLSIPPEN-----------NIFFIPQKP 686

Query: 517 IL-MSGSIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITKFPD-QYQTILGPNG 568
                G++RD I Y ++ +   +      E+ ++  +      + +     Y   +    
Sbjct: 687 YFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWK 746

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
            LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     ISI+
Sbjct: 747 DLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISIS 802

Query: 629 HRLSTIRRSEIVIVLGND 646
            R + I+  E+++ +G +
Sbjct: 803 QRPTLIKYHEMLLEIGEN 820

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 85/187 (45%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F N+SFAY   P   ++++L+F ++  S + +VGP+G GKST+  ++       AG +
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMAQAGRV 450

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E+ 
Sbjct: 451 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSSISQDFQYWRGQLG---RYGLTGES- 506

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
                                   QT+    GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 507 ------------------------QTV--QMGT-LSEGQRSRVVFALLALEQPNVLLLDE 539

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 540 PTNGLDI 546

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 561 QTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKK 620
           QTIL     + SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ 
Sbjct: 216 QTILKKTKDM-SGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRF 270

Query: 621 EVTIISIAH 629
           + T++ ++H
Sbjct: 271 DRTLVLVSH 279

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 103/211 (48%), Gaps = 31/211 (14%)

Query: 451 SLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIG 510
           S+ F    GS++ I+GP+G GKS+I  ++ + + P            + L SK    ++ 
Sbjct: 636 SIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSKPTEANLL 686

Query: 511 IVQQEPILM-SGSIRDNITY----------GLTYEATAEEIRRVTKQCFCHNFITKFPD- 558
            V Q+P     G++RD I Y          GL  +   + +R V       +++ K    
Sbjct: 687 CVPQKPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKL-----DYLLKRDKG 741

Query: 559 -QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLM 617
             Y   +     +LSGG+KQR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++
Sbjct: 742 WSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VL 797

Query: 618 KKKEVTIISIAHRLSTIRRSEIVIVLGNDGS 648
           K+     I+I+ R S I+  ++++ + +D S
Sbjct: 798 KRYRFNFITISQRPSLIKYHDLLLEISDDNS 828

>NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366
          Length = 753

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 121/272 (44%), Gaps = 58/272 (21%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++VSF Y          +L
Sbjct: 496 AQSRIKKL-EKLPVLEPPEEEKTITFKFPDCEKLSPPIIQLQDVSFGYDENNLLLNDVNL 554

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           + +++  S + +VG +G GK+T+  ++++  +PT G ++ +G           R  IG  
Sbjct: 555 DVQMD--SRIALVGANGCGKTTLLKVMMEELRPTKGFVSRNG-----------RLRIGYF 601

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +       D  T  + + + A              +  K  ++Y+  LG  G    
Sbjct: 602 TQHHV----DSMDLTTSAVDWMSKA--------------YPGKTDEEYRHHLGSFGITGT 643

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEA-----TSALDVESESAINYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE      T+ LD   ES  N++ G LM
Sbjct: 644 LGLQKMELLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVESLKNFSGGVLM 703

Query: 618 KKKEVTIISIAHRLSTIRRSEIVIVLGNDGSV 649
              +++II   H  + I  SE   V   DG +
Sbjct: 704 VSHDISIID--HVCNEIWVSENGTVKRFDGDI 733

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 423

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 104/218 (47%), Gaps = 20/218 (9%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK--PTAGTITVDGQDISKLNSKS 504
            +I  +++  ++PG+   ++G SG GK+T+  +L    +     G I VDG     L   S
Sbjct: 859  RILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGH----LRDTS 914

Query: 505  LRRHIGIVQQEPIL-MSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT-----KFPD 558
             +R  G  QQ+ +   + ++RD + +   Y    + I R  K  +  + I       + D
Sbjct: 915  FQRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEKNAYVEDIIKLLGMEAYAD 973

Query: 559  QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLM 617
                ++G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     KL+
Sbjct: 974  ---AVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLV 1030

Query: 618  KKKEVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIG 653
               +  + +I H+ S I   E   +++L N G  V  G
Sbjct: 1031 NHGQAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFG 1067

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 117/249 (46%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKK----YIPGKGE-----IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K    + P   +     I+ ++VSF+Y  +    +   +
Sbjct: 495 AQSRIKKL-EKLPILEPPEEEKVVNFHFPDCEKLSPPIIQLQDVSFSY--KESDPLLTDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +PT G +           S++ R  IG  
Sbjct: 552 NLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGFV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +    S+  N +  + + +TA              F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV---DSMDLNQS-AVDWMSTA--------------FPGKTDEEYRRHLGAFGISGS 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+     ++  G LM
Sbjct: 643 LGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALVDALKSFNGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I+
Sbjct: 703 VSHDISVIN 711

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 422

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SFAY  +P + ++  LNF ++  S + +VGP+G GKST+  ++    +  +G +
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT EA 
Sbjct: 453 SRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRGQLG---RYGLTGEAQ 509

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L+ PNVL+LDE
Sbjct: 510 TVQM---------------------------GT-LSEGQRSRVVFALLALEAPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa]
           {ON} highly similar to gnl|GLV|KLLA0D04554g
           Kluyveromyces lactis KLLA0D04554g and similar to YCR011C
           uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1027

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 119/243 (48%), Gaps = 27/243 (11%)

Query: 428 KGEIEFKNVSFAYPTRPGS--QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485
           K  + F+N+++   +  GS  Q+  S++  ++PG  + I+G SG GK+T+  +L    K 
Sbjct: 367 KATLTFENINYQVRSSKGSSTQVLNSISGSVKPGEILAIMGGSGAGKTTLLDILAMKNKT 426

