Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I003208.850ON52952925160.0
Kpol_237.18.850ON50346016930.0
ZYRO0C14872g8.850ON49643716380.0
NCAS0C003108.850ON55644316400.0
TDEL0B001908.850ON49244116300.0
CAGL0I02684g8.850ON49344116230.0
Suva_13.4758.850ON51548716200.0
TBLA0B029008.850ON52044116210.0
SAKL0D01166g8.850ON50543816170.0
KAFR0L019608.850ON51144316080.0
Skud_13.4588.850ON51449216010.0
Smik_13.5018.850ON51548716000.0
YMR285C (NGL2)8.850ON51544215960.0
NDAI0K003708.850ON56842715990.0
KLTH0C03608g8.850ON49544115250.0
KLLA0C06248g8.850ON51644514710.0
Kwal_27.102048.850ON49443814660.0
KNAG0K006508.850ON48244814530.0
ABL118W8.850ON50442513930.0
Ecym_46198.850ON48742513221e-179
NDAI0E002608.850ON49845311711e-156
NCAS0B002708.850ON47644611491e-153
TBLA0D033008.850ON48045011151e-148
CAGL0B02387g8.850ON4714509571e-124
Suva_13.258.850ON5024529581e-124
YML118W (NGL3)8.850ON5054569431e-121
Skud_13.238.850ON4984559351e-120
Smik_13.168.850ON5024549341e-120
KAFR0A028608.850ON4784359101e-117
KNAG0G034708.850ON4664378511e-108
KLTH0D02310g7.78ON7392361957e-15
KLLA0F15884g7.78ON7902281931e-14
KNAG0D048407.78ON7792361912e-14
SAKL0B10032g7.78ON7312711902e-14
ZYRO0D05302g7.78ON8572361903e-14
TDEL0H037307.78ON7972421903e-14
Suva_1.457.78ON8312401893e-14
Ecym_73547.78ON7852311884e-14
ACR288W7.78ON7362391851e-13
YAL021C (CCR4)7.78ON8372191841e-13
Kwal_26.71127.78ON7422441841e-13
Skud_1.407.78ON8692411832e-13
CAGL0H06149g7.78ON8732711822e-13
Smik_1.457.78ON8392401805e-13
TPHA0H026807.78ON8722661724e-12
NDAI0H025207.78ON8982191724e-12
Kpol_1040.147.78ON7842241681e-11
TBLA0A046607.78ON8962671681e-11
KAFR0K006707.78ON7952201644e-11
NCAS0F016407.78ON8552311538e-10
KLTH0D02574g7.90ON3682471365e-08
ACR277C7.90ON3782391312e-07
Kwal_26.71707.90ON3722481285e-07
TBLA0E022607.90ON3882651223e-06
KAFR0D012507.90ON3562391188e-06
KLLA0F07733g7.90ON3712361171e-05
SAKL0B09768g7.90ON3682481161e-05
CAGL0F01001g7.90ON3592371161e-05
KNAG0L005507.90ON3812421133e-05
ZYRO0D05588g7.90ON3562521062e-04
TDEL0H036007.90ON3662381043e-04
Kpol_1044.67.90ON372252970.002
YOL042W (NGL1)7.90ON36385930.008
Skud_15.1157.90ON36384920.011
Ecym_26367.90ON367238910.013
Smik_15.1257.90ON36385910.014
NDAI0A085307.90ON365250890.027
TPHA0L005307.90ON39185870.053
Suva_15.1277.90ON36381860.056
NCAS0I005007.90ON38977830.16
AER107W4.301ON63680706.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00320
         (529 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   973   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   656   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   635   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      636   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   632   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   629   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   628   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   629   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   627   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   624   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   621   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   620   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   619   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   620   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   592   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   571   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   569   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   564   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   541   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   513   e-179
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   455   e-156
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      447   e-153
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   434   e-148
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   373   e-124
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   373   e-124
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   367   e-121
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   364   e-120
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   364   e-120
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   355   e-117
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   332   e-108
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    80   7e-15
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    79   1e-14
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    78   2e-14
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    78   2e-14
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    78   3e-14
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    78   3e-14
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    77   3e-14
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    77   4e-14
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    76   1e-13
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    75   1e-13
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    75   1e-13
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    75   2e-13
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    75   2e-13
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    74   5e-13
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    71   4e-12
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      71   4e-12
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    69   1e-11
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    69   1e-11
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    68   4e-11
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      64   8e-10
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    57   5e-08
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    55   2e-07
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    54   5e-07
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    52   3e-06
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    50   8e-06
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    50   1e-05
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    49   1e-05
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    49   1e-05
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    48   3e-05
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    45   2e-04
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    45   3e-04
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    42   0.002
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    40   0.008
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    40   0.011
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    40   0.013
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    40   0.014
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    39   0.027
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    38   0.053
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    38   0.056
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    37   0.16 
AER107W Chr5 (838830..840740) [1911 bp, 636 aa] {ON} Syntenic ho...    32   6.1  

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/529 (89%), Positives = 474/529 (89%)

Query: 1   MSTRRDDDGDGVTEVAEGLEKKVYVSEKPKLDGSTFIEKVVVKEPFGDASAXXXXXXXXX 60
           MSTRRDDDGDGVTEVAEGLEKKVYVSEKPKLDGSTFIEKVVVKEPFGDASA         
Sbjct: 1   MSTRRDDDGDGVTEVAEGLEKKVYVSEKPKLDGSTFIEKVVVKEPFGDASAKKQKSKGKG 60

Query: 61  XXXXXXIPSPXXXXXXXXXXXXXXXXKQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPE 120
                 IPSP                KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPE
Sbjct: 61  KGKGKSIPSPEEIARIRAERAAAREEKQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPE 120

Query: 121 KSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQ 180
           KSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQ
Sbjct: 121 KSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQ 180

Query: 181 FQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTK 240
           FQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTK
Sbjct: 181 FQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTK 240

Query: 241 TNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVK 300
           TNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVK
Sbjct: 241 TNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVK 300

Query: 301 EFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTS 360
           EFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTS
Sbjct: 301 EFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTS 360

