Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I003508.853ON94394347600.0
Skud_13.4608.853ON96991616900.0
YMR287C (DSS1)8.853ON96992216830.0
Kpol_237.48.853ON91691416600.0
Suva_13.4778.853ON96991316540.0
Smik_13.5038.853ON96991716530.0
TDEL0B002208.853ON93591015890.0
SAKL0D01078g8.853ON93692715480.0
KAFR0L019708.853ON93290915020.0
CAGL0M07051g8.853ON92391114690.0
ZYRO0C14938g8.853ON96690614680.0
KNAG0E011408.853ON92990814650.0
TBLA0B029208.853ON102998714570.0
KLTH0C03674g8.853ON94892214390.0
Kwal_27.102138.853ON93692013911e-177
NCAS0C003008.853ON94091313821e-176
NDAI0K003208.853ON96293013281e-167
KLLA0C06314g8.853ON98393712341e-153
AFR448W8.853ON81782611531e-143
TDEL0D023801.367ON9974211238e-06
Kpol_1043.421.367ON9884531202e-05
ZYRO0G01166g1.367ON9933991121e-04
CAGL0H04411g1.367ON10074021093e-04
KLLA0A10835g1.367ON10084581020.002
Smik_15.1451.367ON10014011020.002
Ecym_27151.367ON988399980.007
Suva_15.1471.367ON1001402970.009
KLTH0H13420g1.367ON986449960.010
YOL021C (DIS3)1.367ON1001408950.015
Skud_15.1371.367ON1030400930.025
TBLA0D050701.367ON99773930.026
NCAS0D005901.367ON99873920.031
NDAI0H035601.367ON101273910.044
SAKL0D10186g1.367ON988123890.065
TPHA0A023201.367ON1015107890.070
Kwal_34.162451.367ON986445870.14
KNAG0C019501.367ON996117860.16
KAFR0C045301.367ON100073850.24
AEL031C1.367ON99773840.27
NDAI0J00540singletonON33047771.6
Suva_6.2831.131ON84152752.9
TDEL0B071102.618ON88862727.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00350
         (943 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...  1838   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   655   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   652   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   644   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   641   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   641   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   616   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   600   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   583   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   570   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   570   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   568   0.0  
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   565   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   558   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   540   e-177
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   536   e-176
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   516   e-167
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   479   e-153
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   448   e-143
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    52   8e-06
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    51   2e-05
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    48   1e-04
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    47   3e-04
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    44   0.002
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    44   0.002
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    42   0.007
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    42   0.009
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    42   0.010
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    41   0.015
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    40   0.025
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    40   0.026
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    40   0.031
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    40   0.044
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    39   0.065
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    39   0.070
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    38   0.14 
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    38   0.16 
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    37   0.24 
AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON} S...    37   0.27 
NDAI0J00540 Chr10 complement(110610..111602) [993 bp, 330 aa] {O...    34   1.6  
Suva_6.283 Chr6 (496415..498940) [2526 bp, 841 aa] {ON} YJL204C ...    33   2.9  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    32   7.8  

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score = 1838 bits (4760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 901/943 (95%), Positives = 901/943 (95%)

Query: 1   MTVHLIRRNIQSSASALKLATRRTKYLEKRLPASFNLELVKSKFLERTKGLEHISEIKEV 60
           MTVHLIRRNIQSSASALKLATRRTKYLEKRLPASFNLELVKSKFLERTKGLEHISEIKEV
Sbjct: 1   MTVHLIRRNIQSSASALKLATRRTKYLEKRLPASFNLELVKSKFLERTKGLEHISEIKEV 60

Query: 61  DEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINETLISKKWKKFPDLPIKMNGDY 120
           DEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINETLISKKWKKFPDLPIKMNGDY
Sbjct: 61  DEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINETLISKKWKKFPDLPIKMNGDY 120

Query: 121 SFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVT 180
           SFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVT
Sbjct: 121 SFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVT 180

Query: 181 LRILNTLPKNILNHDLIKNKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAA 240
           LRILNTLPKNILNHDLIKNKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAA
Sbjct: 181 LRILNTLPKNILNHDLIKNKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAA 240

Query: 241 RDLNVNLKKLEVLHRYISDGVETSSISFLKLVHLVQNVDLNKLARNRADHDANHISNIIR 300
           RDLNVNLKKLEVLHRYISDGVETSSISFLKLVHLVQNVDLNKLARNRADHDANHISNIIR
Sbjct: 241 RDLNVNLKKLEVLHRYISDGVETSSISFLKLVHLVQNVDLNKLARNRADHDANHISNIIR 300

Query: 301 NTKDDIQYMTKIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLN 360
           NTKDDIQYMTKIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLN
Sbjct: 301 NTKDDIQYMTKIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLN 360

Query: 361 ETIPRVATDENINKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLF 420
           ETIPRVATDENINKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLF
Sbjct: 361 ETIPRVATDENINKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLF 420

Query: 421 RRIETYKNKELSRDNCQKLYNEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEV 480
           RRIETYKNKELSRDNCQKLYNE                   PEISGTTRTEQLIYSLTEV
Sbjct: 421 RRIETYKNKELSRDNCQKLYNELNPSNKILNSLLLSKDLCLPEISGTTRTEQLIYSLTEV 480

Query: 481 DNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHN 540
           DNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHN
Sbjct: 481 DNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHN 540

Query: 541 TIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDK 600
           TIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDK
Sbjct: 541 TIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDK 600

Query: 601 SSCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKC 660
           SSCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKC
Sbjct: 601 SSCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKC 660

Query: 661 RIDNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGK 720
           RIDNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGK
Sbjct: 661 RIDNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGK 720

Query: 721 YFKNHKIPAIYKTYKGLNMKPKASSQFKKILNVNKKRLPXXXXXXXXXXXXXXXXXXXXX 780
           YFKNHKIPAIYKTYKGLNMKPKASSQFKKILNVNKKRLP                     
Sbjct: 721 YFKNHKIPAIYKTYKGLNMKPKASSQFKKILNVNKKRLPSIKEISKIGSLLSSSTFSSKP 780

Query: 781 XXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTIL 840
             HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTIL
Sbjct: 781 SIHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTIL 840

Query: 841 RHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPS 900
           RHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPS
Sbjct: 841 RHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPS 900

Query: 901 ATTIPAIGEIIKNCKIANIDCLGNSLEFAIDENQEHDRVNTFT 943
           ATTIPAIGEIIKNCKIANIDCLGNSLEFAIDENQEHDRVNTFT
Sbjct: 901 ATTIPAIGEIIKNCKIANIDCLGNSLEFAIDENQEHDRVNTFT 943

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/916 (40%), Positives = 543/916 (59%), Gaps = 41/916 (4%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFD----TVTSSGS 91
           ++E +   FL RTKGLE   E+K++ +I+ +    + + YI PS+ W+     ++     
Sbjct: 69  DIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSWRSLAKPKI 128

Query: 92  FSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCV 151
            S++LIN  +         D  +K +    F  +QL +R L++GDLVLLR    EL MCV
Sbjct: 129 SSHNLINSNIQL-------DAQLKFSNPLEFQPVQLMERPLNVGDLVLLRVRPNELAMCV 181

Query: 152 DIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKEN 211
            +P S  DPR+TF   DG++ F+TK  + LRI + LP  + +    + +Y    I   +N
Sbjct: 182 SLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPEERYGHLPIGTIKN 241

Query: 212 NAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKL 271
            + +   LP+ ARQI TS  P++IS++A RDL    KKL++LHR + D      I F  L
Sbjct: 242 FSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQDYRGPWQIPFFTL 301

Query: 272 VHLVQNVDLNKLARNRADHDANHISNII--RNTKDDIQYMTKIDAITLLSTYWAVIQQQQ 329
           V LVQ +DLN+   ++  + A +++N++    T D++     I + T +STYWA++QQQ+
Sbjct: 302 VGLVQRLDLNEALDDK--YGATYLANLLGTHQTADNV----PISSATFVSTYWAIMQQQE 355

Query: 330 SQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATDE--NINKFTEAINKHNLEK 386
           S  WG+I +++ALL PISV+V+P  +  +Y  + + ++  D+   IN+F + +N+     
Sbjct: 356 SNFWGEIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLEADDYNEINRFVKLVNERKYRD 415

Query: 387 INEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXXXX 446
           I+  +P  + MLK++  G ++ N  I T++SK+FR+IE YK+ +++RD CQ L NE    
Sbjct: 416 ISTLYPSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLINEILPN 475

Query: 447 XXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDN----HAIIDQRRHDFKDLKVFCID 502
                          P  S   R++Q +Y LT +++    ++     R+DF DLKVFCID
Sbjct: 476 SMSNPLLLNMDLAL-PASSKLVRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCID 534

Query: 503 EKTAHEIDDGVSVLRK--DGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAF 560
            +TAHEIDDGVS+     DG  T L IHIADP S+FP     ++     +ILN+A  R+F
Sbjct: 535 SETAHEIDDGVSIENHGTDGLYT-LHIHIADPTSMFPESTNYDSEGIITDILNVALERSF 593

Query: 561 TTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDF------DKSSCSILEDTFEIQL 614
           TTYLP+ V+PMLPKS C  SDLG  G+ T TI+FSVD       D  S  I+ D+F+I+ 
Sbjct: 594 TTYLPDVVVPMLPKSICNLSDLGKQGQKTKTISFSVDVKVMSKGDGESLEIMFDSFKIRK 653

Query: 615 GKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRI-DNSAVIFGEGF 673
           G V+NFPK  TY +VD+ILN+     + +++DL  +  ++N LR  RI +N+AVIFGEGF
Sbjct: 654 GIVSNFPK-VTYDDVDRILNTPNDEASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGF 712

Query: 674 NKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKT 733
           NKG V L    ++GE + +++F D   T S ++VSE MILAN+L GKYF ++KI  +++ 
Sbjct: 713 NKGLVTL-NANEEGELT-EISFSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRC 770

Query: 734 YKGLNMKPKASSQFKKILNVNKKRL-PXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYA 792
           YK L +   A  Q+  ++   KK L P                       HEMIG  QY 
Sbjct: 771 YKQLPLDIIAQEQYDSMITSTKKGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYL 830

Query: 793 TVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWT 852
           TVTSPLRRFPDLINH Q+HR+L  +PLCFSQ ++D ++W +  R  IL+   R  + YWT
Sbjct: 831 TVTSPLRRFPDLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWT 890

Query: 853 LQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIK 912
           L YL +  + +P   +DVM+ +V +NG V C+ P LS+A GTLKL PSA   P IG+I+K
Sbjct: 891 LNYLKKLKKLDPEKTYDVMITAVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVK 950

Query: 913 NCKIANIDCLGNSLEF 928
           NCKI  IDCL   LE 
Sbjct: 951 NCKILRIDCLEGMLEL 966

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/922 (40%), Positives = 550/922 (59%), Gaps = 53/922 (5%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSN- 94
           ++E +   FL+RTKGLE   E+K++ +I+ +    + + Y+ PS+ W+  V S  S +  
Sbjct: 69  DIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWY--VNSWRSLTKP 126

Query: 95  -----DLINE--TLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKEL 147
                 LIN    LI+K         +K      F  +QL +  L++GD VLL+    EL
Sbjct: 127 KIPLYKLINSDFQLITK---------LKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNEL 177

Query: 148 LMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIK--NKYEAGL 205
            MCV +P S  DPR+TF   DGT+ F+TK  V LRI + LP  I  H LI+  + ++   
Sbjct: 178 AMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGI--HSLIQPESHHKHLP 235

Query: 206 INRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSS 265
           I   +N + +   LP+VARQ+ TS  P++IS++A +DL +  KKL++LHR + + +    
Sbjct: 236 IGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQ 295

Query: 266 ISFLKLVHLVQNVDLNKLARNRADHDANHISNIIRN--TKDDIQYMTKIDAITLLSTYWA 323
           I F  LV LVQ +DLNK   ++  +  N++++++ N  T +DI     I++ T +STYWA
Sbjct: 296 IPFFTLVGLVQKLDLNKALDDK--NGINYLTSLVNNYHTVNDI----PINSPTFVSTYWA 349

Query: 324 VIQQQQSQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAIN 380
           ++QQQ+S LWG+I +++ALL PISV+++P  +  +Y  + I ++  +    +NKF + +N
Sbjct: 350 IMQQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVN 409

Query: 381 KHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLY 440
           +     I+  +P  + +LK++  G ++ N  I  +ISK+FR+IE YK+ +++RD CQ L 
Sbjct: 410 ERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLI 469

Query: 441 NEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVD----NHAIIDQRRHDFKDL 496
           NE                   P  S   + +Q +Y LT ++      +  D  R+DF DL
Sbjct: 470 NEITPNSIPNPLLLNMDLAL-PASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDL 528

Query: 497 KVFCIDEKTAHEIDDGVSV--LRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNI 554
           +VFCID +TAHEIDDGVSV    +DG  T L+IHIADP S+FP    ++    S +ILN+
Sbjct: 529 RVFCIDSETAHEIDDGVSVKNYGRDGLYT-LYIHIADPTSMFPESTNVDIEGISTDILNV 587

Query: 555 AFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD-KSSCS-----ILED 608
           A +R+FTTYLP+ V+PMLP+S C  SDLG  G+ T TI+FSVD    S CS     I+ D
Sbjct: 588 ALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYD 647

Query: 609 TFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS-AV 667
           +F+I+ G V+NFPK  TY++VD+IL +     + +++DL  +  I+  LR+ RI NS AV
Sbjct: 648 SFKIRKGIVSNFPK-ATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAV 706

Query: 668 IFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKI 727
           IFGEGFNKG V ++    +GE + +V F D E T S I+VSE MILAN+L G+YF  +KI
Sbjct: 707 IFGEGFNKGLV-MLNADSEGELT-EVTFSDQEETLSTILVSEMMILANTLTGRYFAENKI 764

