Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I003408.852ON39539518250.0
Kpol_237.38.852ON3512822794e-27
ZYRO0C14916g8.852ON3282592231e-19
TDEL0B002108.852ON3332621879e-15
NDAI0E002408.852ON5191971506e-10
CAGL0B02409g8.852ON3611881362e-08
KAFR0A028808.852ON4302631354e-08
Smik_13.158.852ON3571751337e-08
Skud_13.228.852ON3562321292e-07
KNAG0G034908.852ON3171681256e-07
YML119W8.852ON3572051176e-06
TBLA0D033108.852ON5022151161e-05
NCAS0B002508.852ON3161061088e-05
Suva_13.248.852ON3602051071e-04
KLLA0C06292g8.852ON2561431023e-04
SAKL0D01122g8.852ON311241007e-04
AFR449W8.852ON299233950.003
Kwal_27.102108.852ON27821760.63
KLTH0C03652g8.852ON27621750.75
Kpol_1054.242.58ON103381687.8
ZYRO0A11154g5.230ON776107687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00340
         (395 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}...   707   0.0  
Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON} co...   112   4e-27
ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa] ...    91   1e-19
TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}...    77   9e-15
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    62   6e-10
CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {...    57   2e-08
KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {O...    57   4e-08
Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...    56   7e-08
Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W (...    54   2e-07
KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON...    53   6e-07
YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative pro...    50   6e-06
TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {O...    49   1e-05
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    46   8e-05
Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W (...    46   1e-04
KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {O...    44   3e-04
SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved...    43   7e-04
AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic h...    41   0.003
Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...    34   0.63 
KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {O...    33   0.75 
Kpol_1054.24 s1054 complement(56591..59692) [3102 bp, 1033 aa] {...    31   7.8  
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    31   7.8  

>TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}
           Anc_8.852 YML119W
          Length = 395

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/395 (90%), Positives = 357/395 (90%)

Query: 1   MSTSRSLNNKIFFEKKSATGEYPKEWMNSAYGGNLTHHQDSSQLQNQSYSKRXXXXXXXX 60
           MSTSRSLNNKIFFEKKSATGEYPKEWMNSAYGGNLTHHQDSSQLQNQSYSKR        
Sbjct: 1   MSTSRSLNNKIFFEKKSATGEYPKEWMNSAYGGNLTHHQDSSQLQNQSYSKRNINSTVNN 60

Query: 61  XXXXXXXXXXXXXYGRENFHNNQAYSNNAYSLKGLNNTYILNNMRNDNKIKRGQKPIMNG 120
                        YGRENFHNNQAYSNNAYSLKGLNNTYILNNMRNDNKIKRGQKPIMNG
Sbjct: 61  SFNYNNYDNNAANYGRENFHNNQAYSNNAYSLKGLNNTYILNNMRNDNKIKRGQKPIMNG 120

Query: 121 RSMPYKNMNKQNSRALKQTKNPPNNAKNFTNKNIKFTIVHDESEIDNDKKHSNDDICNKY 180
           RSMPYKNMNKQNSRALKQTKNPPNNAKNFTNKNIKFTIVHDESEIDNDKKHSNDDICNKY
Sbjct: 121 RSMPYKNMNKQNSRALKQTKNPPNNAKNFTNKNIKFTIVHDESEIDNDKKHSNDDICNKY 180

Query: 181 FSEPVDLNYYKDSDGKIKPVINLVSKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEY 240
           FSEPVDLNYYKDSDGKIKPVINLVSKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEY
Sbjct: 181 FSEPVDLNYYKDSDGKIKPVINLVSKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEY 240

Query: 241 RPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVL 300
           RPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVL
Sbjct: 241 RPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVL 300

Query: 301 KSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMXXXXXXXXXXXXXXXXXYNE 360
           KSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRM                 YNE
Sbjct: 301 KSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMVDSFSVAFSDDDGDNDDYNE 360

Query: 361 QAESTFDEEFGSKENKYLRTLTNKILPAEITGGGF 395
           QAESTFDEEFGSKENKYLRTLTNKILPAEITGGGF
Sbjct: 361 QAESTFDEEFGSKENKYLRTLTNKILPAEITGGGF 395

>Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON}
           complement(3052..4107) [1056 nt, 352 aa]
          Length = 351

 Score =  112 bits (279), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 140/282 (49%), Gaps = 50/282 (17%)

Query: 127 NMNKQNSRALKQT--KNPPNNAKNFTNKNIKFTIVHDESEI----DNDKKHSNDDICNKY 180
           N++  N+R +  T  +NP  N     N+N+K+TI++ E ++    +N+       I N+Y
Sbjct: 107 NISNVNNRKINDTNLRNPKQNLTFGQNRNLKYTIINSERDLLKVDNNELMRKTGAIKNRY 166

Query: 181 FSEPVDLNYYKDSDGKIKPVINLVSKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEY 240
           FS   +LN ++  DGK+KP+IN + K  Q + KK YKL+ P+  + T+Y  V  LI+  Y
Sbjct: 167 FSSITNLNDFRGEDGKLKPLINTLPKNVQLNRKKNYKLNKPVMQEKTSYKVVVELIDQVY 226

Query: 241 RPLYSKDQSFKFYNKDSVLLFKTLDAIVEKI--KASNRKETKENDANTTLEKIKLNKSSR 298
              Y+K Q ++  + D++ L  +++  +EK+  +  N   T +   N   +  K++ S  
Sbjct: 227 NKYYNKLQPYRSISDDNIDL-GSIENAIEKLCERLENSTATNKRTPNNVHDIAKISNSRT 285

Query: 299 VLKSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMXXXXXXXXXXXXXXXXXY 358
           +L S              T  NDSFELSFDGKALDRSDILRM                  
Sbjct: 286 LLTS--------------TIGNDSFELSFDGKALDRSDILRMV----------------- 314

Query: 359 NEQAESTFDEEFG-----SKENKYLRTLTNKILPAEITGGGF 395
                 +F   F      +   +++ +L+NK LPAEIT    
Sbjct: 315 -----DSFSVAFSDDDDENDNGEFIASLSNKFLPAEITSSAL 351

>ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa]
           {ON} some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 328

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 114/259 (44%), Gaps = 52/259 (20%)

Query: 138 QTKNPPNNAKNFTNKNIKFTIVHDESEIDNDKKHSNDDICNKYFSEPVDLNYYKDSDGKI 197
           Q + PP        K  + + +++  ++D  K+ +N    N+YFS+PVDL+  +  DG++
Sbjct: 121 QARGPP--------KYKEISSIYELEKVDPVKQENN--FTNRYFSDPVDLDSARSDDGRL 170

Query: 198 KPVINLVSKKTQQ-SIKKVYKLSVPINYKDTTYSGVSSLIETEYRPLYSKDQSFKFYNKD 256
           KP+IN  SK  +     K+YKLS+P+     T+  + + IE  YR  Y   Q    +   
Sbjct: 171 KPIINTASKNGKSYPGNKIYKLSIPLLVCQDTHRALKNQIERVYRSKYHSYQPLSLFGDM 230

Query: 257 SVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLKL 316
           S+  ++  D     I+                    L K  +    +     +N TG   
Sbjct: 231 SIRYYRLEDLQSRFIEF-------------------LQKPRKPQPPLQVARSLNGTG--- 268

Query: 317 TSNNDSFELSFDGKALDRSDILRMXXXXXXXXXXXXXXXXXYNEQAESTFDEEFGSKENK 376
            + NDSFELSFDGKALDRSDI RM                   +       ++    E+ 
Sbjct: 269 -ALNDSFELSFDGKALDRSDIFRMV------------------DSFSVALSDDDAEDESS 309

Query: 377 YLRTLTNKILPAEITGGGF 395
           ++ +    ILPAE+TG  F
Sbjct: 310 FVNSSGRNILPAEMTGTVF 328

>TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}
           Anc_8.852 YML119W
          Length = 333

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 116/262 (44%), Gaps = 55/262 (20%)