Query: 361 YTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNM 420
           YTYSKLRN            NIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNM
Sbjct: 361 YTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNM 420

Query: 421 KATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXX 480
           KATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDC      
Sbjct: 421 KATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCKEVEDF 480

Query: 481 XXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIELNP 529
                 NHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIELNP
Sbjct: 481 EKFEKKNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIELNP 529

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/460 (66%), Positives = 360/460 (78%), Gaps = 3/460 (0%)

Query: 68  PSPXXXXXXXXXXXXXXXXKQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTL 127
           PSP                K+K++LA GLDPD PPELQFI+RP+L LH DEP   F FTL
Sbjct: 45  PSPEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTL 104

Query: 128 MTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQE 187
           MTYNCLAQALIRRKLFPDSGEAVKW+RRS+VLL EF++YN D+ICLQEIDHIQ+Q+FW+ 
Sbjct: 105 MTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKV 164

Query: 188 EFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLI 247
           EF+K+GY SQFHRI SKNHGVAIVWK  +F++TDRMLIDFDKE S DI PRT+TNNTGLI
Sbjct: 165 EFEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLI 224

Query: 248 LSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVN 307
           LSLK+SD +L+  P+  N   +GIIIGTTHLFWHPFGTYERTRQC+VLLNK+KEF  RVN
Sbjct: 225 LSLKFSDKILSTLPK--NTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVN 282

Query: 308 VLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLR 367
           VLQN NDG++ HW  FFCGDFNSQPFD+PYLS+TSKP+EY ERAK VI+CSTSY +SKLR
Sbjct: 283 VLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLR 342

Query: 368 NXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYA 427
           N            NIEKFGKDQPQTPVP+++    EQ  LV +M  +HN L M+A SLY+
Sbjct: 343 N-GEEDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYS 401

Query: 428 VGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXN 487
           VGYK VH EN+G+DN +GEP ISNWA++WRGLLDYIF+V+ WDF +             N
Sbjct: 402 VGYKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIEN 461

Query: 488 HMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
            ++LRG+LRMP  +EM K+GQPH+GEY SDHLSM+C IEL
Sbjct: 462 SIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIEL 501

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/437 (66%), Positives = 348/437 (79%), Gaps = 4/437 (0%)

Query: 91  MLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAV 150
           M+A G+DPD PPELQFI+RP+L LH  E  + F F LMTYNCLAQALIRRKLFP SG+A+
Sbjct: 62  MMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDAL 121

Query: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210
           KWYRRS+VLLNEFKYYN D+ICLQEID+IQ+QSFW++E  K+GY SQFHR  SKNHGVAI
Sbjct: 122 KWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAI 181

Query: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270
           VWK   F +TD+MLIDFD+E SGDI PRT TNN GLILSLK+SD V  ++    N  K+G
Sbjct: 182 VWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH----NLKKTG 237

Query: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
           II+GTTHLFWHPFGT+ERTRQC+V+LNKVKEF  RVNVLQN NDG+  HW  FFCGDFNS
Sbjct: 238 IIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNS 297

Query: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQP 390
           QPFD+PYLS+T KP+EY +RAK VIECSTSYT+SK+R+            NIEKFG DQP
Sbjct: 298 QPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQP 357

Query: 391 QTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS 450
             PVP  Y     + +LV +M+SLHNSL+M+A SLY+V Y+KVHPEN+GLDN++GEPEIS
Sbjct: 358 DHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEIS 417

Query: 451 NWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPH 510
           NWAH+WRGLLDY+F++ HWDFSDC            N +K+RG LR+PP  EM+++GQPH
Sbjct: 418 NWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPH 477

Query: 511 QGEYPSDHLSMMCKIEL 527
            GEYPSDHL M+C++EL
Sbjct: 478 TGEYPSDHLCMLCELEL 494

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/443 (66%), Positives = 352/443 (79%), Gaps = 5/443 (1%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           K++  LA GLDP+  P+LQFI+RP+L LH++EP   F  ++MTYNCLAQALIRRKLFPDS
Sbjct: 116 KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDS 175

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           G+A+KW++RS+VL NEFK+YNPD+ICLQEIDH+Q+QSFW+ EF+K+GY SQFHR  SKNH
Sbjct: 176 GDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNH 235

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           GVAI+W+  LF LTD+MLIDFDKE SG+I PRT TNN GL LSLK+++  L+K+      
Sbjct: 236 GVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFS--NGT 293

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
           ++ GII+GTTHLFWHPFGTYERTRQC+V+LNK+KEF  R+NVLQNNNDG+  HW  FFCG
Sbjct: 294 SRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCG 353

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFDTPYLS+TSKP+ YK RAK VIECSTSY +SK R+            NIEKFG
Sbjct: 354 DFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRD-GEEDADEEEGGNIEKFG 412

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
           KDQPQTPVPD +    EQ  LV  ME LHNSL+M+A SLY VGY+KVHPEN+GLDN  GE
Sbjct: 413 KDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGE 472

Query: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSK- 505
           PEISNWAH+W GLLDYI ++ HW F DC            N +K+RGYLRMPP+TEMSK 
Sbjct: 473 PEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKH 532

Query: 506 -YGQPHQGEYPSDHLSMMCKIEL 527
            +GQPH GEYPSDHLSM+C++EL
Sbjct: 533 GHGQPHTGEYPSDHLSMICELEL 555

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/441 (65%), Positives = 356/441 (80%), Gaps = 4/441 (0%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           K+++MLA G+DPD PPELQFI+RPLLTLH+DEP +  +F L+TYNCLAQALIRRKLFPDS
Sbjct: 54  KREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLTYNCLAQALIRRKLFPDS 113

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           G+++KW+RRS+VL  EFK+YN D++CLQEID+IQ+Q FW++E  K+GY +QF++   KNH
Sbjct: 114 GDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNH 173

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           GV+I WK +LF+LTDRMLID+DKE SG I  RT T+N+GLIL+LK++D+     P +   
Sbjct: 174 GVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCPHI--- 230

