Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I003308.851ON88884483e-59
TDEL0B002008.851ON86863252e-40
ZYRO0C14894g8.851ON84833224e-40
CAGL0I02706g8.851ON89843164e-39
YMR286W (MRPL33)8.851ON86833103e-38
NDAI0E002508.851ON93833104e-38
Suva_13.4768.851ON83833034e-37
Kwal_27.102098.851ON84833034e-37
SAKL0D01144g8.851ON84833001e-36
AFR450C8.851ON84832992e-36
Skud_13.4598.851ON83832956e-36
NCAS0B002608.851ON88862931e-35
KLLA0C06270g8.851ON84832895e-35
Kpol_237.28.851ON86832843e-34
Ecym_46248.851ON84832791e-33
Smik_13.5028.851ON84842703e-32
KLTH0C03630g8.851ON84832704e-32
KNAG0G034808.851ON84812513e-29
KAFR0A028708.851ON85832444e-28
TBLA0B029108.851ON85822359e-27
KLTH0A07106g6.356ON136761612.7
NDAI0C039005.274ON48965595.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00330
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...   177   3e-59
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   129   2e-40
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   128   4e-40
CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   126   4e-39
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   124   3e-38
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   124   4e-38
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   121   4e-37
Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   121   4e-37
SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   120   1e-36
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   119   2e-36
Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   118   6e-36
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   117   1e-35
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   115   5e-35
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   114   3e-34
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   112   1e-33
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   108   3e-32
KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...   108   4e-32
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...   101   3e-29
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...    99   4e-28
TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...    95   9e-27
KLTH0A07106g Chr1 (589774..593877) [4104 bp, 1367 aa] {ON} simil...    28   2.7  
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    27   5.6  

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score =  177 bits (448), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE
Sbjct: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKRETISN 88
          NQLSKEQQRELRKSNPGFTVQKRETISN
Sbjct: 61 NQLSKEQQRELRKSNPGFTVQKRETISN 88

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  129 bits (325), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 61/86 (70%), Positives = 75/86 (87%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          M FYKITLARS+IGTP   K++VK++GLGK GS+VY++ TPA AG LA VKE+VKVEVTE
Sbjct: 1  MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKRETI 86
          N+LSKE+QRELRKSNPGF V+KR+ +
Sbjct: 61 NKLSKEEQRELRKSNPGFIVEKRQLL 86

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  128 bits (322), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (86%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYK+TL+RSLIG P  ++NVVK++GLGKRGS VYR  TP  AG+LA VKE+V VEVT+
Sbjct: 1  MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
          + L+KEQQRELRKSNPGFTV+KR
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKR 83

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  126 bits (316), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 76/84 (90%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          M +YK+TL RSLIGTP   +N+VKAIGLGKRGSVVYR+ +P+MAG+LA +KE++ V+VT+
Sbjct: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKRE 84
          ++L+K+QQRELRK+NPGFTV+K+E
Sbjct: 61 SRLTKQQQRELRKTNPGFTVEKQE 84

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  124 bits (310), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 73/83 (87%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYK+TL+RSLIG P   K++VK++GLGKRGS+VY++  PA+AG+LA VKE+VKVEVTE
Sbjct: 1  MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
          ++L+  QQRELRKSNPGF V+KR
Sbjct: 61 HELTPSQQRELRKSNPGFIVEKR 83

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  124 bits (310), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 58/83 (69%), Positives = 69/83 (83%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITL RSLIG P   + +VK IGLGKRGS+VYR  TPAMAG+LA VKE++ VE+TE
Sbjct: 1  MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            L+K +QRELRKSNPGFT++KR
Sbjct: 61 KALNKMEQRELRKSNPGFTIEKR 83

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  121 bits (303), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 58/83 (69%), Positives = 71/83 (85%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITL+RSLIG P   K+VVK++GLGKRGS+VY+   PA+AG+LA VKE+V VEVTE
Sbjct: 1  MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
          ++L+  QQRELRKSNPGF V+KR
Sbjct: 61 HELTPYQQRELRKSNPGFVVEKR 83

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  121 bits (303), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITL RS IG P  +K+VV ++GLGK GSVVYR+ +P++AG++A +KE+VKV+V E
Sbjct: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            LSKEQQRELRKSNPGF V+KR
Sbjct: 61 QALSKEQQRELRKSNPGFIVEKR 83

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITLARS IG P   K++VK++GLGKRGS VYR  TP++AG++  +KE+V +EVTE
Sbjct: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            LSKE+QRELRKSNPGF V+KR
Sbjct: 61 KALSKEEQRELRKSNPGFVVEKR 83

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITLARS IG P  +K VV ++GLGKRG+ VYR+ +P  AG++A +KE+VKVEVTE
Sbjct: 1  MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
          + L+KE+QR LRKSNPGFTV+KR
Sbjct: 61 HALTKEEQRMLRKSNPGFTVEKR 83