Query: 486 --TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILM-----------SGSIRDNITYGLT 532
               G+I ++G +++K N   +   +G V QE  L+           S  +R  +   ++
Sbjct: 427 GKVTGSIRLNGTEVTKQNYSKI---VGFVDQEDFLLPTLTVYETVLNSALLR--LPRSMS 481

Query: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592
           + A  + + +V ++      +  F  + + I       +SGG+K+R++IA  L+  P +L
Sbjct: 482 FAAKQKRVYQVLEE------LRIFEIRNRVIGNDLERGISGGEKRRVSIACELVTSPLIL 535

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVT-IISIAHRLSTIRRSEIVIVLGNDGSVVE 651
            LDE TS LD  + + +     +L      T I+SI    S I +    +VL ++G +V 
Sbjct: 536 FLDEPTSGLDSNNANNVIECLVRLANHYNRTLILSIHQPRSNIFKLFDKLVLLSEGELVY 595

Query: 652 IGK 654
            G+
Sbjct: 596 SGE 598

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 60/247 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SFAY   P + +++ LNF ++  S   +VGP+G GKST+  ++     P +G +
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT +A 
Sbjct: 563 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG---RYGLTGDAQ 619

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L+ PNVL+LDE
Sbjct: 620 KVQM---------------------------GT-LSEGQRSRVVFALLALENPNVLLLDE 651

Query: 597 ATSALDVES----ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN-----DG 647
            T+ LD+ +      AIN   G       V ++S   RL      +I +V        DG
Sbjct: 652 PTNGLDIPTIDSLADAINEFNGG------VVVVSHDFRLLDKIAKDIFVVEDKTATRWDG 705

Query: 648 SVVEIGK 654
           S+++  K
Sbjct: 706 SILDYKK 712

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 561 QTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKK 620
           QTIL     + SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ 
Sbjct: 328 QTILKKTKDM-SGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRF 382

Query: 621 EVTIISIAH 629
           + T++ ++H
Sbjct: 383 DRTLVLVSH 391

>Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 109/249 (43%), Gaps = 56/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P    K +  K           I+ ++V F Y  +  + + + +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEQDKTVDFKFPDCDKLSPPIIQLQDVFFGYDEK--NLLLEDV 551

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           N  ++  S + +VG +G GK+T+  ++++  +P  G +           S++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV-----------SRNPRLRIGYF 600

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +          +  LT  A               +F  K  ++Y+  LG  G    
Sbjct: 601 TQHHV---------DSMDLTTSAV---------DWMSRSFPGKTDEEYRRHLGSFGITGT 642

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+     N+  G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVDALKNFNGGVLM 702

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 703 VSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 116/257 (45%), Gaps = 52/257 (20%)

Query: 431 IEFKNVSFAYPTRP---GSQIFKSLNFKI----EP------------------------G 459
           I F+N+    P+R    G+++  +L F+I    EP                        G
Sbjct: 572 IRFENIDIIIPSRRAGRGAKLIGTLTFQIPSVIEPSSKSSSIQDFKKNFDPNVPLIDSTG 631

Query: 460 SNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILM 519
           +++ I+GP+  GKS+I  ++ + + P            + L S     ++  V Q P   
Sbjct: 632 ASLLILGPNSCGKSSIQRIITEVW-PVYNK--------NGLLSIPAPSNLFCVPQRPYFT 682

Query: 520 -SGSIRDNITYGLTYEATAEE------IRRVTKQCFCHNFITK-FPDQYQTILGPNGTLL 571
             G+ RD I Y ++ +   +       + R+ K+      + +     Y   +     +L
Sbjct: 683 RGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWKDVL 742

Query: 572 SGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRL 631
           SGG+KQR+  AR L  +P  ++LDEAT+A+ V+ E   +Y F  L+K+     I+I+ R 
Sbjct: 743 SGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DYLFN-LLKRYRFNFITISQRP 798

Query: 632 STIRRSEIVIVLGNDGS 648
           S I+  ++++ + + GS
Sbjct: 799 SLIKYHDMLLEVDSSGS 815

>NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON}
           Anc_1.427
          Length = 1097

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 119/260 (45%), Gaps = 47/260 (18%)

Query: 431 IEFKNVSFAYPTRPGS--------------QIFKSLNFKIEPGSNVCIVGPSGRGKSTIA 476
           + F+N+S+  P  PG                I  +++  ++PG    I+G SG GK+T+ 
Sbjct: 407 LTFENISYRVPQLPGDHGNNNSNNDNDDGKSILNNISGIVKPGQIFAIMGGSGAGKTTLL 466

Query: 477 SLLLKYYKP--TAGTITVDGQDISKLNSKSLRRHIGIVQQ-----------EPILMSGSI 523
            +L    K     GTI V+GQ IS+   K   +  G V Q           E +L S  +
Sbjct: 467 DILAMKRKTGIVTGTIKVNGQTISR---KDYSKLTGFVDQNDYLHPMLTVYETVLNSALL 523

Query: 524 RDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL-LSGGQKQRIAIA 582
           R  +   +++EA    + +V ++        +  D    I+G +    +SGG+K+R++IA
Sbjct: 524 R--LPRSMSFEAKESRVYQVLEE-------LRIFDIKDRIIGSDFERGISGGEKRRVSIA 574

Query: 583 RALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH--RLSTIRRSEIV 640
             L+  P +L LDE TS LD  + S +  +  +L +    T++   H  R +   + + +
Sbjct: 575 CELVTSPLILFLDEPTSGLDANNASNVINSLVRLSQHYNRTLVLTIHQPRSNIFYQFDKL 634

Query: 641 IVLGN-----DGSVVEIGKF 655
           ++L N      G V ++ +F
Sbjct: 635 VLLSNSEMVYSGDVSKVNEF 654

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 116/247 (46%), Gaps = 34/247 (13%)