Query: 136 LKQTKNPPNNAKNFTNKNIKFTIVHDESEIDNDKKHSNDDI-CNKYFSEPVDLNYYKDSD 194
           L  TKN  + A N  ++N +    +D S++    K   D I  ++YFS P+DL   K +D
Sbjct: 125 LSPTKN--SKATNSKSRNPRCKEKNDASQVPTLNKLEKDKIIASRYFSPPIDLRKMKRAD 182

Query: 195 GKIKPVINLVSKKTQQSI-KKVYKLSVPINYKDTTYSGVSSLIETEYRPLYSKDQSFKFY 253
           GK++P+I + S  ++     K+Y+L+VP+   D ++  V   IE   R  Y + Q     
Sbjct: 183 GKLRPIIYVTSSGSKNLTNSKIYRLTVPLMTCDESHQVVRDEIENN-RHRYRQTQPL--- 238

Query: 254 NKDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTG 313
                                +R +   +D   T+  ++  K +  L+    R  +  + 
Sbjct: 239 ---------------------HRNQAPADDFGETVPNLRNTKKTATLR----RPLLAGSS 273

Query: 314 LKLTSNNDSFELSFDGKALDRSDILRMXXXXXXXXXXXXXXXXXYNEQAESTFDEEFGSK 373
           L     NDSF+LSFDGKALDRSDI RM                    Q++   +E+  + 
Sbjct: 274 L-----NDSFDLSFDGKALDRSDIFRMVDSFSVA-------------QSDDEPEEDNNNS 315

Query: 374 ENKYLRTLTNKILPAEITGGGF 395
            N +    +  +LPAE+T   F
Sbjct: 316 SNLH----SKNVLPAEMTSSAF 333

>NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852
           YML119W
          Length = 519

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 101/197 (51%), Gaps = 38/197 (19%)

Query: 175 DICNKYFSEPVDLNYYKDSDGKIKPVINLVSKKTQQSIKKVYKLSVPI-NYKDTTYSGVS 233
           +I N+YF+E  +    KD D K+KP+IN++ K +  +  K YKL  P+ + K  T   +S
Sbjct: 262 NIKNRYFTENKE-QLIKDGD-KLKPIINIIPKHSS-TTSKTYKLLNPLLSEKSITSMDIS 318

Query: 234 SLIET---------EYRPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDA 284
           S+++              L + D +FK  N D +    T+D I++KIK  N  + K    
Sbjct: 319 SILKLNNATISHGNSKHLLLANDPNFKINNLDEI----TMDLIMKKIKLINETKKKGKTT 374

Query: 285 NTTLEKIKL--------NKSSRVLKSINERSFI-NNTGLK---------LTSN---NDSF 323
             ++   KL        +KS +V+     +S + N T L+         +T+N   NDSF
Sbjct: 375 TKSITDEKLSENNIKEKDKSKKVVVLDPTKSKLKNTTSLRKSNRHLINVITANSNPNDSF 434

Query: 324 ELSFDGKALDRSDILRM 340
           +LSFDGKA+DRSDI RM
Sbjct: 435 DLSFDGKAMDRSDIFRM 451

>CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119w
          Length = 361

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 79/188 (42%), Gaps = 46/188 (24%)

Query: 205 SKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEYRPLYSKDQSFKFYNKDSVLLFKTL 264
           SK  Q+    VYKL+ P+  KD      S L++ +  P Y K Q  KF + + +  F  L
Sbjct: 216 SKSKQKKPPVVYKLATPLASKDVNALDNSFLLQPD-TPRYYKIQPIKFLHSEPIENFAGL 274

Query: 265 DAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLKLTSNNDSFE 324
             I           T   D NT  +K                S I+       + NDSF+
Sbjct: 275 QDI----------STHLLDNNTPKKK----------------SHISRVQPPPAATNDSFD 308

Query: 325 LSFDGKALDRSDILRMXXXXXXXXXXXXXXXXXYNEQAESTFDEEFGSKENKYL-RTLTN 383
           LSFDGKALDRSDI RM                   +     F ++  ++E+ ++ R   N
Sbjct: 309 LSFDGKALDRSDIFRMV------------------DSFSIAFSDDEDNEESSFISRRNNN 350