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
            KSGI++GT+HLFWHPFGTYERTRQC+V+L K+KEF KRVNVLQNNNDGN+ HW  FFCG
Sbjct: 231 RKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCG 290

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFDTPYLS+TSKPVEY  RAK V+ECSTSYT+SKLRN            NIEKFG
Sbjct: 291 DFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRN-GEEDAEDEEGGNIEKFG 349

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
           KDQPQTPVP+++  TPEQ  LV +M+ LHNS++M+A SLYAVGY +VHPENSG+DN +GE
Sbjct: 350 KDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGE 409

Query: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKY 506
           PE+SNWA++WRGLLDYI  +  WD SD             N +KLRG LRMPPA+EMS +
Sbjct: 410 PEMSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHH 469

Query: 507 GQPHQGEYPSDHLSMMCKIEL 527
           GQPH+GEY SDHLSMMC IEL
Sbjct: 470 GQPHEGEYASDHLSMMCTIEL 490

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/441 (65%), Positives = 353/441 (80%), Gaps = 2/441 (0%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           K+++ML  G+DPDCPPELQFIRR +L LH++EP +     +M+YNCLAQALIRRKLFPDS
Sbjct: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           GEA+KWYRRSRVLLNEFK+Y+PD++CLQEID+IQ+QSFW+EEF+K+GY+SQFHR  SKNH
Sbjct: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           GV I+WK+  F ++DRMLIDFD E SGDI PRT TNN  LIL+LK++  V     +L  +
Sbjct: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLL-D 232

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
           +KSGI++GTTHLFWHPFGTYERTRQC+V+LNK+KEF  RVNVLQNNNDG+M HW  FFCG
Sbjct: 233 DKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCG 292

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFD+PYLS+T KP++Y  RAK VIECSTS+ +SK R             NIEKFG
Sbjct: 293 DFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRE-SGEDAEDEEGGNIEKFG 351

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
           KDQPQTPVP+ +    EQ  LVS+ME LHNSL+M+A SLY+V Y KVHPENSGLDN++GE
Sbjct: 352 KDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGE 411

Query: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKY 506
           PEISNWAH+WRGLLDY+F + +W+F D             N++K+RG LRMPP +EMS +
Sbjct: 412 PEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTH 471

Query: 507 GQPHQGEYPSDHLSMMCKIEL 527
           GQPH GEYPSDHL ++ ++EL
Sbjct: 472 GQPHVGEYPSDHLCLLSEVEL 492

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/487 (59%), Positives = 362/487 (74%), Gaps = 3/487 (0%)

Query: 42  VKEPFGDASAXXXXXXXXXXXXXXXIPSPXXXXXXXXXXXXXXXXKQKKMLANGLDPDCP 101
           +K+  GD S                + +P                K+  MLA G+DPDCP
Sbjct: 29  LKQQVGDNSKNQTKKKGNKGKKSKPVVTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCP 88

Query: 102 PELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLN 161
           PEL FI+RP L+LH++EP   F F LMTYNCLAQALIRRKLFPDSG+A+KWYRRSRVLLN
Sbjct: 89  PELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLN 148

Query: 162 EFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTD 221
           EF++YN D+ICLQEIDHIQFQSFW+EEF K+GY  Q+HR  +KNHGVAI+W+ ++F+  D
Sbjct: 149 EFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVD 208

Query: 222 RMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWH 281
           +MLIDFDKE+SG+I  RT TNN GL+L+LK+S+ VL+   +  ++ KSGI+IGT+HLFWH
Sbjct: 209 KMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGK-ASSKKSGILIGTSHLFWH 267

Query: 282 PFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSIT 341
           PFGTYERTRQC+++L K++EF  RVNVLQN NDG++ HW  FFCGDFNSQPFDTPYLS+T
Sbjct: 268 PFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMT 327

Query: 342 SKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTPT 401
            KPV Y++RAK VIECSTS+ +SK+R+            NIEKFGKDQP++PVP  +   
Sbjct: 328 CKPVHYEKRAKTVIECSTSFKFSKVRD-GEEGADEEEGGNIEKFGKDQPESPVPKDFHAN 386

Query: 402 PEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLD 461
            EQ +LV +M  LHNSL+M+A SLY+V YK VHPEN+GLDN +GEPEISNWA++WRGLLD
Sbjct: 387 EEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLD 446

Query: 462 YIFYVDHWDF-SDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLS 520
           Y+FY+  WD  S+C            N +K RG+LRMPP +EM+K+GQPH GEY SDHLS
Sbjct: 447 YLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLS 506

Query: 521 MMCKIEL 527
           M+C IEL
Sbjct: 507 MVCDIEL 513

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/441 (64%), Positives = 352/441 (79%), Gaps = 4/441 (0%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           K+  +LA G+DPDCP ELQFI+RP+L +H++EP K F F+LMTYNCLAQALIRRKLFP+ 
Sbjct: 82  KRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEG 141

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           G+A+KW+RRS+VLLNEFK+YNPD+ICLQEIDH+Q+QSFW+EEF K+GY  QF++  SKNH
Sbjct: 142 GDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNH 201

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           GV++VWK  LF +TDRML+D+DKELSGDI PRT TNN  L+LSLK+S  V  ++P+  N 
Sbjct: 202 GVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPK--NI 259

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
           NK+GI+IGTTHLFWHPFGTYERTRQC+++LNK+KEF  RVN+LQNN D +  HW  FFCG
Sbjct: 260 NKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCG 319

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFD+PYLS+TSKP++Y  R+K VIECSTS+ +SK R+            NIEKFG
Sbjct: 320 DFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRD--GEEGDDEEGGNIEKFG 377

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
           KDQPQ PVPD Y    EQ  LV+KM+ LHNSL+M+A SLY+ GY KVHPENSG+DN++ E
Sbjct: 378 KDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNE 437

Query: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKY 506
           PEISNWAH WRGLLDY+FY+  WDF+              N +K+RGYLRMPPA E+  +
Sbjct: 438 PEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSH 497