Query: 728 PAIYKTYKGLNMKPKASSQFKKILNVNKKRL-PXXXXXXXXXXXXXXXXXXXXXXXHEMI 786
             +++ YK L +   A  Q+  ++   KK + P                       HEMI
Sbjct: 765 GGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMI 824

Query: 787 GTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRK 846
           G  QY TVTSPLRRFPDLINH Q+HR+L  +PLCF+Q ++D ++W +  R  IL+  SR 
Sbjct: 825 GAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRN 884

Query: 847 FNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPA 906
            + YWTL YL +  +  P   FDVMV SV +NG   C+ P LS+A GTLKL PS+   P 
Sbjct: 885 SSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPM 944

Query: 907 IGEIIKNCKIANIDCLGNSLEF 928
           IG+I+KNCKI+ IDCL   LE 
Sbjct: 945 IGDIVKNCKISKIDCLEGMLEL 966

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/914 (40%), Positives = 536/914 (58%), Gaps = 51/914 (5%)

Query: 43  KFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINETLI 102
           KFL RT GLE IS    + +I++ S+  FN  Y  PS  W+ ++  S    +   + +  
Sbjct: 25  KFLNRTSGLETISIPHSIQKIKSNSIKRFNLTYNQPSNTWYKSLLISSPPPSLPCSPSTS 84

Query: 103 SK-------------KWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLM 149
           +              KW  F  +P     +++FN  QL ++  + GD+VLL      L M
Sbjct: 85  TSTSATTATSTSNSPKWLSF--IP---KNNHTFNINQL-NKKFNRGDIVLLSQDLSNLYM 138

Query: 150 CVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNIL-NHDLIKNKYEAGLINR 208
           C+++P S  DPR++FA  +G ++F+ + +V LRI   LP N+L + D ++ +   G+   
Sbjct: 139 CIELPQSTADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNLLLSDDFLQPEPTQGVGTV 198

Query: 209 KENNAIKLP-SLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSIS 267
           K  N+I  P  LPV+ RQ+  SP  S IS  A   L + LKKL++LHR +        I 
Sbjct: 199 K--NSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKKLQLLHRNLQ---AFKIIP 253

Query: 268 FLKLVHLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQ 327
            ++L  LVQN+DL K   N  +   ++ISN I N+ ++   +  I++  L++T+WA+ QQ
Sbjct: 254 LVQLSSLVQNLDLTKATSNDGE---SYISNFIANSNENYS-IESINSSNLIATFWAIRQQ 309

Query: 328 QQSQLWGDIQIHSALLFPISVSVLPF-NNVIYLNETIPRVATDENINKFTEAINKHNLEK 386
           QQ  LWGDI    ALLFP++VS+LP  +N +Y  E +P +  D +I +FT    K+ +  
Sbjct: 310 QQDHLWGDIHYSKALLFPLAVSILPLQSNYMYYKEILPAIELDHSIERFT----KNGIPN 365

Query: 387 INEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXX-X 445
              +FP  LN+LK+Y +G    ++KI T+ISK+FR ++ YK  ++SRD CQKLYNE    
Sbjct: 366 TPNEFPQLLNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQKLYNELVPK 425

Query: 446 XXXXXXXXXXXXXXXXPEISGTTRTEQLIYSL---TEVDNHAIIDQRRHDFKDLKVFCID 502
                           P  S  T  ++ +Y +    +  N++     RHDF DL+VFCID
Sbjct: 426 EQKIQNSLLYNTDLALPLASNRTEEQEKVYQMYNPIQTSNNS----NRHDFGDLRVFCID 481

Query: 503 EKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTT 562
           EKTAHEIDDGVS+  K  N+  L +HIADP+S F + N    N  +DEIL IA +R+FTT
Sbjct: 482 EKTAHEIDDGVSIEYKQNNVYTLHVHIADPSSYFKICNDHNVNIENDEILKIALQRSFTT 541

Query: 563 YLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD----KSSCSILEDTFEIQLGKVN 618
           YLP+ VLPMLPK  C  +DLG TG+ T TITFSVD        +  +L++TF+++LG V+
Sbjct: 542 YLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVDVKLNKKDMTVKVLDNTFQVRLGYVS 601

Query: 619 NFPKNTTYKEVDKILNSSIK--RENDIERDLREMRFIANHLRKCRIDNSAVIFGEGFNKG 676
           NF K+ TY +VD ILN S +  R+  +E+DL+ M  IA  L   RI N+AVIF +  N G
Sbjct: 602 NFVKDMTYSDVDSILNDSKESGRDKKVEKDLKSMFLIAKGLNNSRIMNNAVIFSDEINNG 661

Query: 677 AVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKG 736
            + L + +  GE + ++NFK  + T SNI+VSE MILANSLAGK+F  + IPAIY++Y  
Sbjct: 662 KIELTKDEITGEVT-QINFKGGKFTDSNILVSELMILANSLAGKFFAENGIPAIYRSYSD 720

Query: 737 LNMKPKASSQFKKIL-NVNKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVT 795
           L +   A S++  +L N+   + P                       H MI T  YATVT
Sbjct: 721 LLLGKDAQSEYNAMLSNLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSMIATKYYATVT 780

Query: 796 SPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           SPLRRFPD+INH Q+HR L+ QPLCF+Q  L+ M W++  +D ILR  SR  N YWTL++
Sbjct: 781 SPLRRFPDMINHLQIHRILSKQPLCFTQRDLENMNWNIQTKDVILRSSSRMINTYWTLRH 840

Query: 856 LNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCK 915
           + +++  +P  +FDVM+ SV +NG  HCIL + S+A G L   P+  + P IG+ + NCK
Sbjct: 841 IKDQLSEDPDKKFDVMITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHPLIGDTVSNCK 900

Query: 916 IANIDCLGNSLEFA 929
           I  IDCLGN LEF+
Sbjct: 901 ITKIDCLGNVLEFS 914

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/913 (39%), Positives = 543/913 (59%), Gaps = 37/913 (4%)

Query: 37  LELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFD----TVTSSGSF 92
           +E +   FL R KGLE   E+K++ +I+ +    + + Y+VPS+ W+     ++T     
Sbjct: 70  IESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTKPKIP 129

Query: 93  SNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVD 152
           S  LIN  +       F D  ++ +    F   QL    L++GDLVLL++   EL MCV 
Sbjct: 130 SYKLINLDI------HF-DTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVS 182

Query: 153 IPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKENN 212
           +P S  DPR+TFA  DG++ F+TK  V LRI   LP  I +    ++ ++   I   +N 
Sbjct: 183 LPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNF 242

Query: 213 AIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLV 272
           + +   LP+VARQ+ TS  P++IS++A + L +  KKL++LHR + + +    I F  LV
Sbjct: 243 SNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLV 302

Query: 273 HLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQQQSQL 332
            LVQ +DLNK   N+  +  N++++++ + K        +++ T +STYWA++QQQ+S L
Sbjct: 303 GLVQKLDLNKALDNK--NGVNYLADLVNSYKSADS--VPMNSATFVSTYWAIVQQQESNL 358

Query: 333 WGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAINKHNLEKINE 389
           WG I +++ALL P SV+++P  +  +Y  + I ++  D  ++I++F + +N+     I+ 
Sbjct: 359 WGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISS 418

Query: 390 KFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXXXXXXX 449
            +P  + +LK++  G ++ N  I T+ISK+FR+IE YK  +++RD CQ L NE       
Sbjct: 419 LYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMI 478

Query: 450 XXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDN----HAIIDQRRHDFKDLKVFCIDEKT 505
                       P  S   +++Q +Y LT ++N    ++ I+  R+DF DLKVFCID +T
Sbjct: 479 NPLLLNMDLAL-PASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSET 537

Query: 506 AHEIDDGVSV--LRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTY 563
           AHEIDDGVS+   +KDG  T L IHIADPASLFP    IE+   + ++LN+A +R+FTTY
Sbjct: 538 AHEIDDGVSIENHKKDGLYT-LHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTY 596

Query: 564 LPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD---FDKSS---CSILEDTFEIQLGKV 617
           LP+ V+PMLP+S C  SDLG  G+ T T++FSVD     KS+     I+ ++ +I+ G V
Sbjct: 597 LPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIV 656

Query: 618 NNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRID-NSAVIFGEGFNKG 676
           +NFPK  TY +VD+IL+ +       + DL  +  I+  LR+ RI  N+AVIFGEGFN+G
Sbjct: 657 SNFPK-ATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRG 715

Query: 677 AVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKG 736
            V L   K+ GE + +V+F D   TPS ++VSE MILAN+L G++F  +KI  +++ YK 
Sbjct: 716 LVTLNTNKE-GELT-EVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQ 773

Query: 737 LNMKPKASSQFKKILNVNKKRL-PXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVT 795
           L +   A  Q+  ++   KK + P                       HEMIG +QY TVT
Sbjct: 774 LPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVT 833

Query: 796 SPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           SPLRRFPDLINH Q+HR+L  +PLCFSQ ++D ++W +  R  IL+  SR  + YWTL Y
Sbjct: 834 SPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNY 893

Query: 856 LNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCK 915
           L   ++ NP   +DVM+ SV +NG   C+ P LS+A GTLKL PS    P IG+ +K CK
Sbjct: 894 LKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCK 953

Query: 916 IANIDCLGNSLEF 928
           I  IDCL   LE 
Sbjct: 954 ILKIDCLEGILEL 966

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/917 (39%), Positives = 540/917 (58%), Gaps = 43/917 (4%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSG----- 90
           ++E +   FL+RTKGLE   E+K++ +I+ +    + + YI PS+ W+     S      
Sbjct: 69  DIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTKPKI 128

Query: 91  SFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMC 150
           SF   + ++  +  K K    +         F   QL +  L++GDLVLL+    EL MC
Sbjct: 129 SFHKLINSDVQLDTKLKDLDPM--------EFQPAQLMENPLNVGDLVLLKVKPNELAMC 180

Query: 151 VDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKE 210
           V +P S  DPR+TF   DGT+ F+TK  V LRI + LP  + +    +  ++   I   +
Sbjct: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240

Query: 211 NNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLK 270
           N + +   LP+V RQ+ TS  P++IS++A + L +  KKL++LHR + + +    I F  
Sbjct: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 271 LVHLVQNVDLNKLARNRADHDANHISNIIRN--TKDDIQYMTKIDAITLLSTYWAVIQQQ 328
           LV LVQ +DLNK    +  +  +++++++ N  T D++     I++ T +STYWA++QQQ
Sbjct: 301 LVGLVQKLDLNKALDGK--YGIDYLTDLVNNYHTADNV----AINSPTFVSTYWAILQQQ 354

Query: 329 QSQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAINKHNLE 385
           +S LWG+I +++ALL PISV+++P  +  +Y  + I ++  +  + +N F + +N+    
Sbjct: 355 ESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYR 414

Query: 386 KINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXXX 445
            I+  +P  + +LK++  G ++ N  I T+ISK+FR+I  YK+ +++RD CQ L NE   
Sbjct: 415 DISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVP 474

Query: 446 XXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDN----HAIIDQRRHDFKDLKVFCI 501
                           P  S    ++Q +Y LT +++    ++  D  R+DF DL+VFCI
Sbjct: 475 NSLSNPLLLNMDLAL-PSSSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCI 533

Query: 502 DEKTAHEIDDGVSVLR--KDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRA 559
           D  TAHEIDDGVSV    KDG  T L IHIADP S+FP    I++   S +ILNIAF+R+
Sbjct: 534 DSDTAHEIDDGVSVENHGKDGMYT-LHIHIADPTSMFPESTAIDSVGISTDILNIAFKRS 592

Query: 560 FTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD------KSSCSILEDTFEIQ 613
           FTTYLP+ V+PMLP++ C  SDLG  GK T TI+FSVD          S  I+ D+F I+
Sbjct: 593 FTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIR 652

Query: 614 LGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRID-NSAVIFGEG 672
            G V+NFPK  TY +VDKIL++     + ++ DL  +  I+  LR+ RI  N+AVIFGEG
Sbjct: 653 KGFVSNFPK-ATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEG 711

Query: 673 FNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYK 732
           FNKG V L     +GE + +V+F + E TPS ++VSE MILAN+L G+YF  + I  +++
Sbjct: 712 FNKGMVTL-NANAEGELT-EVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFR 769

Query: 733 TYKGLNMKPKASSQFKKILNVNKKRL-PXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQY 791
            YK L +   A  Q+  ++   KK L P                       HEMIG  QY
Sbjct: 770 CYKQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQY 829

Query: 792 ATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYW 851
            TVTSPLRRFPDLINH Q+HR+L  +PLCF+Q ++D ++W +  R  IL+  SR  + YW
Sbjct: 830 LTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYW 889

Query: 852 TLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEII 911
           TL YL +  + +P   +DVM+ SV +NG   C+ P LS+A GTLKL+P A   P IG+I+
Sbjct: 890 TLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIV 949

Query: 912 KNCKIANIDCLGNSLEF 928
           K+CKI+ IDCL   LE 
Sbjct: 950 KDCKISKIDCLEGMLEL 966

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/910 (37%), Positives = 525/910 (57%), Gaps = 41/910 (4%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSND 95
           ++E +  +FL RTK LE   E+K++ +I  +    F+  Y  PSK+WF+          +
Sbjct: 52  DIERINLQFLSRTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFE---------KN 102

Query: 96  LINETLISKKWKKFPDLPIKMNGD--YSFNALQLFDRSLDIGDLVLLRNSDKELLMCVDI 153
            +N T  S+K      +P K +    + + A  L  + LD+GDLVLL++   EL MC+D+
Sbjct: 103 WLNRTKFSRKM--LNAVPRKEDTKEVFQYKASALMAKPLDVGDLVLLKSHPSELSMCIDV 160

Query: 154 PMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLI-----KNKYEA-GLIN 207
           P S +DPR+ F   DG+L F ++  V +RI ++LP+ +     +     K+ +E  G I 
Sbjct: 161 PSSTKDPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEPIGTIK 220