Query: 384 KILPAEIT 391
            ILPA++T
Sbjct: 351 DILPADMT 358

>KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {ON}
           Anc_8.852 YML119W
          Length = 430

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 124/263 (47%), Gaps = 41/263 (15%)

Query: 154 IKFTIVHDESEI--DNDKKHSNDDICNKYF---SEPVDLNYYKDS-DGKIKPVI-NLVSK 206
           +++  + D SE+  D   +  N  + ++YF   ++PVD   +  S + K K +I N  S+
Sbjct: 182 VQYKEIKDVSELFKDATNQDVNSYLLSQYFNKNTKPVDFGEFNHSNEMKSKAIIINTASR 241

Query: 207 KTQQSIKKV--YKLSVPINYKDTTYSGVSSLIETEY-------RPLY-SKDQSFKF--YN 254
              ++  K+  YKLS PI       S +S  I++ Y       +PL+ + +++FK    N
Sbjct: 242 SWYKNSNKIQTYKLSTPILSSIKYGSTLSKKIDSHYNDQNISAQPLFIAGNKNFKIDELN 301

Query: 255 KDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGL 314
           + SV L   +D  + ++  S+   T     N++L   K+ +  R L             +
Sbjct: 302 EASVEL---IDKYLSQLDKSSTGRTLI--KNSSLNSSKMQRQRRPL-------------I 343

Query: 315 KLTSNNDSFELSFDGKALDRSDILRMXXXXXXXXXXXXXXXXXYNEQ----AESTFDEEF 370
            +++ NDSF+LSFDGKALDR+DI RM                  N       ++  +  +
Sbjct: 344 NVSNYNDSFDLSFDGKALDRNDIFRMVDSFSIAVSDNESSDIIANSSDISYTQTGNNIHY 403

Query: 371 GSKENKYLRTLTNKILPAEITGG 393
            ++++ Y  T +N ILPAEIT  
Sbjct: 404 NNEKDNYTTTNSNNILPAEITSS 426

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 81/175 (46%), Gaps = 24/175 (13%)

Query: 179 KYFSEPVDLNYYK----------DSDGKIKPVINLVSKKTQQSIKKVYKLSVPI--NYKD 226
           +YF+ P+DL+  +          +S  K K   N+      +S+   YKLS P+     D
Sbjct: 151 RYFTSPIDLSGARKNTSTAPALTNSPIKSKANFNIRKYILPRSVITTYKLSSPVYETIDD 210

Query: 227 TTYSGVSSLIETEYRPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDANT 286
            +   +  LI  ++   Y   Q  +        + KTLD + E           E  A+T
Sbjct: 211 ISKKVIILLISLKFEKNYHFWQPIQLSVNKKTRISKTLDELCE-----------EQLAST 259

Query: 287 TLEKIKLNKSSRVLKSINERSFINNTGLKLT-SNNDSFELSFDGKALDRSDILRM 340
             ++ +L  + + LK+ +  +    TG  +  + N+SFELSFDGKA+DRSDI RM
Sbjct: 260 FQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIFRM 314

>Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W
           (REAL)
          Length = 356

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 89/232 (38%), Gaps = 43/232 (18%)

Query: 179 KYFSEPVDLNYYKDSDGKIKPVINLVSKKTQ-----------QSIKKVYKLSVPINYKDT 227
           +YF+ P+DL+  +++   I P +     K++           +S+   YKL+ P++    
Sbjct: 151 RYFTSPIDLHGIRNNSSNITPTLTNSPMKSKANFNIKKFILPRSVIITYKLASPVHETID 210

Query: 228 TYSGVSSLIETE--YRPLYSKDQSFKFYNKDSVLLFKTLDAIVEK--IKASNRKETKEND 283
             S    +++    +   Y   Q  +        + K+LD +  +  +    ++   +N+
Sbjct: 211 DISKKIIILQISLNFEKSYHSLQPIQLSTDRKTRILKSLDELCGEHLVLLPKQQSQPQNN 270