Query: 431 IEFKNVSF-AYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP--TA 487
           + F+N+++    ++    I K ++  I+PG  + ++G SG GK+T+  +L    K     
Sbjct: 377 LSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVT 436

Query: 488 GTITVDGQDISKLNSKSLRRHIGIVQQ-----------EPILMSGSIRDNITYGLTYEAT 536
           G+I V+G DI +   K   + IG V Q           E +L S  +R  +    ++ A 
Sbjct: 437 GSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLR--LPRSFSFAAK 491

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILD 595
              + +V ++        +  D    ++G +    +SGG+K+R++IA  L+  P +L LD
Sbjct: 492 QTRVYQVLEE-------LRILDIKDRVIGNDFERGISGGEKRRVSIACELVTSPLILFLD 544

Query: 596 EATSALDVESESAINYTFGKLMKKKEVTIISIAH--RLSTIRRSEIVIVLGN-----DGS 648
           E TS LD  + + +     +L K    T++   H  R +  +  + +++L N      G 
Sbjct: 545 EPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVYSGD 604

Query: 649 VVEIGKF 655
            + +G+F
Sbjct: 605 AIRVGEF 611

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F  +SF+Y   P + +++ LNF ++  S   +VGP+G GKST+  ++     P  G +
Sbjct: 390 LAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV 449

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + ++     G +     YGLT EA 
Sbjct: 450 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHISEDFQFWRGQLG---RYGLTGEAQ 506

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                              LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 507 TAQM----------------------------ATLSEGQRSRVVFALLALEQPNVLLLDE 538

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 539 PTNGLDI 545

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 278

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 116/241 (48%), Gaps = 29/241 (12%)

Query: 431 IEFKNVSFAYP-TRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP--T 486
           + FK++ +  P  R  S+ +   ++  ++PG  + ++G SG GK+T+  +L    K    
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 487 AGTITVDGQDISKLNSKSLRRHIGIVQQ-----------EPILMSGSIRDNITYGLTYEA 535
           +G I V+G+ ISK   K   + IG V Q           E +L S  +R  +   L +EA
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALPFEA 510

Query: 536 TAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLIL 594
               + +V ++        +  D    I+G      +SGG+K+R++IA  L+  P +L L
Sbjct: 511 KRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFL 563

Query: 595 DEATSALDVESESAINYTFGKLMKKKEVT-IISIAHRLSTIRRSEIVIVLGNDGSVVEIG 653
           DE TS LD  + S +     +L +    T ++SI    S I +    +VL ++G +V  G
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSG 623

Query: 654 K 654
           +
Sbjct: 624 E 624

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F  ++F+Y   P + +++ LNF ++  S + +VGP+G GKST+  ++     P AG +
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLG---RYGLTGEGQ 509

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 510 TVQM---------------------------GT-LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 109/223 (48%), Gaps = 35/223 (15%)

Query: 431 IEFKNVSFAYPT-------RPGS--QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481
           + F+N+++  P+       +P S  ++ KS++  ++PG    I+G SG GK+T+  +L  
Sbjct: 390 LSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAM 449

Query: 482 YYKP--TAGTITVDGQDISKLNSKSLRRHIGIVQQ-----------EPILMSGSIRDNIT 528
             K     G I V+G  +S+   KS  + IG V Q           E +L S  +R  + 
Sbjct: 450 KRKTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLR--LP 504

Query: 529 YGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL-LSGGQKQRIAIARALLK 587
             +++E+    + ++ ++        +  D    I+G +    +SGG+K+R++IA  L+ 
Sbjct: 505 RTMSFESKQSRVFQILEE-------LRIFDIKDRIIGNDFERGISGGEKRRVSIACELVT 557

Query: 588 KPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHR 630
            P +L LDE TS LD  + + +  +  +L K    T+I   H+
Sbjct: 558 SPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQ 600

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 80/183 (43%), Gaps = 37/183 (20%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SFAY  +P + +++ LNF ++  S V +VGP+G GKST+  ++       +G +
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 491 TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCH 550
                      S+     +G+  Q         +D     L    +  E  R       H
Sbjct: 450 -----------SRHTHVKLGVYSQHS-------QDQ----LDLTKSPLEFVRDKYSHISH 487

Query: 551 NFITKFPDQYQTILGPNG----------TLLSGGQKQRIAIARALLKKPNVLILDEATSA 600
           +F       ++  LG  G            LS GQ+ R+  A   L+ PNVL+LDE T+ 
Sbjct: 488 DF-----QYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAPNVLLLDEPTNG 542

Query: 601 LDV 603
           LD+
Sbjct: 543 LDI 545

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 278

>Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii AEL032W
          Length = 748

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 114/249 (45%), Gaps = 57/249 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K +  K           I+ + VSF Y  +    + K +
Sbjct: 492 AQSRIKKL-EKLPVLEPPEEEKSVNFKFADCEKLSPPIIQLQEVSFGYEDQL---LLKDV 547

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           +  ++  S + +VG +G GK+T+  ++++   P +G +           S++ R  IG  
Sbjct: 548 SLDVQMDSRIALVGANGCGKTTLLKIMMEQLTPLSGFV-----------SRNPRLRIGYF 596

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            Q  +       D++      + T   +  ++K     NF  K  ++Y+  LG  G    
Sbjct: 597 TQHHV-------DSM------DLTMSSVDWMSK-----NFPGKSDEEYRRHLGAFGITGS 638

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P++L+LDE ++ LD     A+      ++ G LM
Sbjct: 639 LGLQRIQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALVDALKAFSGGVLM 698

Query: 618 KKKEVTIIS 626
              ++++I 
Sbjct: 699 VSHDISVID 707

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R++++RAL  +P++L+LDE ++ LDV S   I Y     +K    T++ ++H
Sbjct: 365 FSGGWRMRLSLSRALFCQPDLLLLDEPSNMLDVPS---IAY-LSNYLKTYPATVLVVSH 419

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 111/227 (48%), Gaps = 28/227 (12%)

Query: 433 FKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP------- 485
           +K  +F + T+   +I +S+N   +PG    I+GPSG GKS++ +L+    K        
Sbjct: 697 WKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYG----LTYEATAEEIR 541
           T+G+I  +   +S+L  K++  ++     + +L + ++++ + Y     L +   AE + 
Sbjct: 754 TSGSIMFNDIQVSELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAERME 812

Query: 542 RVTKQCFCHNFITKFPDQY--QTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILDEAT 598
           R        N I     ++    I+G      +SGG+K+R+ +   LL  P +L+LDE T
Sbjct: 813 RT------DNLIRSLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPT 866

Query: 599 SALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
           S LD  + + I     KL +++  TII   H+     RSE+    GN
Sbjct: 867 SGLDSFTSATILEILEKLCREQGKTIIITIHQ----PRSELFKRFGN 909

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 127/287 (44%), Gaps = 55/287 (19%)

Query: 442 TRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL-------------LKYYKPTAG 488
           ++  + +  + +  +  GS + ++G SG GK+T+ ++L             ++Y     G
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 489 T---------ITVDGQDISKLNSKSLRRHIGIV---QQEPILMSGSIRDNITYGLTYEAT 536
           +           +DGQD        +++H+ +    QQ+ +    + R+ + +    +  
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 537 AEEIRRVTKQCFCHNFITKF--PDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLI 593
           + E    TK+      I +    D   T++G N    LSGG+K+R++I   ++  P+++ 
Sbjct: 152 SSE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMF 208

Query: 594 LDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG-----NDGS 648
           LDE T+ LD  S   +  T  KL K+   T I   H+     RS+I+ +L      + G+
Sbjct: 209 LDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ----PRSDILFLLDQVCILSKGN 264

Query: 649 VVEIGKFKT---LFGNPLSELSQLLN------EKSTINERNPNEKPA 686
           VV   K       F +    + QL+N      + S+++ R+  E+ A
Sbjct: 265 VVYCDKMDNTIPYFESIGYHVPQLVNPADYFIDLSSVDSRSDKEEAA 311

>TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1621

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 103/213 (48%), Gaps = 10/213 (4%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            +I  +++  ++PG+   ++G SG GK+T+   L +  + T G +T D     KL  +S  
Sbjct: 991  RILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RTTMGIVTGDMFVDGKLRDESFP 1048

Query: 507  RHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT--KFPDQYQTI 563
            R IG  QQ+ + L + ++R+++ +   Y      + R  K+ +    I   +     + I
Sbjct: 1049 RSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPYSVSRKEKELYVEEVIKILEMEKYAEAI 1107

Query: 564  LGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLMKKKEV 622
            +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +I     KL    + 
Sbjct: 1108 VGVPGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSICKLMRKLANHGQA 1167

Query: 623  TIISIAHRLSTIRRSEI--VIVLGNDGSVVEIG 653
             + +I H+ S I   E   ++ L   G  V  G
Sbjct: 1168 ILFTI-HQPSAILMQEFDRLLFLQKGGKTVYFG 1199

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 100/198 (50%), Gaps = 25/198 (12%)

Query: 459 GSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRHIGIVQQEP 516
           GS++ I+GP+  GKS+I  ++ + +      G +++  ++           +I  + Q+P
Sbjct: 638 GSSLLILGPNSCGKSSIQRIIAEIWPVYNKNGLLSIPSEN-----------NIFCIPQKP 686

Query: 517 IL-MSGSIRDNITYGLTYEATAE------EIRRVTKQCFCHNFITK-FPDQYQTILGPNG 568
                G++RD I Y ++ +   +      E+ ++  +      + +     Y   +    
Sbjct: 687 YFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTYLDAVADWK 746

Query: 569 TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIA 628
            LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     ISI+
Sbjct: 747 DLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISIS 802

Query: 629 HRLSTIRRSEIVIVLGND 646
            R + I+  E+++ +G +
Sbjct: 803 QRPTLIKYHEMLLEIGEN 820

>YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}
            PDR10ATP-binding cassette (ABC) transporter, multidrug
            transporter involved in the pleiotropic drug resistance
            network; regulated by Pdr1p and Pdr3p
          Length = 1564

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 111/231 (48%), Gaps = 11/231 (4%)

Query: 431  IEFKNVSFAYPTRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
              +KN+ +  P + G + I  +++  ++PG+   ++G SG GK+T+   L +  + T G 
Sbjct: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGL 980

Query: 490  ITVDGQDISKLNSKSLRRHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIRRVTKQCF 548
            IT D     +   +S  R IG  QQ+ + L + ++R+++ +   Y   A+++    K  +
Sbjct: 981  ITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEKDKY 1039

Query: 549  CHNFITKFPDQY--QTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVES 605
                I     +     I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++
Sbjct: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099

Query: 606  ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIGK 654
              +      KL  + +  + +I H+ S +   E   ++ L   G  V  G+
Sbjct: 1100 AWSTCQLMKKLASRGQAILCTI-HQPSALLMQEFDRLLFLQEGGQTVYFGE 1149

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 98/200 (49%), Gaps = 14/200 (7%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            +I  +++  ++PG+   ++G SG GK+T+   L +  + T G IT D     K   +S  
Sbjct: 910  RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGVITGDVFIDGKPRDESFP 967

Query: 507  RHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT-----KFPDQY 560
            R IG  QQ+ + L + ++R+++ +   Y     E+    K  +  + I      K+ D  
Sbjct: 968  RSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEMEKYAD-- 1024

Query: 561  QTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLMKK 619
              I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     KL  +
Sbjct: 1025 -AIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKLCNQ 1083

Query: 620  KEVTIISIAHRLSTIRRSEI 639
             +  + +I H+ S I   E 
Sbjct: 1084 GQAILCTI-HQPSAILMQEF 1102

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 124/273 (45%), Gaps = 56/273 (20%)

Query: 415 MISPTTGKKYIPGKGEIEFKNVSFAYPT---RPGSQIFKSLNFKIEP------------- 458
           +IS T  +K+   +G I  +N+    P+   + G ++ K L F+I P             
Sbjct: 568 VISGTVQRKF---RG-IRLENIDIMIPSVRGKSGIKLIKKLTFQIPPHLDQLSSKTSSLQ 623

Query: 459 ----------------GSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNS 502
                            S++ I+GP+G GKS+I  ++ + +      I      +SK +S
Sbjct: 624 DITSMSNIPLPFLSGQASSLLILGPNGCGKSSIQRIIAEIW-----PIYNKNGLLSKPDS 678

Query: 503 KSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEE------IRRVTKQCFCHNFITKF 556
            SL   + I Q+      G+ RD I Y ++ +   +       +  +  +      + + 
Sbjct: 679 SSL---LCIPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRA 735

Query: 557 PD-QYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGK 615
           P   Y   +     +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +Y F  
Sbjct: 736 PGWSYLDEVTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFN- 791

Query: 616 LMKKKEVTIISIAHRLSTIRRSEIVIVLGN-DG 647
           ++KK   + I+I+ R S I+  ++++ + + DG
Sbjct: 792 MLKKFRFSFITISQRPSLIKYHDMLLEIADRDG 824

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 98/200 (49%), Gaps = 14/200 (7%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            +I  +++  ++PG+   ++G SG GK+T+   L +  + T G IT D     K   +S  
Sbjct: 968  RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGVITGDVFIDGKPRDESFP 1025

Query: 507  RHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT-----KFPDQY 560
            R IG  QQ+ + L + ++R+++ +   Y     E+    K  +  + I      K+ D  
Sbjct: 1026 RSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEMEKYAD-- 1082

Query: 561  QTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLMKK 619
              I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     KL  +
Sbjct: 1083 -AIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKLCNQ 1141

Query: 620  KEVTIISIAHRLSTIRRSEI 639
             +  + +I H+ S I   E 
Sbjct: 1142 GQAILCTI-HQPSAILMQEF 1160

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 105/217 (48%), Gaps = 16/217 (7%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            +I  +++  ++PG+   ++G SG GK+T+   L +  + T G IT D        ++S  
Sbjct: 886  RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAE--RVTMGVITGDIFVDGLPRNESFP 943

Query: 507  RHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT-----KFPDQY 560
            R IG  QQ+ + L + ++R+++ +   Y    +E+    K  +    I      K+ D  
Sbjct: 944  RSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVEEKNAYVEEIIKILEMEKYAD-- 1000

Query: 561  QTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLMKK 619
              I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     KL K 
Sbjct: 1001 -AIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKKLCKH 1059

Query: 620  KEVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIGK 654
             +  + +I H+ S I   E   ++ +   G  V  G+
Sbjct: 1060 GQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGE 1095

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 58.5 bits (140), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 58/99 (58%), Gaps = 3/99 (3%)

Query: 579 IAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSE 638
           I +ARALL+   +L++DEAT+++D E+++ +  T     + ++VTI++IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 639 IVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677
            ++VL + G V+E     TL  N       +  E   +N
Sbjct: 60  KILVL-DAGQVIEYDHPYTLLKNESGHFYDICKESGNLN 97

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 112/233 (48%), Gaps = 22/233 (9%)

Query: 424 YIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYY 483
           YI  +G  +++N       R   +I +S+N   +PG    I+GPSG GKST+ +L+    
Sbjct: 675 YIHVQGISQWRN---KIINRERKKILRSVNATFKPGMVNAIMGPSGSGKSTLLNLISGRV 731

Query: 484 KPTA-------GTITVDGQDISKLNSKSLRRHIGIVQQEPILMSG-SIRDNITYGLTYEA 535
           K T        G+++ +G ++S+   K +  ++   Q +  L+S  ++R+  T+    + 
Sbjct: 732 KSTLFSRFTKDGSMSFNGAEVSETMFKQICSYVS--QDDDHLLSKLTVRE--TFKFASDL 787

Query: 536 TAEEIRRVTKQCFCHNFITKFPDQY--QTILGPNGTL-LSGGQKQRIAIARALLKKPNVL 592
               +    ++   +N I     ++   TI+G      +SGG+K+R+ +   LL  P +L
Sbjct: 788 RLHHLNAKEREAKRNNLIIALGLKHCEDTIIGNEFVKGISGGEKRRVTMGIQLLNDPPIL 847

Query: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
           +LDE TS LD  + S I      L ++   T+I   H+     R+E+    GN
Sbjct: 848 LLDEPTSGLDSFTSSTILEILSNLCQEYGKTVILTIHQ----PRAELFKKFGN 896

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 116/267 (43%), Gaps = 25/267 (9%)

Query: 442 TRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK---PTAGTITVDGQDIS 498
           ++  +++ KS +  +  GS + ++G SG GK+T+ ++L         T G I    +D  
Sbjct: 30  SKTDAELVKSFSLDLPSGSIMAVMGGSGSGKTTLLNVLASKISGGLKTVGEINYIREDCG 89