Query: 208 RKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSIS 267
            + N  +    LPV+ARQ+ TS +   IS+ A   L V +KKLE+LHR + D      + 
Sbjct: 221 NQANETL---VLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVP 277

Query: 268 FLKLVHLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQ 327
           F  LV ++Q++D+ K   NR      +I ++I N++      + ID+   L+TYWA+  Q
Sbjct: 278 FFDLVMMIQSLDITKAISNRDGEP--YIRDVIENSRTG--STSTIDSSCALATYWAIEAQ 333

Query: 328 QQSQLWGDIQIHSALLFPISVSVLPF-NNVIYLNETIPRVATD--ENINKFTEAINKHNL 384
           Q++ L+GDIQI  ALL P+SV +LPF +  ++ +E   ++ ++  E I +F++  NK   
Sbjct: 334 QKNHLFGDIQISGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANKGKY 393

Query: 385 EKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXX 444
            ++  +FP  + +LK Y  G  + +E I ++I+ +FR+I+ +K+ +++RD C+KL +   
Sbjct: 394 TELTTRFPHIIQVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLSRTL 453

Query: 445 XXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCIDEK 504
                            P+ S  +RT+Q +Y L++  + A   + RHDFK L+V+CID +
Sbjct: 454 PQGTVENPIYANFTLGLPDSSARSRTQQQVYDLSKPAS-AQSTENRHDFKHLRVYCIDSE 512

Query: 505 TAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYL 564
            AHEIDDG+S+         L IHIADPASLFP   + E +  +DE+L +A  R FTTYL
Sbjct: 513 EAHEIDDGISIEDCGNGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAERCFTTYL 572

Query: 565 PEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDF--DKSSCSILEDTFEIQLGKVNNFPK 622
           P+ V PMLP++F T  DLG+ GK T TITFSVD      +  I  D+++I+LG V+NFPK
Sbjct: 573 PDVVSPMLPQTFTTVCDLGHQGKKTKTITFSVDVLVKDGAIKIFFDSYKIRLGLVSNFPK 632

Query: 623 NTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRID-NSAVIFGEGFNKGAVNLI 681
             TY+ VD+ L+       +I  DL+ M  IA  LR+ RI  + A++FG GFN+G V + 
Sbjct: 633 -VTYETVDRYLSEPKNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAVS 691

Query: 682 EKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMKP 741
              Q+      ++F D + + S ++VSEFMILANSLAG++F   +IP I++TY+ L ++ 
Sbjct: 692 PVDQE------ISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRG 745

Query: 742 KASSQFKKIL-NVNKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRR 800
           +A  +++++  +V K  LP                       H MIG  QY TVTSPLRR
Sbjct: 746 QADQEYERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRR 805

Query: 801 FPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKI 860
           FPD+INH Q+HR L N PLCF+++ L +M+WH+  RD  L+  S     YWTL+Y+   I
Sbjct: 806 FPDIINHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLI 865

Query: 861 EGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCKIANID 920
              P  RFDV + SV +     C+L     A G LKLKPSAT IP +G+ +K CK++ ID
Sbjct: 866 RDTPHQRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKID 925

Query: 921 CLGNSLEFAI 930
           CL + LE  +
Sbjct: 926 CLDSLLELEL 935

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/927 (37%), Positives = 520/927 (56%), Gaps = 45/927 (4%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWF-DTVTSSGSFSN 94
           NLE +   F    K LE   EIK++ +++  S   + + Y  PSK+WF   V+ + SF +
Sbjct: 26  NLEKI---FFSHAKDLEPEVEIKQLSQVRQDSDNRYYHRYFTPSKIWFTQNVSRTQSFKH 82

Query: 95  DLINETLISKKWKKFPDLPIKM--NGDYSF--NALQLFDRSLDIGDLVLLRNSDKELLMC 150
               +   S      P L  ++   G ++F  +   L +  L IGDLVLLR++  +L MC
Sbjct: 83  FFNLDPQRSSDKYILPTLNERLYDKGSHTFYLSPSDLMNTPLKIGDLVLLRSNPTQLSMC 142

Query: 151 VDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKE 210
           VD+P  I DPR+TFA  DG L F+ +  + LRI +   + +     ++ K+    I   +
Sbjct: 143 VDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSCHKQELDGLVQLERKHSYEPIGVVK 202

Query: 211 NNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLK 270
           N+      LP++ARQ+ TS +P EI++ A   + +  KKLE+LHR++        IS   
Sbjct: 203 NSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIVSKKLELLHRFLQRSTGPWQISIFT 262

Query: 271 LVHLVQNVDLNKLARNRADHDANHISNIIRNTKDD------------IQYMTKIDAITLL 318
           L  LVQN+DL +    +     +++S++ +    D            +    KIDA   L
Sbjct: 263 LCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDSNLYCLGEQNLHVNPPNKIDASYFL 322

Query: 319 STYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDEN---INKF 375
           STYW++++QQ+ Q+WG IQ H  +L PISV+VLP N+     E +      +N   +++F
Sbjct: 323 STYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLNSEHLYYENVVSTLKQDNYRMLDEF 382

Query: 376 TEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDN 435
            E +NK N + I  +FP  + +LK Y  G +  N  + T++SK+FR++ TYK ++ +RD 
Sbjct: 383 AELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAMITLVSKIFRKLHTYKERDTTRDM 442

Query: 436 CQKLYNEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYS-----LTEVDNHAIIDQRR 490
           C +L  +                   P  S  +  EQ++Y      LTE D++      R
Sbjct: 443 CHELLTQISPDKLINPLLLNKDLGL-PMASQRSALEQVVYDISKPPLTEDDSYV-----R 496

Query: 491 HDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDE 550
           HDF D+ V+CID +TAHEIDDG+S+        RL IHIADPAS F      E     D+
Sbjct: 497 HDFGDMPVYCIDSETAHEIDDGISIETLSEKKYRLHIHIADPASSFAKSTDPE---ARDD 553

Query: 551 ILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD--FDKSSCSILED 608
           +L+IAF+R+FTTYLP+ VLPMLP+S+C  +DLG  G  T T++FS+D  F + +  +L+D
Sbjct: 554 VLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTLSFSIDIYFHQGTLRLLDD 613

Query: 609 TFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS-AV 667
           TF+++LG V+ FP+  TY++VD +L    K+  +   DL+ M  +A  LR  R+ N  A+
Sbjct: 614 TFKMRLGLVSRFPR-VTYEKVDILLQYPEKQPKEAS-DLKLMYEVAKSLRAKRVKNQDAI 671

Query: 668 IFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKI 727
           IFGEGFNKG V L    + GE + K++F+D   + S ++VSE MILAN+L G YFK +KI
Sbjct: 672 IFGEGFNKGLVKL-SPDETGELT-KISFEDQVESKSTVLVSEMMILANTLTGGYFKKNKI 729

Query: 728 PAIYKTYKGLNMKPKASSQFKKILNVNKK-RLPXXXXXXXXXXXXXXXXXXXXXXXHEMI 786
           P +++ Y  L +K +A  ++ K+  + K  + P                       HEMI
Sbjct: 730 PGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISSLLNSSFYTGKPKKHEMI 789

Query: 787 GTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRK 846
           G  +Y TVTSPLRRFPD+INH Q+HR+L   PLCFSQ+++D + WH+  RD +L++ +R 
Sbjct: 790 GASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGITWHIQSRDVVLKNAARM 849

Query: 847 FNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPA 906
              YWTL++L  ++E    +RF VMV SV   G V C  P L+ A GTL L P  T  PA
Sbjct: 850 SATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLNAARGTLNLDPKHTPYPA 909

Query: 907 IGEIIKNCKIANIDCLGNSLEFAIDEN 933
           IG++I  CK+  +DCL   +E  I E+
Sbjct: 910 IGDLIHKCKLTKLDCLDGVIELEIFES 936

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/909 (37%), Positives = 507/909 (55%), Gaps = 46/909 (5%)

Query: 37  LELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFD--------TVTS 88
           ++L+   FL RT GLE   EIKE+ +I+      +    I PSK W++         +  
Sbjct: 47  IKLINKLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTKILG 106

Query: 89  SGSFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELL 148
              FS +LIN           P+   K N   +F+  +L +  L +GD+VLL+++  EL 
Sbjct: 107 MERFSKNLINGAK--------PNFN-KRNEGITFHTQELLESPLKVGDIVLLKSNATELS 157

Query: 149 MCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILN---HDLIKNKYEAGL 205
           MCV +P S +DPR+TFA   G L+FST+ ++ LRI  ++P  I N    ++       G+
Sbjct: 158 MCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGV 217

Query: 206 INRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSS 265
           I    N    LP+   V RQ  TS  P  +S IA  +L + +KKLEVLHR++ + +    
Sbjct: 218 IKSSINETFILPT---VTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQ 274

Query: 266 ISFLKLVHLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVI 325
           I F +LVHLV  +D++        +D  ++  +I N+K+D      +DA   LSTYWA+I
Sbjct: 275 IPFFQLVHLVDTIDMSSC------NDRKYMKTLIDNSKND--SYNNLDASRCLSTYWAII 326

Query: 326 QQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDENINKF---TEAINKH 382
           +QQ++ +WGDIQ +S  + PISV+V P     + N+ +      ++++K    T  +N+ 
Sbjct: 327 EQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEK 386

Query: 383 NLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNE 442
           N   I EK+P+F++MLK+Y +G    N ++  +IS   R++  YK+ ++S+  C KL  E
Sbjct: 387 NYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQE 446

Query: 443 XXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCID 502
                                 S   ++ + +Y+L      A  D  R DF +L+V+CID
Sbjct: 447 IDPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYALCGPQISA--DADRVDFGNLRVYCID 504

Query: 503 EKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTT 562
            +TAHEIDDG+S++ K   I  L IHIADP+ LF   + I+    +D++  +A  ++FTT
Sbjct: 505 SETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQG-PLNDDVFKLAMEKSFTT 563

Query: 563 YLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD---FDKSSCSILEDTFEIQLGKVNN 619
           YLP+ V P+LP ++   +DLG  G++TN +TF+V+       +  +L DTF+I+L K+ N
Sbjct: 564 YLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRN 623

Query: 620 FPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS-AVIFGEGFNKGAV 678
           FPK  TY  V+KIL SS      +++DL ++  IA  LR  R+ N  AV+FGEGFNKG +
Sbjct: 624 FPK-VTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMI 682

Query: 679 NLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKGLN 738
              E+ Q   K+  V F D E TP+ ++VSE MIL N+L G +FK + IP IY++Y  L 
Sbjct: 683 EFFEEGQAEVKN--VKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLL 740

Query: 739 MKPKASSQFKKILNVNKKRL-PXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSP 797
           +  KA+ ++  + +  K  + P                       HEMIG  QY TVTSP
Sbjct: 741 LGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSP 800

Query: 798 LRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLN 857
           LRRFPDL+NHFQ+HR+L   P  F+ EKL  ++WH+  R  IL+  SR  N YWTL+YL 
Sbjct: 801 LRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQ 860

Query: 858 EKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCKIA 917
           + I  NP  RFDVM+ SV  NG V+C+ P +S+A G LKLK      P IG+ + NC+I 
Sbjct: 861 KAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTNCRIV 919

Query: 918 NIDCLGNSL 926
            ++ L   L
Sbjct: 920 KLESLDGIL 928

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/911 (37%), Positives = 510/911 (55%), Gaps = 51/911 (5%)

Query: 44  FLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINETLIS 103
           +L RTKGLE   EI+++ +I +     +   Y+ PS+ WF     +     D     L  
Sbjct: 28  YLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKADWKASDHGEDKATRLLRP 87

Query: 104 KKWKKFPDLPIKMNGDY--------------SFNALQLFDRSLDIGDLVLLRNSDKELLM 149
           + + KF      +N D+              SF+  +L   SL++GD+VLL+    EL M
Sbjct: 88  EVFDKF-----IINSDFHRGNMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTM 142

Query: 150 CVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNK--YEAGLIN 207
           CV++P S  DPR+TFAK DGTLV++ K +V LRI   LP+ +  + L+K +  +    I 
Sbjct: 143 CVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEV--NQLLKRESNHPYQKIG 200

Query: 208 RKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSIS 267
             +N++ +   LPV+ RQ+  S   +  ++ A   L + LKKLE++HRY+ D   +  ++
Sbjct: 201 TIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVN 260

Query: 268 FLKLVHLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQ 327
           F+ LV +++N+++ K A +  + DA ++  +I  +   +     ID  TLL+TYW V +Q
Sbjct: 261 FMSLVRIIKNLNI-KEATDAINGDA-YVRKVIDESMSVVN--KSIDPTTLLATYWGVREQ 316

Query: 328 QQSQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAINKHNL 384
           QQ+ LWG +  ++ALL P +V+VLP     ++  E I R+ ++  + I  F + +N  + 
Sbjct: 317 QQNNLWGSVYTNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDY 376

Query: 385 EKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXX 444
             I +++     +L +Y  G    N  +TTIISK+FR I+ Y++++++R  C KL  E  
Sbjct: 377 HSIAKRYDYIRTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEIS 436

Query: 445 XXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCIDEK 504
                            P+ SG +  EQ +Y         + D  R+DF D+ VFCID +
Sbjct: 437 PQSNSSNFILGNWDLNIPKSSGISSVEQKLYDTAMPT--IVSDTDRYDFGDMPVFCIDSE 494

Query: 505 TAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYL 564
            AHEIDDG+S+   DG  +R+ IHIADPA LFP       +  SD++L ++ +RAFTTYL
Sbjct: 495 DAHEIDDGISIEELDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTTYL 554

Query: 565 PEFVLPMLPKSFCTKSDLGNTGKMTNTITFS---VDFDKSSCSILEDTFEIQLGKVNNFP 621
           P+ V+PMLPKSFC ++DLG   + T TI+FS   V+ +     +  DTF+++LG V+NFP
Sbjct: 555 PDLVVPMLPKSFCNRADLGKHDRKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFP 614