Query: 284 ANTTLEKIKLNKSSRVLKSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMXXX 343
                    +N   R   SI             T+ N+SFELSFDGKA+DRSDI RM   
Sbjct: 271 IKPVKNLPNINTKQRTSTSIG------------TTANESFELSFDGKAMDRSDIFRMVDS 318

Query: 344 XXXXXXXXXXXXXXYNEQAESTFDEEFGSKENKYLRTLTNKILPAEITGGGF 395
                          N Q                 R  +N+ILPAEI   G 
Sbjct: 319 FSIAISDEDEDDDEDNFQQ----------------RNKSNRILPAEILSNGL 354

>KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON}
           Anc_8.852 YML119W
          Length = 317

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 79/168 (47%), Gaps = 17/168 (10%)

Query: 176 ICNKYFSEP-VDLNYYKDSDGKIKPVINLVSKKTQQS-IKKVYKLSVPI-NYKDTTYSGV 232
           I N+YF+E  V L+  + +DGK++P++  V ++++        KL  P+  +     + +
Sbjct: 127 ILNRYFTEDIVQLDRLRGADGKLRPLVASVKRQSKPGNSGNCVKLLRPLERHTKQRTTAL 186

Query: 233 SSLIETEYRPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIK 292
           +SL         SK  S +    + +LLF     +       N +  K  D  T   + +
Sbjct: 187 NSL-------FVSKTSSIR---GEPLLLFAGKRPVYTLSDLQNMELVKGADRPTETVEPR 236

Query: 293 LNKSSRVLKSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRM 340
             +   V  S      + + G     +NDSF+LSFDGKA+DRSDI RM
Sbjct: 237 QVEEKNVTGSKRPVDQVASGG----GHNDSFDLSFDGKAMDRSDIFRM 280

>YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative
           protein of unknown function; YML119W is not an essential
           gene; potential Cdc28p substrate
          Length = 357

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 93/205 (45%), Gaps = 30/205 (14%)

Query: 152 KNIKFTIVHDESEIDNDKKHSNDDICNKYFSEPVDLNYYKDSDGKIKP-VINLVSK-KTQ 209
           K++KF    + S I+     S      +YF++P+DL Y   S   + P + N  +K KT 
Sbjct: 125 KSLKFNQTKEVSSINEIIFPSRTCTKKRYFTKPIDL-YGTRSSTSVAPKLTNSPTKSKTN 183

Query: 210 QSIKKV---------YKLSVPINYKDTTYSGVSSLIETEYRPLYSKD----QSFKFYNKD 256
            +IKK          YKL  P++  +T       +I       + K+    Q  +     
Sbjct: 184 FNIKKCILPRSVVTTYKLPSPVH--ETIDDISKKIIILLISLKFEKNYHFLQPIQLSTNS 241

Query: 257 SVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLKL 316
              + K+LD +      S  ++ K+           L  +S+ +K++   +     G  +
Sbjct: 242 KTRISKSLDELCGVQLTSTLRQQKQ-----------LQGNSKPVKNLPNSNAKQRAGASV 290

Query: 317 TSN-NDSFELSFDGKALDRSDILRM 340
           ++N N+SFELSFDGKA+DRSDI RM
Sbjct: 291 STNANESFELSFDGKAMDRSDIFRM 315

>TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {ON}
           Anc_8.852 YML119W
          Length = 502

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 99/215 (46%), Gaps = 31/215 (14%)

Query: 152 KNIKFTIVHDESEID-NDKKHSNDDICNKYFSEPVDLNYY------------KDSDGKIK 198
           K +K   ++DE+ +   ++ +    I +KYF+  +DLN +              S  K+K
Sbjct: 231 KQLKLKEIYDENSLPVMNRMYIEQSIRSKYFNNSIDLNQFFNDSTTNTNSSNNSSMNKLK 290

Query: 199 PVINLVSKKTQQSIKKVYKLSVPINYKDTTYSG----VSSLIETEYRPLYSKDQSFKFYN 254
           P+IN + K  +   +K YKL +P+        G    ++ L+ T      S DQ  + + 
Sbjct: 291 PIINTLPKHLKNVSRKKYKLIIPLRKLQQDSKGDNKTINELMATRND---SNDQIIQSFG 347