Query: 499 KLNSKSLRRHIGIV---QQEPILMSGSIRDNITYG--LTYEATAEEIRRVTKQCFCHNFI 553
            +N      H  +    QQ+ +    + RD + +   L  +    E  ++ +Q       
Sbjct: 90  -VNDGDHPEHAVMTYLPQQDVLPARLTCRDTMMFAADLKLDKPKHEKVQIVEQLIDE--- 145

Query: 554 TKFPDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYT 612
               D   TI+G +    LSGG+K+R++I   ++  P+++ LDE T+ LD  S   +  T
Sbjct: 146 LGLKDCADTIIGDSSHRGLSGGEKRRLSIGTQMIANPSIMFLDEPTTGLDAYSAYLVVKT 205

Query: 613 FGKLMKKKEVTIISIAHRLSTIRRSEIVIVL--------GNDGSVVEIGKFKTLFGNPLS 664
             KL +      I   H+     RS+I+ +L        GN      + K    F +   
Sbjct: 206 IRKLAEDDGRIFIMSIHQ----PRSDIMFLLDKVCILSKGNIVYCDAVDKMIPYFESMGY 261

Query: 665 ELSQLLNEKSTINERNPNEKPAETPEQ 691
           ++ QL+N    I + +  +  +E  E+
Sbjct: 262 KVPQLVNPADYIVDISSVDSRSEEAEE 288

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 85/187 (45%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF+Y   P + ++++L+F ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG---RYGLTGEGQ 509

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 510 TVQM---------------------------GT-LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {ON}
           YOL075C (REAL)
          Length = 1295

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 103/213 (48%), Gaps = 25/213 (11%)

Query: 447 QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP-------TAGTITVDGQDISK 499
           QI +S+N   +PG    I+GPSG GKS++ +L+    K        TAG+I ++   +S+
Sbjct: 709 QILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSFFAKFNTAGSIMLNDIQVSE 768

Query: 500 LNSKSLRRHIGIVQQEPILMSGSIRDNITYG----LTYEATAEEIRRVTKQCFCHNFITK 555
              K++  ++     + +L + ++++ + Y     L +   AE + R        N I  
Sbjct: 769 FMFKNVCSYVS-QDDDHLLATLTVKETLKYASALRLHHLTEAERMERT------DNLIRS 821

Query: 556 FPDQY--QTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYT 612
              ++    I+G      +SGG+K+R+ +   LL  P +L+LDE TS LD  + + I   
Sbjct: 822 LGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEI 881

Query: 613 FGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGN 645
             KL  ++  T+I   H+     RSE+    GN
Sbjct: 882 LEKLCTEQGKTVIITIHQ----PRSELFKRFGN 910

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 126/279 (45%), Gaps = 43/279 (15%)

Query: 442 TRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLL-------------LKYYKPTAG 488
           ++  + +  + +  +  GS + ++G SG GK+T+ ++L             ++Y     G
Sbjct: 38  SKTNTTLVNAFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDMG 97

Query: 489 TITVDGQ-DISKLNSKSLRRHIGIV-----QQEPILMSGSIRDNITYGLTYEATAEEIRR 542
           + + + +  +  L+ +    H  ++     QQ+ +    + R+ + +    +  + E   
Sbjct: 98  SESGEARLKVGHLDDQDHPTHKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSE--- 154

Query: 543 VTKQCFCHNFITKF--PDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILDEATS 599
            TK+      I +    D   T++G N    LSGG+K+R++I   ++  P+V+ LDE T+
Sbjct: 155 RTKRIMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSVMFLDEPTT 214

Query: 600 ALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLG-----NDGSVVEIGK 654
            LD  S   +  T  KL K+   T I   H+     RS+I+ +L      + G+VV   K
Sbjct: 215 GLDAYSAYLVIKTLKKLAKEDGRTFIMSIHQ----PRSDILFLLDQVCILSKGNVVYCDK 270

Query: 655 FKTL---FGNPLSELSQLLN------EKSTINERNPNEK 684
              +   F +    + QL+N      + S+++ R+  E+
Sbjct: 271 MNNIIPYFESIGYRIPQLVNPADYFIDLSSVDSRSDKEE 309

>NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {ON}
           Anc_8.661
          Length = 868

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 102/200 (51%), Gaps = 25/200 (12%)

Query: 458 PGSNVCIVGPSGRGKSTIASLLLKYY--KPTAGTITVDGQDISKLNSKSLRRHIGIVQQE 515
           PGS++ I+GP+  GK++I  ++ + +      G +++  +D           ++  V Q+
Sbjct: 636 PGSSLLILGPNSCGKTSIQRIIAEIWPIYNKNGLLSIPAED-----------NLFCVPQK 684

Query: 516 PILM-SGSIRDNITYGLT----YEATAEEIRRVTKQCFCH-NFITKFPDQYQTI--LGPN 567
           P     G++RD I Y ++    Y+   ++ + V      H +++ K    +  +  +   
Sbjct: 685 PYFTRGGTLRDQIIYPMSSDEFYDRGIKDAQLVQIMAEVHLDYLLKRGTGFSYLDNVADW 744

Query: 568 GTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISI 627
             +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   ++ F  ++KK     I+I
Sbjct: 745 KDVLSGGEKQRMNFARILFHKPRFVVLDEATNAISADME---DHLFN-ILKKYRFNFITI 800

Query: 628 AHRLSTIRRSEIVIVLGNDG 647
           + R + I   ++++ +  +G
Sbjct: 801 SQRPALIEYHDLLLEILEEG 820

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 124/268 (46%), Gaps = 24/268 (8%)

Query: 431  IEFKNVSFAYPTRPG-SQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGT 489
              ++N+ +  P +     I  +++  ++PG+   ++G SG GK+T+   L +  + T GT
Sbjct: 867  FHWRNLCYEIPIKKEIRHILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQ--RVTVGT 924