Query: 622 KNTTYKEVDKILNSSIKRENDI----ERDLREMRFIANHLRKCRI-DNSAVIFGEGFNKG 676
           K  TY +VD ILN     +N +    ++ L  +  +A  L   RI D++AV+FG+GFNKG
Sbjct: 615 K-VTYDKVDSILNGD---DNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKG 670

Query: 677 AVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKG 736
            V+L     DGE      F D   T S ++VSEFMIL N L   +F+ +KIP +Y+ Y G
Sbjct: 671 LVSL-SPDDDGELCIPT-FYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNG 728

Query: 737 LNMKPKASSQFKKIL-NVNKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVT 795
           LN+  +A +QF+ +  N+   +LP                       H+MIG   Y TVT
Sbjct: 729 LNLGNQAKAQFELLKENIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVT 788

Query: 796 SPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           SP+RR PDLINH QLHR+L   PLCF QE LD+ VW    R  IL+ + R  + YWTL++
Sbjct: 789 SPMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKH 848

Query: 856 LNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCK 915
           L    E +     DV+V SV +NG V+C+ P+ SYA GTLKL P+   IP IG+ I++CK
Sbjct: 849 L----EQSGTKTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCK 904

Query: 916 IANIDCLGNSL 926
           + +I  L   L
Sbjct: 905 VESIHPLDGIL 915

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/906 (36%), Positives = 510/906 (56%), Gaps = 38/906 (4%)

Query: 44  FLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTS---SGSFSNDLINET 100
           FL RTK LE   E+K+++ I+ +    +   Y+ P   WF          SFS  LIN  
Sbjct: 80  FLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQRSEQNILGKSFSRSLINAD 139

Query: 101 LISKKWKKFPD-LPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMSIED 159
                    P+ L IK      F+  +L  R L IGDLVLL++   +L MC+D+P S  D
Sbjct: 140 ---------PEALGIKNKRFLKFDPKELMSRPLQIGDLVLLKHQSPQLCMCIDVPSSTRD 190

Query: 160 PRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKENNAIKLPSL 219
           PR+TF   DGT++FST+  V +RI + LP   L    +K+ +E   +   +N   +   L
Sbjct: 191 PRYTFTTVDGTIIFSTRNKVLMRIPHHLPNVPLLMKEMKHGFEP--VGCVKNTTTETFIL 248

Query: 220 PVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLVHLVQNVD 279
           P+V RQ  TSP+  +IS+ A  ++   LKKLE+LHR++ D      + F+ LV +V+ +D
Sbjct: 249 PIVPRQQITSPISHQISKRAWEEMPFTLKKLELLHRHLQDARGPWQVPFMNLVSMVEKLD 308

Query: 280 LNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQQQSQLWGDIQIH 339
           + +LA + ++  A ++ ++IR    + Q   K+D+   LS Y A+  QQQS LWG+I   
Sbjct: 309 M-QLA-SASNTGAAYVEDLIRTCTFEPQ--AKLDSAIFLSVYCAIENQQQSHLWGNIHSS 364

Query: 340 SALLFPISVSVLPFNNVIYLNETIP---RVATDENINKFTEAINKHNLEKINEKFPDFLN 396
            ALL P+SV+V+P  +    + ++    +V   E ++KF   ++     +   ++P+ + 
Sbjct: 365 RALLSPVSVTVMPLRSQHLYHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVK 424

Query: 397 MLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXXXXXXXXXXXXXX 456
           +L++Y  G +Y +    +++SK+FR+I+ ++ ++++RD C +L  E              
Sbjct: 425 LLQDYAAGNFYNDATAISVVSKIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYN 484

Query: 457 XXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQR-RHDFKDLKVFCIDEKTAHEIDDGVSV 515
                P  S  + +EQ IY+L         D+  RHDF D+KV+CID +TAHEIDDGVS+
Sbjct: 485 LDLGLPSSSLRSSSEQDIYNLAHPVTFEGQDKNLRHDFGDMKVYCIDSETAHEIDDGVSI 544

Query: 516 LRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKS 575
                    L IHIADPAS F        +    EIL IA  ++FTTYLP+ + PMLP S
Sbjct: 545 ESHSDVKRTLHIHIADPASFF-RECQEGTHGIESEILQIALNKSFTTYLPDLMSPMLPGS 603

Query: 576 FCTKSDLGNTGKMTNTITFSVD---FDKSSCSILEDTFEIQLGKVNNFPKNTTYKEVDKI 632
           +   +DLG  G+   TITFSVD          +  ++F I+LG V+NFP+  TY  VD +
Sbjct: 604 YSKAADLGKQGQKAKTITFSVDGSWIKNGQFQLQPESFRIKLGLVSNFPQ-VTYNTVDSM 662

Query: 633 LNSSIKREN------DIERDLREMRFIANHLRKCRID-NSAVIFGEGFNKGAVNLIEKKQ 685
           L  + + +N      D +R+L+E+  I+ +LR  RI+   AV+FG  FNKG V L    +
Sbjct: 663 LAQASEVKNGSANLTDDQRNLKELYAISQNLRANRINTQQAVVFGSEFNKGQVAL-SPDE 721

Query: 686 DGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMKPKASS 745
           +G    KV+FKD   TPS+++VSE MILAN+L+G++FK++ +P +++ Y+ L + P+A +
Sbjct: 722 NGVLQ-KVSFKDQLETPSSVLVSEMMILANTLSGQFFKDNNLPGVFRCYQPLALGPQAQN 780

Query: 746 QFKKILN-VNKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDL 804
           +++ + + + + +                         HEMIG   Y TVTSPLRRFPD+
Sbjct: 781 EYELLKSKIKEGKSLTFKDICMISTILNSSFYSSDGYRHEMIGAPHYLTVTSPLRRFPDM 840

Query: 805 INHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEGNP 864
           INH Q+HR L   PLCF+++ +D  VWH+  RD+IL+  SR  N YWTL+YL + +E + 
Sbjct: 841 INHLQIHRLLKGLPLCFNKDDVDRFVWHIQSRDSILKDASRCSNTYWTLKYLKQLVENDK 900

Query: 865 LLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCKIANIDCLGN 924
             +F VM+ SV + G V C+LP  S A  TLKLKP+  + P IG+II+NC+I  ID L  
Sbjct: 901 NKKFSVMINSVPQVGFVRCVLPDYSSARATLKLKPNEISHPVIGDIIENCRITKIDALEG 960

Query: 925 SLEFAI 930
            LE  +
Sbjct: 961 LLEMEL 966

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/908 (37%), Positives = 499/908 (54%), Gaps = 39/908 (4%)

Query: 34  SFNLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFD---TVTSSG 90
           + ++E +   FL RTK LE   EIK++ +I+ +    F   Y  PSK WF     V  S 
Sbjct: 49  AVDIERINEMFLSRTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDNWVVEPST 108

Query: 91  SFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMC 150
           + +    ++  ++ K           N  Y+F   +     L +GDLVL      EL MC
Sbjct: 109 NTAGKSSSQNSMTGK-----------NKHYTFKLSEFISSVLQMGDLVLTTPYPNELAMC 157

Query: 151 VDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNI--LNHDLIKNKYE-AGLIN 207
           V +P S EDPR+TF    G + F TK  V LRI   LP+ +  L      + +E  G I 
Sbjct: 158 VGLPESAEDPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIK 217

Query: 208 RKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSIS 267
              +    LP L   ARQ+ TS LPS+I+++A + L   +K+LE+L RY+     T  + 
Sbjct: 218 GTRDVTYILPYL---ARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVP 274

Query: 268 FLKLVHLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQ 327
           F++LV  VQ     +L       +  +I ++    +  +     I A T L+TYWA+ +Q
Sbjct: 275 FVQLVDAVQ-----RLEEKGGPGEFEYIKSLFE--RPSLGSRRSIHAATYLATYWAIKEQ 327

Query: 328 QQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDENINKFTEAINKHNLEKI 387
           Q   +WG I ++ A L PIS SV+P  ++   ++ +      +++NK T+ IN  + E +
Sbjct: 328 QNFNIWGKIHVNKAFLAPISTSVVPAASLRSFHDELINDPKRKHVNKITDLINTKDYELV 387

Query: 388 NEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXXXXX 447
            E++P+FL +L ++  G +  N ++ T+IS++FR ++ Y+   ++RD C  L  E     
Sbjct: 388 RERYPEFLQLLSDFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDN 447

Query: 448 XXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCIDEKTAH 507
                          + S  +  ++ +YS+ + D       +RHDF D+ V+CID +TAH
Sbjct: 448 FCENPILSNSDLALAQSSERSALQKCVYSVVQPDIQLDTKTKRHDFLDMPVYCIDSETAH 507

Query: 508 EIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYLPEF 567
           EIDDGVS+ +       L +HIADPAS FP   T E+   SD +L IAF ++FTTYLP+ 
Sbjct: 508 EIDDGVSIEKNGKGSYTLHVHIADPASFFPESYT-ESTKLSD-VLKIAFDKSFTTYLPDV 565

Query: 568 VLPMLPKSFCTKSDLGNTGKMTNTITFSVDF---DKSSCSILEDTFEIQLGKVNNFPKNT 624
           V  MLP+SFC  +DLG   K T TITFSV     +     I  DTF  +LG V+NFPK  
Sbjct: 566 VEAMLPESFCRAADLGKQDKKTRTITFSVRVKMDEHGGLHIQSDTFRARLGLVSNFPK-V 624

Query: 625 TYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRID-NSAVIFGEGFNKGAVNLIEK 683
           TY  VD +LN S    + + +DL  +  IA+ LR  R+  N AV+FGEGFN G V LI  
Sbjct: 625 TYNIVDSVLNDS-SSNSPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLI-- 681

Query: 684 KQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMKPKA 743
           +    K   + F+++  TPS ++VSE MILAN+L+G +F+ +KIP I++ Y  L +  KA
Sbjct: 682 RDSANKVKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKA 741

Query: 744 SSQFKKIL-NVNKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFP 802
            S ++ I  NV + + P                       H+MIG  QY TVTSPLRR+P
Sbjct: 742 LSDYRSIQDNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYP 801

Query: 803 DLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEG 862
           DLINH QLH++L N+PL FSQ+ +D+M+W +  R  IL+  S   + YWTL YL ++IE 
Sbjct: 802 DLINHIQLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEK 861

Query: 863 NPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCKIANIDCL 922
           +   RFDVMV S  ++G V+C+ P  SYA G LKLK      P IG+I+K+C+I +IDCL
Sbjct: 862 DSSARFDVMVTSFPQDGMVNCLFPNHSYARGKLKLKVDRLP-PQIGDIVKDCQITSIDCL 920

Query: 923 GNSLEFAI 930
            ++L+  +
Sbjct: 921 DSNLQLVM 928

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/987 (37%), Positives = 530/987 (53%), Gaps = 104/987 (10%)

Query: 36   NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTV-----TSSG 90
            ++E +K  FL R K L+    IKE+ EI N+    F   +I+PS  WF+++     T + 
Sbjct: 54   DIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITP 113

Query: 91   SFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMC 150
             FS  ++N T     W +   +    N  ++ ++L+L    L+IGDL+LL +S   LLMC
Sbjct: 114  KFSKYMLNSTFSFDAWYQ-KIISNSFNLTFTKHSLEL--DPLNIGDLILLPDS-SNLLMC 169

Query: 151  VDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAG---LIN 207
            VDIP + +DPR+TFA  DG L F T+ N+ LRI N LP  +++  L+  +++ G   +  
Sbjct: 170  VDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGT 229

Query: 208  RKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSIS 267
             K    IK+  LP++ARQ+   P+ + +++ A   L++ LKKLE++HR I +G     IS
Sbjct: 230  IKNTQNIKI-LLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQIS 288

Query: 268  FLKLVHLVQNVDLNKLARNRA-DHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQ 326
            F KL+ L+  ++LN    ++  D + N    +  N  + +   T+IDA T L+TYWA+  
Sbjct: 289  FFKLIKLIDILNLNDFDNSKKFDINLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRL 348

Query: 327  QQQSQLWGDIQIHSALLFPISVSVLPF--------------NNVIYLNETIPRVATDENI 372
            QQQ  LWG IQ++ ALL PISV+VLP               NN I   +++     D+  
Sbjct: 349  QQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDIN 408

Query: 373  NKFTEAINKHNL------------------EKINEKFPDFLNMLKEYGNGCYYGNEKITT 414
            N+ T     +N                   + I++ +P+F+N+ + Y  G +  N KI  
Sbjct: 409  NQSTTNTTNNNNNTTIITTTTTNNNKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIA 468

Query: 415  IISKLFRRIETYKNKEL---------------------------------SRDNCQKLY- 440
            +ISK+ RR+  +K+ +L                                 S+D+ Q    
Sbjct: 469  LISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSK 528

Query: 441  ---NEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLK 497
               N                    P  S  T+ + L Y+L E        +  HDF DLK
Sbjct: 529  DTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLK 588

Query: 498  VFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFR 557
            V+CID +TAHEIDDG+S+ + + N+  L IHIADP+S+F  H   E NS    +LN+A  
Sbjct: 589  VYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNH---EKNSDIQNLLNMALS 645

Query: 558  RAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV----DFDKSSCSILEDTFEIQ 613
            ++FTTYLP+ V PMLPKSFC  SDLG   + T TI+FSV    D +  S  IL +TF+++
Sbjct: 646  KSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVR 705

Query: 614  LGKVNNFPKNTTYKEVDKILNSSIKRE------NDIERDLREMRFIANHLRKCRIDNS-A 666
            LG V+ FP NTTY  VD+IL++S +        +DI+ DLR +  I+N L+K RI N  A
Sbjct: 706  LGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNA 765

Query: 667  VIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHK 726
            VIFGEGFNKG V L   K  G     +NFKD   T S  +V+E MILANSLA + FK +K
Sbjct: 766  VIFGEGFNKGLVTLSCSKDGGPV---INFKDQNDTKSVTLVTEMMILANSLAARLFKENK 822