Query: 507 GQPHQGEYPSDHLSMMCKIEL 527
           GQP +GEYPSDHL M+C++EL
Sbjct: 498 GQPFEGEYPSDHLCMLCEVEL 518

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/438 (66%), Positives = 350/438 (79%), Gaps = 5/438 (1%)

Query: 91  MLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAV 150
           MLA+GLDP+ PP+LQFI+RPLL LH++EP K F F +MTYN LAQALIRRKLFP SG AV
Sbjct: 72  MLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAV 131

Query: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210
           KW++RS+VLLNEFK+Y+ D+ CLQEIDHIQ+Q+FW+EEF+K+GYASQFHRI +KNHGVAI
Sbjct: 132 KWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAI 191

Query: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270
           VW+ +LF + D ML+D+DKE SGDI PRT T N GLIL+LK++D VL ++P      KSG
Sbjct: 192 VWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFP---GTKKSG 248

Query: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
           I+IGTTHLFWHPFGT+ERTRQC+V+LNK+KE   RVNVLQNN D +  HW  F CGDFNS
Sbjct: 249 ILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNS 308

Query: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQP 390
           QPFDTPYLS+TSKPV Y+ RAK VIECSTS+T+SKLR+            NIEKFGK QP
Sbjct: 309 QPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRD--GEEGEDEEGGNIEKFGKGQP 366

Query: 391 QTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS 450
           + PVP  +  T EQ  LV +MESLHNSL+M+A SLYAVGYK VHPEN+GLDN  GEPEIS
Sbjct: 367 EHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEIS 426

Query: 451 NWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPH 510
           NWA +WRGLLDYIF+V +W+ +D             N +K+RG LRMPP  EM+K+GQPH
Sbjct: 427 NWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPH 486

Query: 511 QGEYPSDHLSMMCKIELN 528
           +GEYPSDHLSMMC+IELN
Sbjct: 487 EGEYPSDHLSMMCEIELN 504

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/443 (66%), Positives = 344/443 (77%), Gaps = 6/443 (1%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           KQ+ MLA GLDPD PPELQFIRRPLL L   E    F F +MTYNCLAQALIRRKLFPDS
Sbjct: 71  KQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMTYNCLAQALIRRKLFPDS 130

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           GEAVKW+RRS+VLLNEFKYY+ D+ICLQE+D IQFQ+FW+EEF K+GY SQFH   SKNH
Sbjct: 131 GEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNH 190

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           G++I+WK +LF +TD+MLID+DKE+SG+I PRT TNN GL+L+LK+S  VL ++P   N 
Sbjct: 191 GISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKVLERFP---NT 247

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
            KSGII+GTTHLFWHPFGTYERTRQC+++LNK KEF  RVNVLQNNND   DHW  FF G
Sbjct: 248 RKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGG 307

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFDTPYLS+TSKPV+Y  RAK VIECSTSYT+SK R+            NIEKFG
Sbjct: 308 DFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRD-GEEDAEDEEGGNIEKFG 366

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
           KDQP TPVP  +  + EQ  LV+ ME LHNSL+M+A SLY+VGY  VH EN+GLDN +GE
Sbjct: 367 KDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGE 426

Query: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKY 506
           PEISNWAH+W GLLDY+F +  WDFSD             N +K++ +L+MP   EM K+
Sbjct: 427 PEISNWAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKF 486

Query: 507 --GQPHQGEYPSDHLSMMCKIEL 527
             GQPH GEYPSDHLSM+CK+EL
Sbjct: 487 GHGQPHVGEYPSDHLSMICKLEL 509

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/492 (60%), Positives = 365/492 (74%), Gaps = 3/492 (0%)

Query: 37  IEKVVVKEPFGDASAXXXXXXXXXXXXXXXIPSPXXXXXXXXXXXXXXXXKQKKMLANGL 96
           IE V +K+  GD S                I +P                K+  MLA+G+
Sbjct: 23  IESVNIKQQTGDDSVVQAKRKAKKGKKSKPIVTPEHIAKVRAEREAMRKAKRDAMLAHGV 82

Query: 97  DPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRS 156
           DPDCPPEL FI+RPLL+L + EP   F F LMTYNCLAQALIRRKLFPDSG+A+KW+RRS
Sbjct: 83  DPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRS 142

Query: 157 RVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNL 216
           +VLLNEFKYYN D+ICLQE+DHIQFQSFW+ +F KMGY  Q+HR  +KNHGVAI+W+ ++
Sbjct: 143 KVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSM 202

Query: 217 FRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTT 276
           F+  D+MLID+DKE SG IL RT TNN GL+L+LK+S  VL+K     ++ K GI+IGTT
Sbjct: 203 FQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKL-GKKSSKKCGILIGTT 261

Query: 277 HLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTP 336
           HLFWHPFGTYERTRQC+V+L K+KEF  RVNVLQN+NDG++ HW  FFCGDFNSQPFDTP
Sbjct: 262 HLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTP 321

Query: 337 YLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPD 396
           YLS+TSKPV YK RAK VIECSTS+ +SK+R+            NIEKFGKDQP++PVP+
Sbjct: 322 YLSMTSKPVHYKSRAKTVIECSTSFKFSKVRD-GEEGADDEEGGNIEKFGKDQPESPVPE 380

Query: 397 SYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSW 456
           ++    EQ ++V  M  LHNSL+M+A SLY+VGYK VHPEN+GLDN +GEPEISNWA++W
Sbjct: 381 NFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTW 440

Query: 457 RGLLDYIFYVDHWDF-SDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYP 515
           RGLLDY+FY+  WD  S+             N +K RG+LRMPPA+EM+K+GQPH GEYP
Sbjct: 441 RGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYP 500

Query: 516 SDHLSMMCKIEL 527
           SDHLSM+C +EL
Sbjct: 501 SDHLSMVCDLEL 512

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/487 (60%), Positives = 355/487 (72%), Gaps = 3/487 (0%)

Query: 42  VKEPFGDASAXXXXXXXXXXXXXXXIPSPXXXXXXXXXXXXXXXXKQKKMLANGLDPDCP 101
           ++ P GD S                I +P                K+  MLA G+DPDCP
Sbjct: 29  IRHPTGDGSIPQTKKKGKKGKKSKPIVTPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCP 88