Query: 490  ITVDGQDISKLNSKSLRRHIGIVQQEPI-LMSGSIRDNITYGLT----YEATAEEIRRVT 544
            IT D      L  +S  R IG  QQ+ + L + ++R+++ +       ++   EE  +  
Sbjct: 925  ITGDVFVNGCLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPFDVPVEEKNKYV 984

Query: 545  KQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDV 603
            ++      +  + D    ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 985  EEIIKTLEMETYAD---AVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1041

Query: 604  ESESAINYTFGKLMKKKEVTIISIAHRLSTI--RRSEIVIVLGNDGSVVEIGKFKTLFGN 661
            ++  A      KL +  +  + +I H+ S I  +  + ++ L   G  V        FG+
Sbjct: 1042 QTAWATCQLMKKLAQNGQAILCTI-HQPSAILMQNFDRLLFLQKGGETV-------YFGD 1093

Query: 662  PLSELSQLLN--EKSTINERNPNEKPAE 687
              S    +++  EK    +  P   PAE
Sbjct: 1094 LGSGCQTMIDYFEKEGAEKCPPEANPAE 1121

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 85/199 (42%), Gaps = 37/199 (18%)

Query: 431 IEFKNVSFAY----PTRP--GSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYK 484
           + +K +++ Y    PTR     QI KS++  + PG  + ++G  G G +T    LLK   
Sbjct: 147 MPWKIITYVYRKVTPTREIDTFQILKSMDGILNPGELLVVLGRPGSGCTT----LLK--- 199

Query: 485 PTAGTITVDGQDISK--------LNSKSLRRH-----IGIVQQEPILMSGSIRDNITYGL 531
             + +    G DISK        L  K +RRH     +   + +  L   ++   +    
Sbjct: 200 --SISSNTHGFDISKDSIISYNGLTPKDIRRHYRGEVVYNAESDIHLPHLTVYQTLLTVA 257

Query: 532 TYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL--------LSGGQKQRIAIAR 583
             +  +  I+ VT++ +  N +T+       +L    T         +SGG+++R++IA 
Sbjct: 258 RLKTPSNRIKDVTREDYA-NHLTQVTMATYGLLHTRDTKVGDDLVKGVSGGERKRVSIAE 316

Query: 584 ALLKKPNVLILDEATSALD 602
             +    V   D AT  LD
Sbjct: 317 VSICGSKVQCWDNATRGLD 335

>TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.366
           YFR009W
          Length = 753

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 107/248 (43%), Gaps = 56/248 (22%)

Query: 402 AASRLFELTDRIPMISPTTGKKYIPGKGE---------IEFKNVSFAYPTRPGSQIFKSL 452
           A SR+ +L +++P++ P   +K I  K           I+ ++VSF Y           L
Sbjct: 496 AQSRIKKL-EKLPILEPPEQEKSISFKFPDCEKLSPPIIQLQDVSFGYSEDDLLLKDVDL 554

Query: 453 NFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIV 512
           + +++  S + +VG +G GK+T+  ++++  +P                   LR   G V
Sbjct: 555 DLQMD--SRIALVGANGCGKTTLLKVMMEQLRP-------------------LR---GYV 590

Query: 513 QQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNG---- 568
            + P L        I Y   +   + ++           F  K  ++Y+  LG  G    
Sbjct: 591 SRNPRL-------RIAYFTQHHVDSMDLNSSAVDWMSKRFPGKTDEEYRRHLGSFGITGS 643

Query: 569 ------TLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAI-----NYTFGKLM 617
                  LLSGGQK R+A A   L  P+VLILDE ++ LD     A+     N+T G LM
Sbjct: 644 LGLQKMQLLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTNGIDALVDALKNFTGGVLM 703

Query: 618 KKKEVTII 625
              ++++I
Sbjct: 704 VSHDISVI 711

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K    T++ ++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 423

>KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1555

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 111/237 (46%), Gaps = 19/237 (8%)

Query: 428  KGEIEFKNVSFAYPTRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPT 486
            K    ++++ +    + G++ I  +++  ++PG+   ++G SG GK+T+   L +  + T
Sbjct: 905  KAIFHWRDLCYDVKIKNGTRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVT 962

Query: 487  AGTIT----VDGQDISKLNSKSLRRHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIR 541
             G IT    VDG    KL   S  R IG  QQ+ + L + S+R+++ +   Y      + 
Sbjct: 963  MGVITGYIYVDG----KLRDTSFPRSIGYCQQQDLHLKTASVRESLRFS-AYLRQPASVS 1017

Query: 542  RVTKQCFCHNFIT--KFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEAT 598
            +  K  +    I   +       I+G  G  L+  Q++R+ I   L  KP +L+ LDE T
Sbjct: 1018 KEEKDAYVEEVIKILEMEAYADAIVGVAGEGLNVEQRKRLTIGVELAAKPRLLVFLDEPT 1077

Query: 599  SALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIG 653
            S LD ++  A      KL +  +  + +I H+ S I   E   ++ L   G  V  G
Sbjct: 1078 SGLDSQTAWATCQLMRKLAEHGQAILCTI-HQPSAILMQEFDRLLFLQKGGQTVYFG 1133

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SF+Y   P   ++++L+F ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 392 LAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV 451

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 452 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG---RYGLTGEGQ 508

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 509 TVQM---------------------------GT-LSEGQRSRVVFALLALEQPNVLLLDE 540

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 541 PTNGLDI 547

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 280

>Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {ON}
           complement(62452..64284) [1833 nt, 611 aa]
          Length = 610