Query: 727  IPAIYKTYKGLNMKPKASSQFKKILNVNKK---RLPXXXXXXXXXXXXXXXXXXXXXXXH 783
            IP I++ Y  L++  KA  +F  IL  N K    LP                       H
Sbjct: 823  IPGIFRCYHELHLAKKAQLEFD-ILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPH 881

Query: 784  EMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHY 843
            +MIG   Y TVTSPLRRFPDL+NH Q+  ++  +P  +S   + +M+  +  RD I+R  
Sbjct: 882  QMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIREL 941

Query: 844  SRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATT 903
            S K NKY+ L YL E+I+ NP   FDV++ SVS  G +HCILP  S + G LKLKP    
Sbjct: 942  SGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDF 1001

Query: 904  IPAIGEIIKNCKIANIDCLGNSLEFAI 930
             P+IG++I+NCKI  ID L   L+F++
Sbjct: 1002 TPSIGDVIRNCKIDKIDALDGRLDFSM 1028

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/922 (36%), Positives = 502/922 (54%), Gaps = 52/922 (5%)

Query: 42  SKFL-ERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINET 100
           +KF+ +R   LE   EIK++  IQ      F N++ +PSK W      + +   D +N  
Sbjct: 45  AKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMD 104

Query: 101 LISKKWKKFPDLPIKM--------NGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVD 152
           L S   K+  D+   +        +G +  +   L D SL IGDLVLLR+   +L MCV+
Sbjct: 105 LTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVE 164

Query: 153 IPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKENN 212
           +P  + +P + FA  DG + F  +  + LRI  +  K    + LIK   E   +N +   
Sbjct: 165 VPTEVTNPSYAFATIDGHIRFGERNMILLRI-PSFHKAAAKY-LIKE--EVPFLNTRIGA 220

Query: 213 AIKLPS----LPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISF 268
               P     L +VARQ+ TS +P EI++ A   + V  KKLE+LHR++        +S 
Sbjct: 221 VKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSI 280

Query: 269 LKLVHLVQNVDLNKLARNRADHDANHISNIIRNT---KD-------DIQYMTKIDAITLL 318
            KL  LV  +D++K    ++    ++I  I++     +D         + +  IDA   L
Sbjct: 281 FKLCELVALLDIDKC---QSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFL 337

Query: 319 STYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPF-NNVIYLNETIPRVATD--ENINKF 375
           +TYW+++QQQ+  LWG I  H A+L PISV+VLP  ++ +Y  E +  +  D    +  F
Sbjct: 338 ATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELKKDNYAALESF 397

Query: 376 TEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDN 435
            + IN         ++P    +L++Y  G ++ N  I TI+SKLFR+++ Y+N +++RD 
Sbjct: 398 AKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDL 457

Query: 436 CQKLYNEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKD 495
           C +   E                   P  S     EQ IY L   + +  I  RRHDF  
Sbjct: 458 CHEFLQELTCESIPNPQLLSNEIRS-PSTSERAVLEQKIYDLALPNQNDDIS-RRHDFGK 515

Query: 496 LKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIA 555
           + V+CID +TAHEIDDG+S+     N   L IHIADP SLF   +  +  S S EI NIA
Sbjct: 516 MNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLF---SNSQEGSFSKEIWNIA 572

Query: 556 FRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD--KSSCSILEDTFEIQ 613
            +R FT+YLP+ V PMLPKS+    DLG  G  + T++FSVD    K++  ILE+TF ++
Sbjct: 573 LQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNNVEILEETFSVK 632

Query: 614 LGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRF---IANHLRKCRI-DNSAVIF 669
           LG V+ FP+  TYK VD+IL      E D  +  +E+R    IA  LR  R+ + +A+IF
Sbjct: 633 LGLVSQFPR-VTYKVVDRILG----LEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIF 687

Query: 670 GEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPA 729
           GEGFN+G V L+  + +   +  ++F+D E T S ++VSE MILAN++AGK+F++  IP 
Sbjct: 688 GEGFNRGLVKLMPTQTNTATA--LSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPG 745

Query: 730 IYKTYKGLNMKPKASSQFKKILNV-NKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGT 788
           +++ YKGL +K  A   +  + ++ + ++ P                       HEMIG 
Sbjct: 746 VFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGA 805

Query: 789 DQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFN 848
             Y  VTSPLRRF DL+NH+QLH YL   PL FS++++ ++ WH+  RD +LR  +R   
Sbjct: 806 PAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSA 865

Query: 849 KYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIG 908
            +WTL +L  + E NP  R  VMV SV   G V C+LP+LS A G LKLKP A++  AIG
Sbjct: 866 SFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIG 925

Query: 909 EIIKNCKIANIDCLGNSLEFAI 930
           +++ NC+I  +DCL + +E  +
Sbjct: 926 DVVHNCRITRLDCLDSIMELEM 947

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  540 bits (1391), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 330/920 (35%), Positives = 493/920 (53%), Gaps = 55/920 (5%)

Query: 46  ERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWF-DTVTSSGSFSNDLINETLISK 104
           +R   LE   EIK++ EIQ+     +  +Y++PSK W  D  T  G   N L N  L+S 
Sbjct: 36  KRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYL-NMDLMSL 94

Query: 105 KWKKFPDLPI--------KMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMS 156
             K+  D+          K +  +     +L    L IGDLVLLR++  +L  CV++P  
Sbjct: 95  SEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTD 154

Query: 157 IEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNK--YEAGLINRKENNAI 214
           + +P + FA  DG + ++ +  + LRI +   ++   H LI+ +  Y    I   +++  
Sbjct: 155 VMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSA--HHLIREEKPYLDARIGTVKDSPE 212

Query: 215 KLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLVHL 274
           K   LP++ARQ+ TS  P +I++ A   + +  +KLE+LHR++        +S  KL  +
Sbjct: 213 KTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQM 272

Query: 275 VQNVDLNKLARNRADH---------DANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVI 325
              +DL K   + A+            N   N  +    ++ Y+  +DA   L+T+WA+ 
Sbjct: 273 AVMLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALE 332

Query: 326 QQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDEN---INKFTEAINKH 382
           QQQ++ LWG  Q H A+L P+SV+VLP  +     ET+ +    +N   I KF   +N  
Sbjct: 333 QQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLKKDNHRLITKFAGLVNSG 392

Query: 383 NLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNE 442
           N    + + P F  +LK+Y  G ++ N  + T++SKLFR I+ +K ++++RD C +L  E
Sbjct: 393 NFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDVFKGRDITRDLCHELM-E 451

Query: 443 XXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCID 502
                              P  S  T  E+ IY + +      I  R  DF  + V+CID
Sbjct: 452 KLSHRNTLNPLLLSDDLALPSSSANTALEEKIYEMAQPSTKEDIPAR-FDFSSMNVYCID 510

Query: 503 EKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNST--SDEILNIAFRRAF 560
            ++AHEIDDG+S+     N   L IHIADP SLF      E+  T  +DE+ NIA+RR F
Sbjct: 511 SESAHEIDDGISIEPLGRNAFTLHIHIADPVSLF-----TEDGGTKFNDEVWNIAYRRGF 565

Query: 561 TTYLPEFVLPMLPKSFCTKSDLG-NTGKMTNTITFSVD--FDKSSCSILEDTFEIQLGKV 617
           TTYLP+ VLPMLP+SFC    LG N GK + T++FSV+         I E++F+++LG  
Sbjct: 566 TTYLPDLVLPMLPQSFCLAGSLGINNGK-SKTVSFSVNIKMHDGGLRIDEESFKVRLGYA 624

Query: 618 NNFPKNTTYKEVDKILNSSIKRENDIERDLREMRF---IANHLRKCRI-DNSAVIFGEGF 673
             FPK  TY  VD+IL    ++ ND  ++ +E+R    I+  L+  RI +  A+IFGEGF
Sbjct: 625 TKFPK-VTYDSVDRIL----QQNNDKTQEAKELRTLYQISLLLQSKRINEQRAIIFGEGF 679

Query: 674 NKGAVNLIEKKQDGEKSY--KVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIY 731
           N+G V L E    GE     K+ F+D   TPS ++VSE MILAN+LAG+YF+ +KIP ++
Sbjct: 680 NRGLVKLNE----GESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIPGVF 735

Query: 732 KTYKGLNMKPKASSQFKKILNVNKK-RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQ 790
           + YK L +K  A   ++ +  + +   LP                       H MIG   
Sbjct: 736 RCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYTGTPDRHSMIGAPA 795

Query: 791 YATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKY 850
           Y TVTSPLRRFPDLINH Q+ ++LT  PL FS+  +DEM+WHL  RD ++R  +R    +
Sbjct: 796 YLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARDSASF 855

Query: 851 WTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEI 910
           WTL++L    + +P  +  VMV S+   G V C+LP LS A G LKLKP  +   AIG++
Sbjct: 856 WTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVAIGDL 915

Query: 911 IKNCKIANIDCLGNSLEFAI 930
           + NC I  +DCL   +E  +
Sbjct: 916 MHNCVITKLDCLDAVMELKM 935

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  536 bits (1382), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 332/913 (36%), Positives = 507/913 (55%), Gaps = 40/913 (4%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTV----TSSGS 91
           +++ ++  FL+RT  LE   ++K + +I  +    F + YI PSK W++T+     +   
Sbjct: 46  DIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKFWYETLWLNNDTKPP 105

Query: 92  FSNDLINETL---ISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELL 148
           F+   +N  L   ISKK          +N DY+     L    L I DL +LR +  EL 
Sbjct: 106 FNKLFLNNPLPDSISKKQL--------LNFDYN----DLAKTPLKIRDLAILRATPSELS 153

Query: 149 MCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINR 208
           MCV +P S+EDPR+TFA   G L F  +  + +RI   +PK I    L + ++E   I  
Sbjct: 154 MCVQLPESVEDPRYTFASRSGKLYFVYRSMIKIRIPYQVPKGIQGLILKELQHEFSPIGT 213

Query: 209 KENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISF 268
            ++N      LP +AR + +    S+I++ A+    + +KKLE+LHRY+ +    +SI F
Sbjct: 214 LKSNTKDTFILPYLARNLLSRTGLSDINKAASYQRPIVMKKLELLHRYLQNDKGPTSIPF 273

Query: 269 LKLVHLVQNVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQQ 328
             L++LV  +DL++    +A +D  +I N+I+   D    M   +A   ++ YW++++  
Sbjct: 274 THLINLVNKLDLSQALHLQAGND--YIINLIKEANDPPSIM---NASLTIAVYWSLVELS 328

Query: 329 QSQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAINKHNLE 385
           ++ LW  I  +SA LFP +V+VLP  +  ++  E I  +  +  + +NKF+  +N  N +
Sbjct: 329 ETFLWDGINRNSASLFPTTVTVLPLLSYRVHYTELIEDLERNNYKQLNKFSNLVNDKNYQ 388

Query: 386 KINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNEXXX 445
           +I + F   +N+L+EY  G    N KITT+ISKLFR I+ Y+  +++RD C +L  +   
Sbjct: 389 EIEQSFSKIINLLQEYTAGNLQNNPKITTLISKLFRGIKEYQRCDITRDLCNELLMKFPS 448

Query: 446 XXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLTEVDNHAIID--QRRHDFKDLKVFCIDE 503
                              S   + +Q++Y   + ++  I +  + R DF DL+V+CID 
Sbjct: 449 IKPNSNPLLKNHDLATRADSQHGQRQQILYDYVKPNDLLIQESLRDRFDFGDLRVYCIDS 508

Query: 504 KTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENN-STSDEILNIAFRRAFTT 562
           +TAHEIDDG+S+ +K      L IHIADPA  FP  N  +      D++L IA+  +FTT
Sbjct: 509 ETAHEIDDGISIEKKFNGKFTLHIHIADPAIFFPECNNEKGVLGLQDDVLKIAYENSFTT 568

Query: 563 YLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDF----DKSSCSILEDTFEIQLGKVN 618
           YLP+ V+PMLPKS+C  +DLG  GK T +I+FSVD     +KS+  I  DTF+I+LG V+
Sbjct: 569 YLPDTVVPMLPKSYCKMADLGINGKKTPSISFSVDVILNKEKSNLKICYDTFQIRLGLVS 628

Query: 619 NFPKNTTYKEVDKILNSSIKRENDI-ERDLREMRFIANHLRKCRI-DNSAVIFGEGFNKG 676
           NFPK  TY  VD IL+S +  E  + + DLR++  IA  LR  R  +N A+ FGEGFN+G
Sbjct: 629 NFPK-ATYDNVDDILSSEVNSEQKLLQDDLRQLSMIAGILRNKRTQENGAITFGEGFNRG 687

Query: 677 AVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKG 736
                E  +   +S  ++F D + T SN +V+E MILAN+L G+YFK +KI  +Y+ Y  
Sbjct: 688 TPKYSEDSE--TESDVISFVDQKNTKSNELVTELMILANTLCGRYFKENKIFGVYRCYND 745

Query: 737 LNMKPKASSQFKKILNVNKK-RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVT 795
           LN++PKA  Q+ K+    K  +LP                       H+MIG++QY TVT
Sbjct: 746 LNLEPKAKMQYNKLREECKNGKLPTLEDIVKVQSLLNSSYYSEHPSRHDMIGSEQYLTVT 805

Query: 796 SPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           SPLRRF DL++H QLH +L   PL F+Q+ +   V H+  R   LR  S + N   TL Y
Sbjct: 806 SPLRRFTDLVSHIQLHNHLKGHPLPFNQKAIRNFVPHIQSRADKLRKISTESNVCMTLSY 865

Query: 856 LNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNCK 915
           L   ++  P   FDV + SV   GR  C++P+ S+A G ++L PS    P +G+ + +CK
Sbjct: 866 LKNLLKTKPDTMFDVKITSVPSEGRARCLIPEYSFARGEIRLSPSLKVYPKVGDTVNSCK 925

Query: 916 IANIDCLGNSLEF 928
           +  I C+   LEF
Sbjct: 926 VVKISCVDGILEF 938

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  516 bits (1328), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 328/930 (35%), Positives = 516/930 (55%), Gaps = 58/930 (6%)