Query: 102 PELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLN 161
           PEL FI+RP L LH+ EP   F F LMTYNCLAQALIRRKLFPDSG+A+KWYRRSRVLLN
Sbjct: 89  PELHFIKRPFLVLHEKEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLN 148

Query: 162 EFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTD 221
           EFKYY  D+ICLQEIDHIQFQSFW++EF K+GY  Q++R  +KNHGVAI+W+  +F+  D
Sbjct: 149 EFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVD 208

Query: 222 RMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWH 281
           +MLID+DKE S +I  RT TNN GL+L+LK+S+ VL+      ++ K GI+IGTTHLFWH
Sbjct: 209 KMLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNL-SKSSSKKCGILIGTTHLFWH 267

Query: 282 PFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSIT 341
           PFGTYERTRQC+V+L K+KEF  RVNVLQN NDG++ HW  FFCGDFNSQPFDTPYLS+T
Sbjct: 268 PFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMT 327

Query: 342 SKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTPT 401
           SKPV YK RAK VIECSTS+ +SK R+            NIEK+GKDQP++PVP++Y   
Sbjct: 328 SKPVHYKNRAKTVIECSTSFKFSKARD-GDESADDEEGGNIEKYGKDQPESPVPENYHAN 386

Query: 402 PEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLD 461
            EQ +LV KM  LHNSL+M+A SLY+VGY+ VHPEN+GLDN +GEPEISNWA++WRGLLD
Sbjct: 387 EEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEISNWANTWRGLLD 446

Query: 462 YIFYVDHWDF-SDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLS 520
           Y+FYV  WD  S+C            N MK RG+LRMPP  EM+K+GQPH GEY SDHLS
Sbjct: 447 YLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLS 506

Query: 521 MMCKIEL 527
           M+C +EL
Sbjct: 507 MVCDLEL 513

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/442 (64%), Positives = 347/442 (78%), Gaps = 3/442 (0%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           K+  MLA G+DPDCPPEL FIRRP L+LH+ EP   F F LMTYNCLAQALIRRKLFPDS
Sbjct: 74  KRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCLAQALIRRKLFPDS 133

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           G+A+KWYRRS+VLLNEFKYYN D+ICLQEIDHIQFQSFW++EF K+GY  Q++R  +KNH
Sbjct: 134 GDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNH 193

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           GVAI+W+  LF   D+MLID+DKE S  I  RT TNN GL+L+LK+S+ VL+   +  ++
Sbjct: 194 GVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGK-KSS 252

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
            K GI+IGTTHLFWHPFGTYERTRQC+++L K+KEF  RVNVLQN NDG++ HW  FFCG
Sbjct: 253 KKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCG 312

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFDTPYLS+TSKPV Y+ RAK VI CSTSY +SK+R+            NIEK+G
Sbjct: 313 DFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRD-GEEGADDEEGGNIEKYG 371

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
           KDQP++PVP+ +    EQ++LV KM  LHNSL+M+A SLY+VGYK VHPEN+GLDN +GE
Sbjct: 372 KDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRGE 431

Query: 447 PEISNWAHSWRGLLDYIFYVDHWD-FSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSK 505
           PEISNWA++WRGLLDY+FYV  WD  S+C            N +K RG+LRMPP  EM+K
Sbjct: 432 PEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTK 491

Query: 506 YGQPHQGEYPSDHLSMMCKIEL 527
           +GQPH GEY SDHLSM+C +EL
Sbjct: 492 HGQPHVGEYASDHLSMVCDLEL 513

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/427 (66%), Positives = 338/427 (79%), Gaps = 2/427 (0%)

Query: 101 PPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLL 160
           PPELQFI+RP+L LH++EP + F F++MTYNCLAQALIRRKLFPDSG+A+KWYRRS+VLL
Sbjct: 143 PPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLL 202

Query: 161 NEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLT 220
           NEF YY+PD+ICLQE+DHIQ+QSFW+ EF+K+GY SQ+HR   KNHGV+I+W+ +LF +T
Sbjct: 203 NEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMT 262

Query: 221 DRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFW 280
           D+MLI+FDKE SG++ PRT TNN GLILSLK++    A++  +    K+GIIIGTTHLFW
Sbjct: 263 DKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNV-ETTKTGIIIGTTHLFW 321

Query: 281 HPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSI 340
           HPFGTYERTRQC+V+LNK+KEF  RVNVLQNNND ++ HW  FFCGDFNSQPFD+PYLS+
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 341 TSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTP 400
             KPVEY  RAK VIECSTSY +SK R             NIEKFG DQPQTPVP+ +  
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKR-DGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIA 440

Query: 401 TPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLL 460
             EQ  LV  ME LHNSLNM+A SLY VGYK VHPEN+ +DN+ GEPEISNWAH+W GLL
Sbjct: 441 NGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLL 500

Query: 461 DYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLS 520
           DY+ +V  W FSDC            N M++RG+LRMPPA EM+K+GQPH GEYPSDHLS
Sbjct: 501 DYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLS 560

Query: 521 MMCKIEL 527
           M+C IEL
Sbjct: 561 MLCSIEL 567

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/441 (62%), Positives = 337/441 (76%), Gaps = 5/441 (1%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           K++ M+A GLDPD PP+LQFI RP+L+L+  E    F F LMTYNCLAQALIRRKLFP S
Sbjct: 58  KREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTS 117

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           G A+KW++RSRVLLNEF +YN D++CLQE+D+IQ+QSFW+EEF+K+GY SQFHR  +KNH
Sbjct: 118 GNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNH 177

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           G+AIVWK ++F + D+MLID+DKE SG + PRT T N GL ++L ++  VLAKYP    +
Sbjct: 178 GIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYP---GS 234

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
           +K GII+GTTHLFWHPFGT+ERTRQC+V+LNK+KEF  R+NVLQ+      + W  FFCG
Sbjct: 235 SKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCG 294

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFG 386
           DFNSQPFDTPYLS++SKPV YK RAK VIECSTSYT+SK R+            NIEKFG
Sbjct: 295 DFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARD--GEECDDEEGGNIEKFG 352