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 431 IEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTI 490
           + F ++SFAY     + ++++LNF ++  S + +VGP+G GKST+  ++    +  AG +
Sbjct: 393 LSFDDISFAYDGNKENNLYQNLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQAGRV 452

Query: 491 --------------TVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEAT 536
                         + D  D++K   + +R     + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLG---RYGLTGEGQ 509

Query: 537 AEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDE 596
             ++                           GT LS GQ+ R+  A   L++PNVL+LDE
Sbjct: 510 TVQM---------------------------GT-LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 597 ATSALDV 603
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 571 LSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAH 629
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 281

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 110/230 (47%), Gaps = 10/230 (4%)

Query: 428 KGEIEFKNVSFAYPTRPGSQ-IFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP- 485
           K  + F+N+ +   +  G + I   ++  ++PG  + ++G SG GK+T+  +L    K  
Sbjct: 363 KSTLTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAG 422

Query: 486 -TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVT 544
             +G+I ++G +I+K N   L +  G V QE  L+                   ++  V 
Sbjct: 423 KASGSIKINGSEITKQN---LSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQ 479

Query: 545 KQCFCHNFIT--KFPDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILDEATSAL 601
           KQ   +  +   +  D    I+G +    +SGG+K+R++IA  L+  P+VL LDE TS L
Sbjct: 480 KQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGL 539

Query: 602 DVESESAINYTFGKL-MKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVV 650
           D  + + +     +L +      I+SI    S I +S   +VL + G +V
Sbjct: 540 DSNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMV 589

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 118/253 (46%), Gaps = 27/253 (10%)

Query: 447  QIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLR 506
            +I  +++  ++PG+   ++G SG GK+T+   L +  + T G IT D     +   +S  
Sbjct: 870  RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAE--RVTMGVITGDVLVDGRPRDESFP 927

Query: 507  RHIGIVQQEPI-LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT-----KFPDQY 560
            R IG  QQ+ + L + ++R+++ +   Y     E+    K  +    I      K+ D  
Sbjct: 928  RSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAEVSVEEKDAYVEEVIKILEMEKYAD-- 984

Query: 561  QTILGPNGTLLSGGQKQRIAIARALLKKPNVLI-LDEATSALDVESESAINYTFGKLMKK 619
              ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +I     KL   
Sbjct: 985  -AVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMRKLASH 1043

Query: 620  KEVTIISIAHRLSTIRRSEI--VIVLGNDGSVVEIGKFKTLFGNPLSELSQLL---NEKS 674
             +  + +I H+ S I   E   ++ L   G  V  G+        L E  Q++    E++
Sbjct: 1044 GQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFGE--------LGEGCQVMIDYFERN 1094

Query: 675  TINERNPNEKPAE 687
              ++  P+  PAE
Sbjct: 1095 GSHKCPPDANPAE 1107

>Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 bp,
           1288 aa] {ON} complement(92949..93236,93239..96817)
           [3867 nt, 1289 aa]
          Length = 1288

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 115/253 (45%), Gaps = 39/253 (15%)

Query: 414 PMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKS 473
           PMI+ T  +  +       F+N      +R   +I  S++   +PG    I+GPSG GKS
Sbjct: 671 PMITVTLSEISLQVDYIRLFENWKKGQISRLSKEILHSIDATFKPGMINAIMGPSGSGKS 730

Query: 474 TI---------ASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSG-SI 523
           ++         +SL+ K+ K  +G++ ++   +S    K+L  ++   Q +  L+   ++
Sbjct: 731 SLLNLIAGKQKSSLMSKFTK--SGSLLLNRTPVSNELFKNLSSYV--TQDDSHLLPRLTV 786

Query: 524 RDNITYG----LTY------EATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTL-LS 572
           R+   Y     L Y      E+  +E+ R      C N          TI+G      +S
Sbjct: 787 RETFHYAAELRLYYLSKDERESKIDELIRALSLTHCQN----------TIIGDEFVKGIS 836

Query: 573 GGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLS 632
           GG+K+R+ +   LLK P +L+LDE TS LD  + + I     KL  +   T+I   H+  
Sbjct: 837 GGEKRRVTMGIQLLKDPPILLLDEPTSGLDSFTSATILEILEKLCVEFNKTVIITIHQ-- 894

Query: 633 TIRRSEIVIVLGN 645
              RSE+    GN
Sbjct: 895 --PRSELFRKFGN 905

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 98/216 (45%), Gaps = 35/216 (16%)

Query: 453 NFKIE--PGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRH-- 508
           NF ++   GS + I+G SG GK+T+ ++L       +G ++ +G     L++ S   +  
Sbjct: 39  NFSLDLPSGSVMAIIGGSGSGKTTLLNVLAS---KISGGLSYEGSIKYVLDNDSNTNNSQ 95

Query: 509 -----------------IGIVQQEPILMSG-SIRDNITYG--LTYEATAEEIRRVTKQCF 548
                            +  V Q+ IL +G + R+ + Y   L  + + E   ++T Q  
Sbjct: 96  EPNIVSDNTETETSSVSMAYVPQQDILSAGLTCRETLMYSAELKIQQSKEANNQLTSQLI 155

Query: 549 CHNFITKFPDQYQTILGPNGTL-LSGGQKQRIAIARALLKKPNVLILDEATSALDVESES 607
                    D     +G N    LSGG+K+R+ IA  ++  P+++ LDE T+ LD  S  
Sbjct: 156 DE---LGLKDCADIAVGDNTHRGLSGGEKRRLNIATHMIANPSIMFLDEPTTGLDAYSAF 212

Query: 608 AINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVL 643
            +  T  KL K+   T I   H+     RS+I+ +L
Sbjct: 213 LVIKTLKKLAKEGGRTFIMSIHQ----PRSDILFLL 244

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445