Query: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDT---------V 86
           +++L+++ FL+RT  LE    +K   +I  +    FN  Y+ PSK W+++         +
Sbjct: 53  DIQLIQANFLKRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYESNWEKLNEKRL 112

Query: 87  TSSGSFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKE 146
           T S     +LIN+     K+  + +L         FN ++     L IGD+VLL+ +  E
Sbjct: 113 TLS---IRELINKDPAEFKFNYYKNL--------KFN-IEDVTEPLKIGDIVLLKTNTSE 160

Query: 147 LLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLI 206
             MC+D+P S++DPR+TF    G L+F  +  + L+I   LP NI    + +  ++   I
Sbjct: 161 FSMCIDLPQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNIERLIIKEPAHKYNPI 220

Query: 207 NRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSI 266
              +++  +   +PV+ARQ+  + +P++IS+ A + L V +KKLE+LHRY+ D      I
Sbjct: 221 GTIKSSLDETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQQI 280

Query: 267 SFLKLVHLVQNVDLNKLARNRADHDANHISNIIR----NTKDDIQYMTKIDAITLLSTYW 322
            F KL+++++ ++L++       ++  +++ +++    N   D+  ++ +DA   LSTYW
Sbjct: 281 HFHKLINIIEALNLDRATDYEKGNE--YVNELLKQKYYNDYTDLS-LSSLDATVALSTYW 337

Query: 323 AVIQQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATD--ENINKFTEAIN 380
           A+I+QQ   LWG+I+ +S+ LFP +V++LPF++ +Y  + I  +  +     N+F+  IN
Sbjct: 338 AIIEQQDLFLWGEIKRNSSSLFPTTVTILPFSHHVYYTKLIKSLRKNNFRRTNEFSAFIN 397

Query: 381 KHNLE----KINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNC 436
           +HNL     +I  KFP+FL++LKEY  G    N KI TI+SK+FR +  +K +++++D  
Sbjct: 398 EHNLNTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKIITILSKIFRNLNDFKERDITKDLA 457

Query: 437 QKLYNEXXXXXXXXXX-XXXXXXXXXPEISGTTRTEQLIYSL---TEVDNHAIIDQRRHD 492
            +L  +                    P  SG    +  +Y L   T++++      +RH+
Sbjct: 458 YELLTKLIPTSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKIESGETT-TKRHN 516

Query: 493 FKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS--DE 550
           F DL V+CID +TAHEIDDG+S+ +K   I  L+  I        + ++ +   T   D+
Sbjct: 517 FNDLNVYCIDSETAHEIDDGISI-KKYLKIDLLYSFILLTLQFISMKDSNKEKKTGIDDD 575

Query: 551 ILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD---FDKS----SC 603
           IL IA+ R+FTTYLP+ V+PMLP  +C  SDLG + +   T+TFSVD   FD S    + 
Sbjct: 576 ILKIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDITIFDGSNNEETL 635

Query: 604 SILEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIK-RENDIERDLREMRFIANHLRKCRI 662
            IL DTF+IQ G V+NFPK  TY  VDKIL++S K  +  I  DLR++  IA  LRK RI
Sbjct: 636 KILYDTFKIQFGLVSNFPK-VTYDTVDKILDNSTKIPDTSITEDLRQLSRIAKLLRKYRI 694

Query: 663 -DNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKY 721
            +N+A++FGEGFN+G  +L +  +D     ++ F D + + SN +VSE MILAN+L GKY
Sbjct: 695 NENNAIVFGEGFNRGIPDL-QSTED-----EIIFTDQKNSDSNELVSEMMILANTLTGKY 748

Query: 722 FKNHKIPAIYKTYKGLNMKPKASSQFKKILNVNKKRLPXXXXXXXXXXXXXXXXXXXXXX 781
            K+HKIP IY+ Y  L++ P+A  +   + + N  RLP                      
Sbjct: 749 CKDHKIPVIYRCYSPLDIGPEAQQECIILRSKNIDRLPSNIDMAKMSSFLNSSYYSGTPS 808

Query: 782 XHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILR 841
            H M+G+D+YATVTSPLRRFPDL+NH QLH +L    L F+   +   +  +  R   L+
Sbjct: 809 RHSMLGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHVAHYLTTIQSRSDTLK 868

Query: 842 HYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSA 901
           +         TL Y+   I   P   FDV+V SV   G   C +    YA GT+KLK   
Sbjct: 869 NIGNAVYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIVGYEYARGTIKLKAEI 928

Query: 902 TTIPAIGEIIKNCKIANIDCLGNSLEFAID 931
             +P IG+II  CK+  I  +  +LE +++
Sbjct: 929 NPVPIIGDIITKCKVTKIFPIEGALELSME 958

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  479 bits (1234), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 309/937 (32%), Positives = 497/937 (53%), Gaps = 72/937 (7%)

Query: 44  FLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGS-----------F 92
           F  + K +    EIK     + +++M FN+ ++ PS  W+  V  S              
Sbjct: 55  FFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLL 114

Query: 93  SNDLINETLISK--KWKKFPDLPIKMNG---------DYSFNALQLFDRSLDIGDLVLLR 141
            ND+ + TL  +  KW    +  ++ N          ++ F+   +   +L  GD+ +L+
Sbjct: 115 RNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLK 174

Query: 142 NSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLR---ILNTLPKNILNHDLIK 198
           NS  ELL+CV  P    D RFTFA  DG +V++ K +V LR   I NT    IL  + + 
Sbjct: 175 NSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLH 234

Query: 199 NKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYIS 258
                G +   ++    +P+LP   R++  S +   I+  A + L +  KKLE++HRY+ 
Sbjct: 235 GYSPVGSVKNDKDVTFVIPTLP---RRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQ 291

Query: 259 DGVETSSISFLKLVHLVQNVDLN---------KLARNRADHDANHISNIIRNTKDDI--Q 307
            G     I  LKLV +  N++L+            ++    DA +    + N+  ++  +
Sbjct: 292 SGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYS---LANSHFELSSK 348

Query: 308 YMTKIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLP-------FNNVIYLN 360
              K++   LL+ YWA++ QQ +Q+WG++ +H  + FP +V+VLP       ++N+I+  
Sbjct: 349 VPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKL 408

Query: 361 ETIPRVATDENINKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLF 420
               R      IN+    IN+++L  +N+ FP  + +L++Y  G    N+ IT++IS LF
Sbjct: 409 ----RQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLF 464

Query: 421 RRIETYKNKELSRDNCQKLYNEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQLIYSLT-- 478
           R+++ YK   +SRD C  L  +                   P  +   + EQ IY L   
Sbjct: 465 RKLDEYKELNISRDVCFDLL-KRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVP 523

Query: 479 -EVDNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFP 537
            ++++ A I   R ++KDL  +CID   AHEIDD VS+    G   R++IH+ADPASLFP
Sbjct: 524 PKIEHSAEI---RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFP 580

Query: 538 LHNTIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD 597
             N  +  + +  +L+IA++RAFTTYLP+ V PMLP ++   SDLG  GK T  +TFSVD
Sbjct: 581 EANE-DGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVD 639

Query: 598 --FDKS-SCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNS-SIKRENDIERDLREMRFI 653
             F KS    +L+D+ +++L  ++   +  TY+ VD++L+  + K ++    DL+ + +I
Sbjct: 640 CTFSKSKGLCLLKDSLKVELSVLHKSTR-ITYEAVDELLDEPTTKPKSGKHEDLKTLFYI 698

Query: 654 ANHLRKCRI-DNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMI 712
           A  LR+ RI D  AV+F E  + G V+L     D  +  +V+FKD   T S I+VSE MI
Sbjct: 699 AKALRRQRIVDGGAVVF-ENSSTGIVSL--SPDDNSELVEVSFKDQIETKSTILVSELMI 755

Query: 713 LANSLAGKYFKNHKIPAIYKTYKGLNMKPKASSQFKKI-LNVNKKRLPXXXXXXXXXXXX 771
           LANSL   YF+ ++IP IY+ Y+ LN+   A+S  + +     + ++             
Sbjct: 756 LANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFL 815

Query: 772 XXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVW 831
                      H+M+GT  Y T+TSPLRRFPDL+NH QLHR L   PL + Q +LD MVW
Sbjct: 816 TSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVW 875

Query: 832 HLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYA 891
           H++ RD  L++ S    +YWTL++L ++IE      + + + S+++NG  HC++   ++A
Sbjct: 876 HILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFA 935

Query: 892 TGTLKLKPSATTIPAIGEIIKNCKIANIDCLGNSLEF 928
            G LK+  +    P +G+ I +C+I+NI CL   L+F
Sbjct: 936 VGQLKINLNKNP-PLVGDQISDCEISNIQCLDGILQF 971

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  448 bits (1153), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 287/826 (34%), Positives = 438/826 (53%), Gaps = 38/826 (4%)

Query: 127 LFDRSLDIGDLVLLRNSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRI--L 184
           L   +L IGDL +L     +L++CV+ P    D R+ FA  DG + ++TK +V LR+  L
Sbjct: 6   LAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRLRVPGL 65

Query: 185 NTLPKNILNHDLIKNKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLN 244
           +  P   L H    + Y    +   +NN  +   LPV  R++  +   +EIS+ A   L 
Sbjct: 66  HKRPLRYLLHREADHGYAP--VGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLP 123

Query: 245 VNLKKLEVLHRYISDGVETSSISFLKLVHLVQNVDLNKLARNRADHDANHIS--NIIRNT 302
             + KLE+LHR++   +    +S  KLV LV  ++L       ++  A  ++  NI + +
Sbjct: 124 EVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGS 183

Query: 303 ---KDDIQYMT----KIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNN 355
                DI        ++D    L+TYW V+QQQ  Q+WGDI  H AL  P+SV+VLP  +
Sbjct: 184 YCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRD 243

Query: 356 VIYLNETIPRVATDEN---INKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKI 412
                + + R    ++   +++F   +N+   ++    +   L +L++Y  G    N  +
Sbjct: 244 QTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAAL 303

Query: 413 TTIISKLFRRIETYKNKELSRDNCQKLYNEXXXXXXXXXXXXXXXXXXXPEISGTTRTEQ 472
             ++++LFRR++ YK +E++R    +L  +                   P  +  T  EQ
Sbjct: 304 IYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLEL-PLSNPRTALEQ 362

Query: 473 LIYSLTEVDNHAIIDQR----RHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIH 528
            +Y L        +DQ     R +F  +  +CID   AHEIDDGVS+ R  G+  RL +H
Sbjct: 363 KVYDLAS----PPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVH 417

Query: 529 IADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKM 588
           IA P SLF    T       D +++IAFRRAFTTYLP+ V PM+PKS+   SDLG   K 
Sbjct: 418 IAYPYSLFKKSYT-PGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKP 476

Query: 589 TNTITFSVDFD--KSSCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERD 646
           T TIT SVD D  K    + E T +I LG      K  TY  VD +L S  KR++    D
Sbjct: 477 TKTITISVDVDLSKKLRVVDEATLQIALGTTRT-SKRVTYDYVDDLLES--KRQDAEASD 533

Query: 647 LREMRFIANHLRKCR-IDNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNI 705
           LR +  +A  LR+ R +   A++FG+  N G ++L    +DG K   V   DS++T SN 
Sbjct: 534 LRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLT-PNEDG-KLLNVQLVDSKSTKSNT 590

Query: 706 IVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMKPKASSQFKKILNVNKKRLPXXXXXX 765
           +VSE MI+ANSLAG+YF  + IP +Y+    L +K +AS+Q+  +    +++        
Sbjct: 591 LVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDL 650

Query: 766 XXXXX-XXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQE 824
                             H M+GT++Y T+TSPLRR PD+INH QLHR+L + P CFSQE
Sbjct: 651 VKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQE 710

Query: 825 KLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCI 884
           ++D + WH++ RD  L+  S++ + +WTL YL +++   P  R+D++V S+  NG VHC 
Sbjct: 711 QIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCK 770

Query: 885 LPKLSYATGTLKLKPSATTIPAIGEIIKNCKIANIDCLGNSLEFAI 930
           +P + Y++G LK+ PS    PA+G  + NC I  +D L  +L F +
Sbjct: 771 IPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 86/421 (20%), Positives = 157/421 (37%), Gaps = 70/421 (16%)

Query: 488 QRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNST 547
           Q+R D +D  +  ID     +IDD +   R       + +HIAD       +  ++    
Sbjct: 525 QKRRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHIADVTHFVKPNTALDAEGA 584

Query: 548 SDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSI 605
           S         R  + YL +  + MLP    T  DL +         FSV  + D ++  +
Sbjct: 585 S---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVERFAFSVIWELDDNANIV 633

Query: 606 LEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS 665
             D  +  +     F        +D        +++++   +R +  ++  L++ R+D  
Sbjct: 634 NVDFMKSVIKSREAFSYEQAQLRID-----DPNQKDELTEGMRALLQLSIKLKQKRLD-- 686

Query: 666 AVIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGK 720
                     GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K
Sbjct: 687 ---------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARK 737

Query: 721 YF---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------V 753
            F         + H  P          + +T KGL++  ++S      L+          
Sbjct: 738 IFDAFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPYF 797

Query: 754 NKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRY 813
           N                            H  +  D Y   TSP+RR+ D++ H QL   
Sbjct: 798 NTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGA 857

Query: 814 LTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYL-------NEKIEGNPLL 866
           +  +PL       ++M   +I R+   +H + +F    +++Y        NE +E   ++
Sbjct: 858 IGYEPLDLMHRDKNKM--DMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVEAGYVI 915

Query: 867 R 867
           +
Sbjct: 916 K 916

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 96/453 (21%), Positives = 176/453 (38%), Gaps = 81/453 (17%)

Query: 488 QRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNST 547
           Q+R D +D  +  ID     +IDD +   +       + +HIAD          ++    
Sbjct: 516 QKRVDLRDKLICSIDPPGCVDIDDALHAKKLPNGHFEVGVHIADVTHFVKAGTPLDAEGA 575