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  118 bits (295), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITL RSLIG P   K++VK++GLGKRGS+ Y+   PA+AG+LA VKE++ +EVTE
Sbjct: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
          ++L+  QQRELRKSNPGF V+KR
Sbjct: 61 HELTSTQQRELRKSNPGFVVEKR 83

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 53/86 (61%), Positives = 72/86 (83%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MV+YKITLARS+IG P   +++VK +GLGKRGSV+YR+ TPA+AG++  VKEI+ VEVT+
Sbjct: 1  MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKRETI 86
          + L+K +QR+LRKSNPGF V+KR  +
Sbjct: 61 DSLNKFEQRQLRKSNPGFVVEKRSDL 86

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  115 bits (289), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFY+ITL RS+IGTP   + VVK++GLGKRGSV Y+ ATP++AG +A +KE+V VE+ +
Sbjct: 1  MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            LSK +QRELRKSNPGFTV+KR
Sbjct: 61 KALSKAEQRELRKSNPGFTVEKR 83

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  114 bits (284), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 67/83 (80%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          M FYKITL RSLIG P   +N+VK IGLGKRGS+VYRE TP++AG+LA VKE+V VE+++
Sbjct: 1  MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            L++E+    RKSNPGFTV+KR
Sbjct: 61 KMLTREEVNASRKSNPGFTVEKR 83

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  112 bits (279), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 66/83 (79%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKI L+RS IG P   + VVK++GLGKRGSVVY   +P +AG +A VKE+V VEVT+
Sbjct: 1  MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            LSKE+QR+LR SNPG+TV+KR
Sbjct: 61 KALSKEEQRQLRTSNPGYTVEKR 83

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  108 bits (270), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 66/84 (78%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          M FYKI L RSLIG P   K++VK++GLGKRGS+VY+   PA+AG+LA VKE+V V+VT+
Sbjct: 1  MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKRE 84
          ++L+  QQR LR SNPGF V+KR 
Sbjct: 61 HELTPSQQRVLRMSNPGFVVEKRS 84

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (87%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYKITL+RS IG P   K+VV ++GLGK GSVVYR+ TP++AG++A VKE+V+VEVTE
Sbjct: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
          + L+KEQQRELRKSNPGFTV+KR
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKR 83

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score =  101 bits (251), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (77%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MVFYK+TLARSLIG P   + +VK +GLGKRGS VY+ ATPA+AG+L  VKE++ VEV+ 
Sbjct: 1  MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP 60

Query: 61 NQLSKEQQRELRKSNPGFTVQ 81
           ++SK + R  RKSNPG+ V+
Sbjct: 61 QKVSKGEMRLARKSNPGYVVE 81

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score = 98.6 bits (244), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 63/83 (75%)

Query: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60
          MV+Y+ TL RSLIG P   + +VK +G  KRGS +YR+ TPA+ G+L  VKE++ +++TE
Sbjct: 1  MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE 60

Query: 61 NQLSKEQQRELRKSNPGFTVQKR 83
            ++K +QRE+RKSNPG+ V+KR
Sbjct: 61 KSVTKAEQREIRKSNPGYIVEKR 83

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score = 95.1 bits (235), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 63/82 (76%)

Query: 2  VFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTEN 61
          +FYKITL RSLIG P   +++VK++GLGKRGS+ Y++ +P+ AG +  VKE+V VE+T+ 
Sbjct: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60

Query: 62 QLSKEQQRELRKSNPGFTVQKR 83
           L+K +  + R+SNPGF ++KR
Sbjct: 61 ALTKAEVHDSRRSNPGFIIEKR 82

>KLTH0A07106g Chr1 (589774..593877) [4104 bp, 1367 aa] {ON} similar
           to uniprot|P25648 Saccharomyces cerevisiae YCR081W SRB8
           RNA polymerase II mediator complex subunit
          Length = 1367

 Score = 28.1 bits (61), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 9/61 (14%)

Query: 37  REATPAMAGTLA-MVKEIVKVE------VTENQLSKEQQRELRK--SNPGFTVQKRETIS 87
           +E+ PA++G LA  + ++V++       +T N  S  ++  +    S PGF++ KR T++
Sbjct: 67  QESLPAVSGLLADQLSDVVRIREEKINRITANSTSSAKKSGMPSDLSGPGFSLPKRVTLT 126

Query: 88  N 88
           +
Sbjct: 127 D 127

>NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa]
          {ON} Anc_5.274
          Length = 489

 Score = 27.3 bits (59), Expect = 5.6,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 12 LIGTPPYIKN----VVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTENQLSKEQ 67
          L+   P+I +    +VKAIG G  G +   + T A+  T+  +K+I       ++ +K  
Sbjct: 11 LVLNQPFIVDKGFEIVKAIGKGSFGLICSAKYTEAVDSTMVAIKQI-DSAFQNSRTAKRA 69

Query: 68 QRELR 72
           REL+
Sbjct: 70 LRELK 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,927,446
Number of extensions: 237211
Number of successful extensions: 928
Number of sequences better than 10.0: 26
Number of HSP's gapped: 928
Number of HSP's successfully gapped: 26
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)