Query: 255 KDSVL---LFKTLDAIVEK------IKASNRKETKENDANTTLEKIKLNKSSRVLKSINE 305
           K ++    L K  D ++ K      IK  N    K  ++N  L+      +++   S   
Sbjct: 348 KPNLKISDLTKDEDKLILKNYLLNTIKIVNPIHRKLINSNPHLQINPATTTAQTPASTTA 407

Query: 306 RSFINNTGLKLTSNNDSFELSFDGKALDRSDILRM 340
            +   NT   L  N  SF+LSFDGKALDRSDILRM
Sbjct: 408 TATTANTASNLIQN--SFDLSFDGKALDRSDILRM 440

>NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852
           YML119W
          Length = 316

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 49/106 (46%), Gaps = 26/106 (24%)

Query: 285 NTTLEKIKLNKSSRVLKSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMXXXX 344
           N  LE +KL   S+     + RS +N T    T  N SFELSFDGKALD+SDILR+    
Sbjct: 230 NKKLESLKLQSPSQ---KKSHRSLMNLTHQPATMEN-SFELSFDGKALDKSDILRIVDSF 285

Query: 345 XXXXXXXXXXXXXYNEQAESTFDEEFGSKENKYLRTLTNKILPAEI 390
                                 DEE  + EN+      N ILPA++
Sbjct: 286 TMAFS-----------------DEEIDTNENE-----NNNILPADL 309

>Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W
           (REAL)
          Length = 360

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 91/205 (44%), Gaps = 27/205 (13%)

Query: 152 KNIKFTIVHDESEIDNDKKHSNDDICNKYFSEPVDLNYYKDSDGKIKPVINLVSKKTQQ- 210
           K+++F    +   I +    S      +YF++P+DL   +++   + P   L+S  T+  
Sbjct: 125 KSLRFHQTKEADSIQDIPFPSRTCTAKRYFTKPIDLYGTRNNCSTVMP--GLMSSPTKSK 182

Query: 211 ---SIKK---------VYKLSVPINYKDTTYSGVSSL---IETEYRPLYSKDQSFKFYNK 255
              +IKK          YKL  P+ YK         +   I   +   Y   Q  +    
Sbjct: 183 ANFTIKKSILPRCVITTYKLPSPV-YKTIDDISKKIIILQISLNFEKSYHFLQPIQLSTN 241

Query: 256 DSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLK 315
               + K+++ +   + +       ++   + ++ +K  +++       +R+ IN  G  
Sbjct: 242 KKTRVSKSIEELCRDLLSPPPPSKSQHQLQSNIKPMKNAQNTNT----KQRTSIN-AG-- 294

Query: 316 LTSNNDSFELSFDGKALDRSDILRM 340
            T+ N+SFELSFDGKA+DRSDI RM
Sbjct: 295 -TNANESFELSFDGKAMDRSDIFRM 318

>KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 256

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 72/143 (50%), Gaps = 13/143 (9%)

Query: 199 PVINL-VSKKTQQSIKKVYKLSVPINYKDTTYSGVSSLIETEYRPLYSKDQSFKFYNKDS 257
           P IN+ +   T QS K +YK+ VPI+ K      +S +I       +   ++FK  N D+
Sbjct: 89  PKINVKLEYHTMQSSKIIYKIDVPISSKSDM--EISPVITKLINETHESAEAFKLCN-DN 145

Query: 258 VLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLKLT 317
              + TLDA+   +       +K    N +++++     ++ L +  ++        +  
Sbjct: 146 RFGYTTLDALPAVL-------SKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQEN--QFF 196

Query: 318 SNNDSFELSFDGKALDRSDILRM 340
           S NDS ELSFDGKA++++DI R+
Sbjct: 197 SANDSIELSFDGKAMNKNDIFRI 219

>SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved
           hypothetical protein
          Length = 311

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (87%)

Query: 317 TSNNDSFELSFDGKALDRSDILRM 340
           T  NDS +LSFDGKALD+SDILR+
Sbjct: 252 TCQNDSIDLSFDGKALDKSDILRI 275

>AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML119W
          Length = 299