Query: 548 SDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSI 605
           S         R  + YL +  + MLP    T  DL +     +   FSV  + D+++   
Sbjct: 576 S---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWELDENA--- 621

Query: 606 LEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS 665
             D  ++   K     +     E  ++      + +++   +R +  ++  L++ R+D  
Sbjct: 622 --DIVKVDFSKSVIRSREAFSYEQAQLRIDDKNQTDELTLGMRALLDLSIKLKQKRLD-- 677

Query: 666 AVIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGK 720
                     GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K
Sbjct: 678 ---------AGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARK 728

Query: 721 YF---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN--VNKK---- 756
            +         + H  P          + +  KGL++  ++S      L+  V+KK    
Sbjct: 729 IYDSFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPYF 788

Query: 757 ----RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHR 812
               R+                        H  +  D Y   TSP+RR+ D++ H QL  
Sbjct: 789 NTLVRI-MSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 847

Query: 813 YLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYL-------NEKIEGNPL 865
            +  +PL  S    ++M   +I ++   RH + +F    +++Y        NE +E   +
Sbjct: 848 AIGYEPLDLSHRDKNKM--EMICKNINRRHRNAQFAGRASIEYYVGQVMRNNESVETGYV 905

Query: 866 LRFDVMVQSVSENGRVHCILPKLSYATGTLKLK 898
           ++       V  NG V  I+PK     G ++L+
Sbjct: 906 IK-------VLNNGIV-VIVPKFG-VEGLIRLE 929

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/399 (19%), Positives = 150/399 (37%), Gaps = 59/399 (14%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD       +  ++    S
Sbjct: 522 KRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPNTALDGEGAS 581

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILED 608
                    R  + YL +  + MLP    T  DL +     +   FSV ++ +  +   D
Sbjct: 582 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVLWELNENA---D 627

Query: 609 TFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAVI 668
              +   K     +     E  ++      +++++   +R +  ++  L++ RI      
Sbjct: 628 IVNVDFAKSVIKSREAFSYEQAQLRIDDPNQQDELTHGMRALLKLSIKLKEKRI------ 681

Query: 669 FGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKYF- 722
                N GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K + 
Sbjct: 682 -----NAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYD 736

Query: 723 --------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------VNKK 756
                   + H  P          + +T KG+++  ++S      L+          N  
Sbjct: 737 SFPQTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDPYFNTL 796

Query: 757 RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTN 816
                                     H  +  D Y   TSP+RR+ D++ H QL   +  
Sbjct: 797 VRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGY 856

Query: 817 QPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           +PL  S    + M   +I ++   +H + +F    +++Y
Sbjct: 857 EPLDLSHRDKNRM--DMICKNINKKHRNAQFAGRASIEY 893

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 82/402 (20%), Positives = 156/402 (38%), Gaps = 65/402 (16%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +     +     + +HIAD          ++    S
Sbjct: 536 KRRDLRDKLICSIDPPNCVDIDDALHAKMLENGNWEVGVHIADVTHFVKPGTALDAEGAS 595

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  DL +     +   FSV  + D+ +  + 
Sbjct: 596 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVLWELDQDANIVN 644

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D  +  +     F    +Y++  +I      + +++ + +R +  ++  L++ R+D   
Sbjct: 645 VDFTKSVIRSREAF----SYEQA-QIRIDDPNQTDELTQGMRALLQLSKKLKQKRLD--- 696

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K 
Sbjct: 697 --------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 748

Query: 722 F---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN--VNKK----- 756
           +         + H  P          + +T KGL +  ++S      L+  V+K      
Sbjct: 749 YDSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKALADSLDRCVDKNDPYFN 808

Query: 757 ---RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRY 813
              R+                        H  +  D Y   TSP+RR+ D++ H QL   
Sbjct: 809 TLVRI-MSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAA 867

Query: 814 LTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           +  +PL  +    D+    +I ++   +H + +F    +++Y
Sbjct: 868 IGYEPLSLTHR--DKTKMDMICKNINRKHRNAQFAGRASIEY 907

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 95/458 (20%), Positives = 174/458 (37%), Gaps = 66/458 (14%)

Query: 490 RHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSD 549
           R DF+D  +  ID     +IDD +   +       + +HIAD          ++    S 
Sbjct: 539 RKDFRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTHFVKPGTALDAEGAS- 597

Query: 550 EILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSILE 607
                   R  + YL +  + MLP    T  DL +     +   FSV  + D  +  +  
Sbjct: 598 --------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVVWELDNDANIVGV 647

Query: 608 DTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAV 667
           D  +  +     F   +  K  ++I + + K E  +   +R +  ++  L++ R+D    
Sbjct: 648 DFTKSVIRSREAF---SYEKAQNRIDDETAKDE--LTLGMRALLQLSKKLKQKRLD---- 698

Query: 668 IFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKYF 722
                   GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K +
Sbjct: 699 -------AGALNLASPEVKVHMDSETSDPNEVEIKKLLDTNSLVEEFMLLANISVARKIY 751

Query: 723 ---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------VNK 755
                    + H  P          + +  KG+++  ++S      L+         +N 
Sbjct: 752 EAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALADSLDRCEDPNDSYLNT 811

Query: 756 KRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLT 815
                                      H  +  D Y   TSP+RR+ D++ H QL   + 
Sbjct: 812 LIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 871

Query: 816 NQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSV 875
            + L  S    D+    +I R+   +H + +F    +++Y   ++  N        V  V
Sbjct: 872 YEALDLSHR--DKQKMEMICRNINKKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKV 929

Query: 876 SENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKN 913
             NG +  ++PK     G ++L+ + T  P   E I++
Sbjct: 930 FNNG-IAVLVPKFG-VEGLIRLE-NLTENPQSAEFIED 964

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 78/401 (19%), Positives = 149/401 (37%), Gaps = 63/401 (15%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   R       + +HIAD          ++    +
Sbjct: 530 KRKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKPGTALDAEGAA 589

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  DL +     +   FSV  + D+++  + 
Sbjct: 590 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWELDENANIVN 638

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D  +  +     F        +D      I + +++   +R +  ++  L++ R++   
Sbjct: 639 VDFMKSVIRSREAFSYEQAQLRID-----DINQNDELTLGMRALLQLSVKLKQKRLE--- 690

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K 
Sbjct: 691 --------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 742

Query: 722 F---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------VN 754
           +         + H  P          +  T K +++  ++S      L+          N
Sbjct: 743 YDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFN 802

Query: 755 KKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYL 814
                                       H  +  D Y   TSP+RR+ D++ H QL   +
Sbjct: 803 TLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 862

Query: 815 TNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
             +PL  +    ++M   +I R+   +H + +F    +++Y
Sbjct: 863 GYEPLSLTHRDKNKM--DMICRNINRKHRNAQFAGRASIEY 901

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 78/399 (19%), Positives = 148/399 (37%), Gaps = 59/399 (14%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD       +  ++    S
Sbjct: 518 KRRDMRDKLICSIDPPGCVDIDDALHAKKLINGNWEVGVHIADVTHFVKPNTALDAEGAS 577

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILED 608
                    RA + YL +  + MLP    T  DL +     +   FSV ++  + +   +
Sbjct: 578 ---------RATSVYLVDKRIDMLPMLLGT--DLCSLKASVDRFAFSVIWELDNDA---N 623

Query: 609 TFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAVI 668
              ++  K     +     E  ++      + +++   +R +  ++  L++ R+D     
Sbjct: 624 IVSVEFTKSVIRSREAFSYEQAQLRIDDPNQNDELTLGMRALLQLSKKLKQKRLD----- 678

Query: 669 FGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKYF- 722
                  GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K + 
Sbjct: 679 ------AGALNLASPEVKVHMDSETSDPSEVEIKKLLSTNSLVEEFMLLANISVARKIYD 732

Query: 723 --------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------VNKK 756
                   + H  P          + +  K +++  ++S      L+          N  
Sbjct: 733 SFPQTAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVYFNTL 792

Query: 757 RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTN 816
                                     H  +  D Y   TSP+RR+ D+I H QL   +  
Sbjct: 793 VRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQLAAAIGY 852

Query: 817 QPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           + L  S    D+    +I R+   RH + +F    +++Y
Sbjct: 853 ESLDLSHR--DKQKMEIICRNINKRHRNAQFAGRASIEY 889

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 80/402 (19%), Positives = 148/402 (36%), Gaps = 65/402 (16%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   R       + +HIAD       +  ++    +
Sbjct: 530 KRKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKPNTALDAEGAA 589

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  DL +     +   FSV  + D  +  + 
Sbjct: 590 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWELDDDANIVN 638

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKREND-IERDLREMRFIANHLRKCRIDNS 665
            D  +  +     F        +D       K +ND +   +R +  ++  L++ R++  
Sbjct: 639 VDFMKSVIKSREAFSYEQAQFRIDD------KNQNDELTSGMRALLELSIKLKQKRLE-- 690

Query: 666 AVIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGK 720
                     GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K
Sbjct: 691 ---------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARK 741

Query: 721 YF---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------V 753
            +         + H  P          +  T K +++  ++S      L+          
Sbjct: 742 IYDAFPQTAMLRRHAAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYF 801

Query: 754 NKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRY 813
           N                            H  +  D Y   TSP+RR+ D++ H QL   
Sbjct: 802 NTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGA 861

Query: 814 LTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
           +  +PL  +    ++M   +I R+   +H + +F    +++Y
Sbjct: 862 IGYEPLSLTHRDKNKM--DMICRNINRKHRNAQFAGRASIEY 901

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 88/449 (19%), Positives = 171/449 (38%), Gaps = 75/449 (16%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD       +  ++    S
Sbjct: 515 KRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKANTPLDAEGAS 574

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  +L +     +   FSV  + D+++  + 
Sbjct: 575 ---------RGTSVYLVDKRIDMLPMLLGT--NLCSLKPYVDRFAFSVLWELDENANIVN 623

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D  +  +     F        +D        +++++ + +R +  ++  L++ R+D   
Sbjct: 624 VDFTKSVIKSREAFSYEQAQLRID-----DESQKDELTQGMRALLQLSIKLKQKRLD--- 675

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A + 
Sbjct: 676 --------AGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARRI 727

Query: 722 F---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------VN 754
           +         + H  P          + +  KG+++  ++S      L+          N
Sbjct: 728 YEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSLDRCVDLEDPYFN 787

Query: 755 KKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYL 814
                                       H  +  D Y   TSP+RR+ D++ H QL   +
Sbjct: 788 TLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAI 847

Query: 815 TNQPLCFSQE---KLDEMVWHLIERDTILRHYSRKFNKYWTLQYL--NEKIEGNPLLRFD 869
             +PL  +     K+D M  ++ ++    +   R   +Y+  Q +  NE +E   ++R  
Sbjct: 848 GYEPLDLNHRDKNKMDFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIR-- 905

Query: 870 VMVQSVSENGRVHCILPKLSYATGTLKLK 898
                V  NG V  ++PK     G ++L+
Sbjct: 906 -----VFHNGIV-VLVPKFG-VEGLIRLE 927

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 85/408 (20%), Positives = 155/408 (37%), Gaps = 77/408 (18%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD          ++    +
Sbjct: 530 KRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAA 589

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILED 608
                    R  + YL +  + MLP    T  DL +     +   FSV ++      L+D
Sbjct: 590 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWE------LDD 632

Query: 609 TFEIQLGKVN-NFPKNT-------TYKEVDKILNSSIKREND-IERDLREMRFIANHLRK 659
           +  I    VN NF K+        +Y++    L    K +ND +   +R +  ++  L++
Sbjct: 633 SANI----VNVNFMKSVIRSREAFSYEQAQ--LRIDDKTQNDELTMGMRALLKLSVKLKQ 686

Query: 660 CRIDNSAVIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN 715
            R++            GA+NL    ++   D E S     +  +   +N +V EFM+LAN
Sbjct: 687 KRLE-----------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLAN 735

Query: 716 -SLAGKYF---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---- 752
            S+A K +         + H  P          +  T K +++  ++S      L+    
Sbjct: 736 ISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVD 795

Query: 753 -----VNKKRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINH 807
                 N                            H  +  D Y   TSP+RR+ D++ H
Sbjct: 796 PEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAH 855

Query: 808 FQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
            QL   +  +PL  +    ++M   +I R+   +H + +F    +++Y
Sbjct: 856 RQLAGAIGYEPLSLTHRDKNKM--DMICRNINRKHRNAQFAGRASIEY 901

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 78/400 (19%), Positives = 150/400 (37%), Gaps = 61/400 (15%)

Query: 489 RRHDFKDLKVFC-IDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNST 547
           +R D +D KV C ID     +IDD +   +       + +HIAD          ++    
Sbjct: 559 KRKDLRD-KVICSIDPPGCVDIDDALHARKLPNGNWEVGVHIADVTHFVKPSTALDAEGA 617

Query: 548 SDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILE 607
           +         R  + YL +  + MLP    T  DL +     +   FSV ++    +   
Sbjct: 618 A---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVMWELDDNA--- 663

Query: 608 DTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAV 667
           D   ++  K     +     E  ++      +++++   +R +  ++  L++ R++    
Sbjct: 664 DIVNVEFMKSVIKSREAFSYEQAQLRIDDKNQDDELTLGMRALLKLSIKLKQKRLE---- 719

Query: 668 IFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKYF 722
                   GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K +
Sbjct: 720 -------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIY 772

Query: 723 ---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN---------VNK 755
                    + H  P          +  T K +++  ++S      L+          N 
Sbjct: 773 DAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDSEDPYFNT 832

Query: 756 KRLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLT 815
                                      H  +  D Y   TSP+RR+ D++ H QL   + 
Sbjct: 833 LVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 892

Query: 816 NQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQY 855
            +PL  +    ++M   +I R+   +H + +F    +++Y
Sbjct: 893 YEPLSLAHRDKNKM--DMICRNINRKHRNAQFAGRASIEY 930