Query: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446
             QP+ PVP+ ++ T EQ  LV  M SLHNSL+M+  S+Y+VGYK VH EN+GLDN   E
Sbjct: 353 DGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNE 412

Query: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKY 506
           PEISNWA +WRGLLDYIF++  WDFSD             N +K+RG LRMPPA EM  +
Sbjct: 413 PEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNH 472

Query: 507 GQPHQGEYPSDHLSMMCKIEL 527
           GQPH+GEY SDHLSMMC++EL
Sbjct: 473 GQPHEGEYGSDHLSMMCELEL 493

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/445 (59%), Positives = 333/445 (74%), Gaps = 9/445 (2%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFT----FTLMTYNCLAQALIRRKL 142
           K++ ++A G+DP  P +L+FI+RP+L +  D   +S       ++MTYNCLAQALIRR L
Sbjct: 75  KKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTL 134

Query: 143 FPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIH 202
           FP SG AVKW++RS+VLLNEFKYYN D++CLQEID +Q++SFW+ EF K+GY  QFH   
Sbjct: 135 FPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNP 194

Query: 203 SKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPE 262
           +KNHGV I WK +LF +TD+MLID+DKE +G I PRT T N G++LSLK+   VL KYP 
Sbjct: 195 TKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYP- 253

Query: 263 LGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTA 322
             +   SGIIIGTTHLFWHPFGTYERTRQC+++L KVKEF+ R+NVLQN  DG+  HW A
Sbjct: 254 --DTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPA 311

Query: 323 FFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNI 382
           FFCGDFNSQPFD PYLSITSKPVEY  RAK VIECSTS+T+SKLR+            NI
Sbjct: 312 FFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRD--GDEGEGEEGGNI 369

Query: 383 EKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDN 442
           EKFGK QP+TPVP+S++   EQ  L   M++LHN ++M+A SLY++ Y KVHPENSGLDN
Sbjct: 370 EKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDN 429

Query: 443 KKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATE 502
           K+ EPEISNWAH+WRGLLDY++YV  WD  DC              +++   LR+PPA E
Sbjct: 430 KRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKE 489

Query: 503 MSKYGQPHQGEYPSDHLSMMCKIEL 527
           M+++GQPH+GEYPSDHL M+ K+ +
Sbjct: 490 MTEHGQPHEGEYPSDHLCMIVKLGI 514

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/438 (61%), Positives = 329/438 (75%), Gaps = 6/438 (1%)

Query: 91  MLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAV 150
           MLA GLDP+ PP+LQFI RP+L L  +   + F F +MTYNCLAQALIRRKLFP SG A+
Sbjct: 62  MLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNAL 121

Query: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210
           KW++RSRVLLNEF +Y  D+ CLQEID+IQ+QSFW+EEF K+GY SQFHR  +KNHG+AI
Sbjct: 122 KWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAI 181

Query: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270
           VWK +LF + D+ML+D+DKE SG + PRT T N GL+L+L +S  VL KYP     +K G
Sbjct: 182 VWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYP---GTSKRG 238

Query: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
           I++GTTHLFWHPFGT+ERTRQC+VLLNK+K+F  RVNVLQ+ +      W  FFCGDFN+
Sbjct: 239 ILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNA 297

Query: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQP 390
           QPFDTPYLS++SKPV YK+RAK VIECSTSYT+SK R+            NIEKFG  QP
Sbjct: 298 QPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARD--GEECDDEEGGNIEKFGDGQP 355

Query: 391 QTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS 450
           + PVPD+Y   PEQ +LV  M  LHNSL+M+A S+Y+V YK VHPEN+G DN   EPEIS
Sbjct: 356 EHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEIS 415

Query: 451 NWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPH 510
           NWA +WRGLLDYIF++  W+F+D             N +K+   LRMPP+ EM  +GQPH
Sbjct: 416 NWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPH 475

Query: 511 QGEYPSDHLSMMCKIELN 528
           +GEY SDHLS+MC+IELN
Sbjct: 476 EGEYGSDHLSLMCEIELN 493

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/448 (58%), Positives = 331/448 (73%), Gaps = 10/448 (2%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDD----EPEKSFTFTLMTYNCLAQALIRRKL 142
           K++     G   D P EL+FI RP+L++H D            TLMTYNCLAQALIRRKL
Sbjct: 36  KREAAALQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKL 95

Query: 143 FPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIH 202
           FPDSG A+KWYRRS+VLLN+FK+Y PD++CLQE+D +Q+ SFW+ EF+K+GYA+QFH+  
Sbjct: 96  FPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQ 155

Query: 203 SKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPE 262
           +KNHGVA+VW++ LF + D+MLIDFDKE SGD+ PRT TNN GL+++LK+++  L  +  
Sbjct: 156 TKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGH-- 213

Query: 263 LGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTA 322
             +  +SGI++GTTHLFWHPFGT+ERTRQC+V+LNK+KEF  RVNVLQN NDGN  HW  
Sbjct: 214 -RDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFP 272

Query: 323 FFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLR-NXXXXXXXXXXXXN 381
           FFCGDFNSQP+D PYLS+TSKPV Y  RA+ VIECSTSYT+SK R              N
Sbjct: 273 FFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGN 332

Query: 382 IEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLD 441
           IE FGKDQP  PVP ++ P  EQ  LV +ME+LHNSL+M+A SLY+VGY+ VHPEN+G D
Sbjct: 333 IEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGAD 392

Query: 442 NKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPAT 501
           N +GEPEISNWAH+W GLLDY+FYV HWDF D             + + ++  LRMP   
Sbjct: 393 NARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQ 452

Query: 502 EMSKY--GQPHQGEYPSDHLSMMCKIEL 527
           EM ++  GQPH GEYPSDHL+M+C +EL
Sbjct: 453 EMQQFGHGQPHTGEYPSDHLAMVCDLEL 480

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/425 (57%), Positives = 316/425 (74%), Gaps = 6/425 (1%)