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 93/233 (39%), Gaps = 50/233 (21%)

Query: 171 HSNDDICNKYFSEPVDLNYYKDSDGKIK--PVINLVSKKTQQSIKKVYKLSVPI--NYKD 226
           H N  +  +Y + PV     +    K+   PVINL  KK  ++    YK++ P+     D
Sbjct: 109 HENRALKLRYMAGPV-----RPEGIKVPKNPVINLSKKKAPET---YYKIAEPLLNVAHD 160

Query: 227 TTYSGVSSLIE--TEYRPLYSKDQSFKFYNKDS--VLLFKTLDAIVEKIKASNRKETKEN 282
           ++ S    L +   + R  Y + Q  +  + D   V     L  I+E+ +       + +
Sbjct: 161 SSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRS 220

Query: 283 DANTTLEKIKLNKSSRVLKSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMXX 342
            A++    +  ++   ++   N               NDS +LSFDGKA+++SD LRM  
Sbjct: 221 LASSNYSTVFQDRVDYLIVPTNA--------------NDSIDLSFDGKAINKSDFLRMM- 265

Query: 343 XXXXXXXXXXXXXXXYNEQAESTFDEEFGSKENKYLRTLTNKILPAEITGGGF 395
                            +      DEE     NK+    +  ILP +IT G +
Sbjct: 266 -----------------DSFSLALDEE--DDNNKHYDFHSRNILPRDITSGVY 299

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 19/21 (90%)

Query: 320 NDSFELSFDGKALDRSDILRM 340
           ND+ +LSFDGKA++RSDI ++
Sbjct: 219 NDTADLSFDGKAMNRSDIFKI 239

>KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {ON}
           conserved hypothetical protein
          Length = 276

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 19/21 (90%)

Query: 320 NDSFELSFDGKALDRSDILRM 340
           N+S +LSFDGKA+++SDI +M
Sbjct: 218 NESVDLSFDGKAMNKSDIFKM 238

>Kpol_1054.24 s1054 complement(56591..59692) [3102 bp, 1033 aa] {ON}
           complement(56591..59692) [3102 nt, 1034 aa]
          Length = 1033

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 253 YNKDSVLLFKTLDAIVEKIKASNRKETKENDANTTLEKIKLNKSSRVLKSINERSFINNT 312
           YN+D +LL +TL  ++E IK   RK+          +KI +   S      + RS IN  
Sbjct: 350 YNEDHILLGRTLKGVMENIKRMVRKKNSNTWGPDAWKKIVVCIVS------DGRSKINEK 403

Query: 313 GLKLTSNNDSFELSFDGKALD 333
            L L S+   ++   DG A D
Sbjct: 404 ALSLLSSLGCYQ---DGFAKD 421

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar
           to uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
           Cytoplasmic response regulator part of a two- component
           signal transducer that mediates osmosensing via a
           phosphorelay mechanism dephosphorylated form is degraded
           by the ubiquitin-proteasome system potential Cdc28p
           substrate
          Length = 776

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 114 QKPIMNG--RSMPYKNMNKQNSRALKQTKNPPNNAKNFTNK---NIKFTIVH-DESEIDN 167
           Q P+++G   +   + + +++   +++++  P+   N  NK   N    IV    S+  +
Sbjct: 617 QLPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQS 676

Query: 168 DKKHSNDDICNKYFSEPVDLNYYK---DSDGKIKPVINLVSKKTQQS 211
           DKK +    CN Y ++PV+L++     +  G ++ +IN  S K  QS
Sbjct: 677 DKKEALISGCNDYLTKPVNLHWLSNKINEWGCMQALINFDSWKEGQS 723

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,519,132
Number of extensions: 2256981
Number of successful extensions: 12450
Number of sequences better than 10.0: 503
Number of HSP's gapped: 12185
Number of HSP's successfully gapped: 594
Length of query: 395
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 283
Effective length of database: 40,638,807
Effective search space: 11500782381
Effective search space used: 11500782381
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)