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RR+ D++ H QL   +  +PL  S    ++M   +I R+   RH
Sbjct: 827 HYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLDLSHRDKNKM--DMICRNINKRH 884

Query: 843 YSRKFNKYWTLQY 855
            + +F    +++Y
Sbjct: 885 RNAQFAGRASIEY 897

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 106/258 (41%), Gaps = 44/258 (17%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           RR D +D  +  ID     +IDD +   +       + +HIAD       +  ++    S
Sbjct: 526 RRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPNTPLDAEGAS 585

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILED 608
                    R  + YL +  + MLP      +DL +     +   FSV ++    + + D
Sbjct: 586 ---------RGTSVYLVDKRIDMLP--LLLGTDLCSLKPYVDRYAFSVLWELDDNANIVD 634

Query: 609 TFEIQLGKVNNFPKNT-------TYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCR 661
                     NF K+        +Y++  +I      + +++ + +R +  ++  L++ R
Sbjct: 635 V---------NFTKSVIRSREAFSYEQA-QIRIDDKSQTDELTQGMRALLKLSIKLKQKR 684

Query: 662 IDNSAVIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-S 716
           +D            GA+NL    ++   D E S     +  +   +N +V EFM+LAN S
Sbjct: 685 LD-----------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANIS 733

Query: 717 LAGKYFKNHKIPAIYKTY 734
           +A K F++    A+ + +
Sbjct: 734 VARKIFESFPQTAMLRRH 751

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RRF D++ H QL   +  +PL  S    ++M   +I R+   +H
Sbjct: 828 HYGLAVDIYTHFTSPIRRFCDVVAHRQLAGAIGYEPLDLSHRDKNKM--DMICRNINRKH 885

Query: 843 YSRKFNKYWTLQY 855
            + +F    +++Y
Sbjct: 886 RNAQFAGRASIEY 898

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 96/241 (39%), Gaps = 34/241 (14%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           RR D +D  +  ID     +IDD +   R       + +HIAD          ++    S
Sbjct: 527 RRKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKPGTALDAEGAS 586

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  DL +     +   FSV  + D+++    
Sbjct: 587 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVLWELDENA---- 631

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D   +   K     +     E  ++      + +D+ + +R +  ++  L++ R+D   
Sbjct: 632 -DIVNVDFTKSVIKSREAFSYEQAQLRIDDASQTDDLTQGMRALLQLSIKLKQKRLD--- 687

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K 
Sbjct: 688 --------AGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKI 739

Query: 722 F 722
           +
Sbjct: 740 Y 740

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RR+ D++ H QL   +  +PL  S    ++M   +I R+   +H
Sbjct: 842 HYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLSHRDKNKM--DMICRNINKKH 899

Query: 843 YSRKFNKYWTLQY 855
            + +F    +++Y
Sbjct: 900 RNAQFAGRASIEY 912

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 96/238 (40%), Gaps = 30/238 (12%)

Query: 490 RHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSD 549
           R D +D  +  ID     +IDD +   +       + +HIAD          ++    S 
Sbjct: 542 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKQGTALDAEGAS- 600

Query: 550 EILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILEDT 609
                   R  + YL +  + MLP    T  DL +     +   FSV ++  S +   D 
Sbjct: 601 --------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVLWELDSNA---DI 647

Query: 610 FEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAVIF 669
            ++   K     +     E  ++      + +D+ + +R +  ++  L++ R+DN     
Sbjct: 648 VKVDFTKSVIKSREAFSYEQAQLRIDDPNQTDDLTQGMRALLQLSIKLKQKRLDN----- 702

Query: 670 GEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKYF 722
                 GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K +
Sbjct: 703 ------GALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKIY 754

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 18/123 (14%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RR+ D++ H QL   +  +PL  +    ++M   +I ++   RH
Sbjct: 818 HYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLDLTHRDKNKM--EMICKNINKRH 875

Query: 843 YSRKFNKYWTLQYL-------NEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTL 895
            + +F    +++Y        NE +E   ++R       V  NG V  ++PK     G +
Sbjct: 876 RNAQFAGRASIEYYVGQVMRNNESVETGYVIR-------VFNNGIV-VLVPKFG-VEGLI 926

Query: 896 KLK 898
           +L+
Sbjct: 927 RLE 929

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 98/242 (40%), Gaps = 34/242 (14%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD          ++    S
Sbjct: 517 KRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTHFVKAGTPLDAEGAS 576

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  DL +     +   FSV  + D+ +  + 
Sbjct: 577 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWELDQKASIVN 625

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D  +  +     F        +D        +++++ + +R +  ++  L++ R+D   
Sbjct: 626 VDFTKSVIRSREAFSYEQAQLRID-----DPNQKDELTQGMRALLNLSVKLKQKRLD--- 677

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S   + +  +   +N +V EFM+LAN S+A K 
Sbjct: 678 --------AGALNLASPEVKVHMDSETSDPGDVEIKKLLATNSLVEEFMLLANISVAKKI 729

Query: 722 FK 723
           ++
Sbjct: 730 YE 731

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 38.9 bits (89), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RRF D+I H QL   +  +PL       ++M   +I ++   +H
Sbjct: 845 HYGLAVDIYTHFTSPIRRFCDVIAHRQLAGAIGYEPLALMHRDKNKM--EMICKNINKKH 902

Query: 843 YSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLS 889
            + +F    +++Y   ++  N        V  V  NG V  ++PK  
Sbjct: 903 RNAQFAGRASIEYYVGQVMRNNECTETGYVIKVLNNGIV-VLVPKFG 948

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 96/241 (39%), Gaps = 36/241 (14%)

Query: 490 RHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSD 549
           R D +D  +  ID     +IDD +   R       + +HIAD          ++    S 
Sbjct: 545 RQDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKPGTALDAEGAS- 603

Query: 550 EILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILEDT 609
                   R  + YL +  + MLP    T  DL +     +   FSV ++      L+D 
Sbjct: 604 --------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWE------LDDN 647

Query: 610 FEI---QLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            EI   +  K     +     E  ++      + +++ + +R +  ++  L++ R+D   
Sbjct: 648 AEIIDVKFTKSVIRSREAFSYEQAQLRIDDKNQTDELTKGMRALLELSVKLKQKRLD--- 704

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K 
Sbjct: 705 --------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 756

Query: 722 F 722
           F
Sbjct: 757 F 757

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 88/445 (19%), Positives = 174/445 (39%), Gaps = 67/445 (15%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD       +  ++    S
Sbjct: 515 KRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTHFVKPNTPLDAEGAS 574

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  +L +     +   FSV  + D+ +  + 
Sbjct: 575 ---------RGTSVYLVDKRIDMLPMLLGT--NLCSLKPYVDRFAFSVLWELDQDANIVN 623

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D  +  +     F    +Y++    ++ S +  +++ + +R +  ++  L++ R+    
Sbjct: 624 VDFTKSVIKSREAF----SYEQAQLRIDDSTQ-TDELTQGMRALLSLSIKLKEKRL---- 674

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                  N GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K 
Sbjct: 675 -------NAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKI 727

Query: 722 F---------KNHKIPA---------IYKTYKGLNMKPKASSQFKKILN--VNKK----- 756
           +         + H  P          + +  KG+++  ++S      L+  V+ K     
Sbjct: 728 YEAFPQTAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALADSLDRCVDPKDPYFN 787

Query: 757 ---RLPXXXXXXXXXXXXXXXXXXXXXXXHEMIGTDQYATVTSPLRRFPDLINHFQLHRY 813
              R+                        H  +  D Y   TSP+RR+ D++ H QL   
Sbjct: 788 TLVRI-MSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAA 846

Query: 814 LTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQ 873
           +  + L  +    ++M    + R+   +H + +F    +++Y   ++  N        V 
Sbjct: 847 IGYEALDLNHRDKNKM--EFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESEETGYVI 904

Query: 874 SVSENGRVHCILPKLSYATGTLKLK 898
            V  NG V  ++PK     G ++L+
Sbjct: 905 RVFHNGIV-VLVPKFG-VEGLIRLE 927

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RR+ D++ H QL   +  +PL  S +  D+    +I R+   +H
Sbjct: 826 HYGLAVDIYTHFTSPIRRYCDIVAHRQLAGAIDYEPL--SLDHRDKHKMDMICRNINRKH 883

Query: 843 YSRKFNKYWTLQ-YLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLK 898
            + +F    +++ Y+ + ++ N  L    +++ V  NG V  ++PK     G ++L+
Sbjct: 884 RNAQFAGRASIEYYVGQVMKNNESLESGYVIK-VFNNGIV-VLVPKFG-VEGLIRLE 937

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 111/271 (40%), Gaps = 40/271 (14%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   +       + +HIAD          ++    S
Sbjct: 525 KRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGHWEVGVHIADVTHFVKPGTALDAEGAS 584

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    R  + YL +  + MLP    T  DL +     +   FSV  + D+++    
Sbjct: 585 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWELDENA---- 629

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D   ++  K     +     E  ++     K+++++   +R +  ++  L++ R++   
Sbjct: 630 -DIINVEFHKSVIRSREAFAYEQAQLRIDDPKQQDELTLGMRALLQLSIKLKQKRLE--- 685

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKY 721
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K 
Sbjct: 686 --------AGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKI 737

Query: 722 FKNHKIPAIYKTYKGLNMKPKASSQFKKILN 752
           + +    A+ + +      P  ++ F +ILN
Sbjct: 738 YDSFPQTAMLRRH-----APPPATNF-EILN 762

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RR+ D++ H QL   +  +PL       ++M   ++ R+   +H
Sbjct: 830 HYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIDYEPLSLMHRDKNKM--DMVCRNINKKH 887

Query: 843 YSRKFNKYWTLQY 855
            + +F    +++Y
Sbjct: 888 RNAQFAGRASIEY 900

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 100/240 (41%), Gaps = 32/240 (13%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   R       + +HIAD          ++    S
Sbjct: 529 KRTDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKPGTALDAEGAS 588

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILED 608
                    R  + YL +  + MLP    T  DL +     +   FSV ++ +  +   D
Sbjct: 589 ---------RGTSVYLVDKRIDMLPMLLGT--DLCSLKPYVDRFAFSVIWELNEDA---D 634

Query: 609 TFEIQLGK-VNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAV 667
              +   K V    +  +Y++    ++ S  +++++   +R +  ++  L++ R+D    
Sbjct: 635 IVNVDFTKSVIRSREAFSYEQAQVRIDDS-NQKDELTLGMRALLHLSKKLKQKRLD---- 689

Query: 668 IFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN-SLAGKYF 722
                   GA+NL    ++   D E S     +  +   +N +V EFM+LAN S+A K +
Sbjct: 690 -------AGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKIY 742

>AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL021C
           (DIS3)
          Length = 997

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 783 HEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRH 842
           H  +  D Y   TSP+RR+ D++ H QL   +  +PL  +    D+    +I ++   RH
Sbjct: 828 HYGLAVDIYTHFTSPIRRYCDVVVHRQLAGAIGYEPLDLTHR--DKQKMEMICKNINRRH 885

Query: 843 YSRKFNKYWTLQY 855
            + +F    +++Y
Sbjct: 886 RNAQFAGRASIEY 898

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 89/233 (38%), Gaps = 33/233 (14%)

Query: 489 RRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTS 548
           +R D +D  +  ID     +IDD +   R       + +HIAD          ++    S
Sbjct: 527 KRRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKPGTALDTEGAS 586

Query: 549 DEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV--DFDKSSCSIL 606
                    RA + YL    + MLP    T  DL +     +   FSV  + D  +  + 
Sbjct: 587 ---------RATSVYLVNKRIDMLPMLLGT--DLCSLKPYVDRFAFSVLWELDADANIVN 635

Query: 607 EDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSA 666
            D  +  +     F        +D      + + +++   +R +  ++  L++ R+D   
Sbjct: 636 VDFTKSVIRSREAFSYEAAQLRID-----DVNQNDELTNGMRALLELSKKLKQKRLD--- 687

Query: 667 VIFGEGFNKGAVNL----IEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILAN 715
                    GA+NL    ++   D E S     +  +   +N +V EFM+LAN
Sbjct: 688 --------AGALNLASPEVKVHMDNETSDPNEVEIKKLLATNSLVEEFMLLAN 732

>NDAI0J00540 Chr10 complement(110610..111602) [993 bp, 330 aa] {ON} 
          Length = 330

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 9/47 (19%)

Query: 828 EMVWHLIERDTILRHYSRKFNK-------YWTLQYLNEKIEGNPLLR 867
           ++ W   ER    R++  KFN+       Y+TL +L E +EGNP+LR
Sbjct: 272 DVTW--AERHCYQRYFVCKFNQMRKGSSSYFTLSFLQEHLEGNPVLR 316

>Suva_6.283 Chr6 (496415..498940) [2526 bp, 841 aa] {ON} YJL204C
           (REAL)
          Length = 841

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 345 PISVSVLPFNNVIYLNETIPRVATDENINKFTEAINKHNLEKINEKFPDFLN 396
           P S++VLP N+ ++L E  P+   D   NK T+ IN  +L+K+ +   DFLN
Sbjct: 213 PPSLTVLPSNDELFLKEQ-PQEGED---NKITDIINPESLDKLLDPLRDFLN 260

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 464 ISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNIT 523
           I+G T    ++Y++T     ++   R  + +  +V C+DEK+AHE D      +K+  I 
Sbjct: 505 IAGDTCVGAIVYNVT----FSLTQNRLFELEKAEVICVDEKSAHEEDSSTKNSKKNSRIG 560

Query: 524 RL 525
            L
Sbjct: 561 WL 562

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,493,095
Number of extensions: 4779421
Number of successful extensions: 16217
Number of sequences better than 10.0: 73
Number of HSP's gapped: 16489
Number of HSP's successfully gapped: 94
Length of query: 943
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 824
Effective length of database: 39,836,145
Effective search space: 32824983480
Effective search space used: 32824983480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)