Query: 103 ELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNE 162
           ++ FI+RPLL  + DE  K F F +MTYNCLAQALIRRKLFP SG A+KW++RS+VLL+E
Sbjct: 84  DVGFIKRPLLVCNGDEA-KGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 163 FKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDR 222
            +YYNPD+ICLQEIDH Q++SFW +  +  GY S+FHR   KNHG+AIVW+ +LF   D 
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 223 MLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHP 282
            LIDFD+E SG+I  RT T N GLI++L+Y+D +  +YP    + +SGI++GT+HLFWHP
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYP---GSAQSGIVVGTSHLFWHP 259

Query: 283 FGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITS 342
           FGTYER RQC+++L+++K F KR+ +L+  + G    W  FFCGDFNSQPFD PYLS+ S
Sbjct: 260 FGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCS 319

Query: 343 KPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTPTP 402
           KP+ Y+ RA+ VIECSTSY +S LR+            NIEKFG  QP+TPVPDS+  TP
Sbjct: 320 KPIIYEGRARTVIECSTSYKFSSLRD--GCAADEEEGGNIEKFGAGQPETPVPDSFDGTP 377

Query: 403 EQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDY 462
           EQ  LV  M+SLHN+L+M+A SLY++ Y+ VHPEN+G+DN +GEPEISNWAH+WRGLLDY
Sbjct: 378 EQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDY 437

Query: 463 IFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMM 522
           I YV  WDFSD               + +R  LR+PPA+EM  +GQPH+GEYPSDHLS+M
Sbjct: 438 IMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLM 497

Query: 523 CKIEL 527
           C++EL
Sbjct: 498 CELEL 502

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  513 bits (1322), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/425 (57%), Positives = 305/425 (71%), Gaps = 9/425 (2%)

Query: 104 LQFIRRPLLTLHDDEP-EKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNE 162
           L+FI RP+L L   +   K F+F+LMTYNCLAQ+LIRR LFP SG A+KW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 163 FKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDR 222
           FK+YN D++CLQEID+ Q+ SFW      +GY S+FHR+ +K+HGVAI WK +LF   D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 223 MLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHP 282
           MLI+FD E SG+I PR  TNN G+IL+L +SD V   +P      KSGII+GT+HLFWHP
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFP---GTVKSGIIVGTSHLFWHP 245

Query: 283 FGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITS 342
           FGTYERTRQC+V+LNK+KEF  RV++ QN +  ++  W  FFCGDFNSQPFD PYLSITS
Sbjct: 246 FGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITS 305

Query: 343 KPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKFGKDQPQTPVPDSYTPTP 402
           KPV Y  RAK VIECS +Y +  L              +    G+D+P  PVP+S+ PT 
Sbjct: 306 KPVLYSGRAKTVIECSAAYKFPDL-----GAGARGANEDGGTVGEDRPVDPVPESFQPTA 360

Query: 403 EQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDY 462
           E + LV KME LHNSL+M+A SLYAV YK VHP+N+GLDN++GEPEISNWA++WRGLLDY
Sbjct: 361 EVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDY 420

Query: 463 IFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMM 522
           I Y+  W  S+             +H+ ++  LRMPPA EMS +GQPH GEYPSDHL+MM
Sbjct: 421 IMYITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMM 480

Query: 523 CKIEL 527
           CK+E+
Sbjct: 481 CKLEV 485

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  455 bits (1171), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/453 (48%), Positives = 300/453 (66%), Gaps = 31/453 (6%)

Query: 92  LANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVK 151
           + +G +PD P ELQFI+RPLLTLHDD+P K     +MTYNCLAQ+LI+R LFP SG+A+K
Sbjct: 58  MKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALK 117

Query: 152 WYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIV 211
           W RRS+VLLNE KYY+ DL+ LQEID +QF+ +W+    K+GY  +F++ + K HGV I 
Sbjct: 118 WVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIA 177

Query: 212 WKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGI 271
           WK NLF     + IDFD+ LSG I PRT+T N GL+++L++ +       +     K G+
Sbjct: 178 WKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK------DKSAIKKKGV 231

Query: 272 IIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQ 331
           IIGTTHLFWH FGT+ERTRQC+V+++++ +F K++        G ++ W  FF GDFNSQ
Sbjct: 232 IIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQ 283

Query: 332 PFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNX----------------XXXXXX 375
           P D PY+SITSKPV ++   KIVIECS +Y YSK RN                       
Sbjct: 284 PKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSD 343

Query: 376 XXXXXNIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHP 435
                  E+   +QP    P  +TPT EQA+LVS++ +LHNSLN++A SLY+VGY+KV P
Sbjct: 344 AETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDP 403

Query: 436 ENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDF-SDCXXXXXXXXXXXXNHMKLRGY 494
           EN+ ++N +GEPE+S WA  W GLLDYIF++ HWD  ++             N++KLRG 
Sbjct: 404 ENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGL 463

Query: 495 LRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
           L+MP + EM ++  P++GEYPSDHL MM ++EL
Sbjct: 464 LKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  447 bits (1149), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 218/446 (48%), Positives = 298/446 (66%), Gaps = 23/446 (5%)

Query: 92  LANGLDPDCPPELQFIRRPLLTLHDDEP---EKSFTFTLMTYNCLAQALIRRKLFPDSGE 148
           +  GLDPD PPELQF RRP LTLHD+EP   E    F+++TYNCLAQ LI R +FP+SG 
Sbjct: 42  MQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGN 101

Query: 149 AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGV 208
           A+KW RRS+ ++NE KYYNPD++CLQEID    + FW  +FK +GY+ +F +   K HGV
Sbjct: 102 ALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGV 161

Query: 209 AIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNK 268
            I W++++F+  D+  +DFD+ L+GDI PRTKT N GLI++L++ D+         NNN 
Sbjct: 162 VIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDN--------NNNNP 213

Query: 269 S----GIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFF 324
           S    GI++ TTHLFWHPFGT+ERTRQC+++L+++ +F   +     N    + +W  F 
Sbjct: 214 SRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-----NEHSGITNWYPFL 268

Query: 325 CGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRN--XXXXXXXXXXXXNI 382
            GDFNSQP D PY+S+T+KP++Y +  + VIECSTSYTYSK RN                
Sbjct: 269 TGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEED 328

Query: 383 EKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDN 442
           E+F K QP  P P  + PT EQA LV+ ++ LHNSL  +A SLY+VGY+ VHPENS ++N
Sbjct: 329 EEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINN 388

Query: 443 KKGEPEISNWAHSWRGLLDYIFYVDHWDFSD-CXXXXXXXXXXXXNHMKLRGYLRMPPAT 501
            +GEPE S+W   W GLLDYIFY+  W+  D              N +K+ G+L++P   
Sbjct: 389 TRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRK 448

Query: 502 EMSKYGQPHQGEYPSDHLSMMCKIEL 527
           EM+ + QP++GEYPSDHL++MCK++L
Sbjct: 449 EMAHHSQPYEGEYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  434 bits (1115), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 215/450 (47%), Positives = 298/450 (66%), Gaps = 17/450 (3%)

Query: 87  KQKKMLANGLDPDCPPELQFIRRPLLTL--HDDEPEKSFTFTLMTYNCLAQALIRRKLFP 144
           K++K L  G DPD P EL FI+RP+L L  H     K F F+LMTYNCLAQA+IRR++F 
Sbjct: 33  KREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFS 92

Query: 145 DSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKK-MGYASQFHRIHS 203
           DSG A+KW+RRS+VL+NE  YYNPD++CLQEID  Q+++FW+++ +  +   + +++   
Sbjct: 93  DSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKI 152

Query: 204 KNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAK-YPE 262
           K+HGV I WK ++F+  D M++DFD   + +I  RT T N  + ++LK++D  + K +P 
Sbjct: 153 KHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPN 212

Query: 263 L---GNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDH 319
           L    + N  G II TTHLFWHPFGT+ERTRQC++LL K+K+F   +NV     D    H
Sbjct: 213 LLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTH 268

Query: 320 WTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXX 379
           W  F CGDFNS P D PYLS+TSKP+EY  R K VIECST+Y +SK RN           
Sbjct: 269 WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE- 327

Query: 380 XNIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSG 439
              EK   +QP+  VPDS+TPT EQA LV +++SLHN L ++ATSLY + YK V P N  
Sbjct: 328 ---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVN 384

Query: 440 LDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSD--CXXXXXXXXXXXXNHMKLRGYLRM 497
           ++N +GEPE ++WA SW G+LDYI YVD+WD ++               N + ++G L+M
Sbjct: 385 INNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKM 444

Query: 498 PPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
           P   +M  + QP + EYPSDH+S++C++E+
Sbjct: 445 PLNKDMPFHTQPFEREYPSDHISILCEMEI 474

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 194/450 (43%), Positives = 265/450 (58%), Gaps = 31/450 (6%)

Query: 88  QKKMLANGLDPDCPPELQFIRRPLLTL-HDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146
           ++++L+ GLDPD P E QFI RP+L + H D  E+    ++MTYNCLAQ LIRR++FP+S
Sbjct: 42  REELLSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPES 101

Query: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206
           G A+KW+ RS+VLL+E K+YN D+ CLQEID +Q+  FW EE  K GY + +    SK+H
Sbjct: 102 GPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSH 161

Query: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266
           GV I WK  LF+L   M I+FDKE    I PRT+TNN GL+++L ++D+  A+   +   
Sbjct: 162 GVMIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRI-RT 220

Query: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326
           ++SG+IIGT HLFWHPFGTY+RTRQC V+  K+ EF   V             +   F G
Sbjct: 221 SRSGVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK----------GDYCKMFTG 270

Query: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXXXXXNIEKF- 385
           DFNSQP   PYL +T    +   + +  IE ST+Y YS+ RN              E+  
Sbjct: 271 DFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEE 330

Query: 386 --------GKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPEN 437
                   G D   TP PD +  T EQ  LV+ +    N + + ATSLY++GY  V P +
Sbjct: 331 KREYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTH 390

Query: 438 SGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRM 497
                   EPE+S+W+  W GLLDYIFYV+                   N++ + GYL+M
Sbjct: 391 IA---DHHEPELSSWSTKWAGLLDYIFYVNQ-------RPSTPATFETANNIAIAGYLQM 440

Query: 498 PPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
           P   +M  + QP+ GEYPSDH+SMMC +E+
Sbjct: 441 PTHAQMHNHSQPYTGEYPSDHISMMCALEI 470

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  373 bits (958), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/452 (42%), Positives = 276/452 (61%), Gaps = 31/452 (6%)

Query: 87  KQKKMLANGLDPDCP-PELQFIRRPLLTLHDDEPEKSFTFT-------LMTYNCLAQALI 138
           ++  +++ G DPD P P+LQFI+RP L LH +  + S   T       +MTYN LAQ LI
Sbjct: 61  RRNSLISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLI 120

Query: 139 RRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQF 198
           RR  FP SG A+KW++RS+VL++E K Y PD++ LQE+D+ + + FWQE F+K+G+   F
Sbjct: 121 RRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTF 179

Query: 199 HRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILP-RTKTNNTGLILSLKYSDSVL 257
            R   K HG+ I W +  F+L +  ++D+D  L+G+ +P RT+T N  LI SL+  +   
Sbjct: 180 KRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRLKN--- 236

Query: 258 AKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNM 317
                + + +  G+I+  THLFWHPFG +ER RQ +++L K++E K              
Sbjct: 237 -----ISDPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQEIKA---------CPKY 282

Query: 318 DHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXXXX 377
           + W +   GDFN++P + PYL+IT KPV     A+++ ECS +Y YSK RN         
Sbjct: 283 NGWHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDE 342

Query: 378 XXXNIEKF-GK-DQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHP 435
                 +  G+ +QPQ P P S+T T EQ  LV ++ +LHNSL+++  SLY +GY KV P
Sbjct: 343 ECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQP 402

Query: 436 ENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYL 495
           ENS   N  GEPE+SNWA+SW GLLDYIFY++H D                N++++ GYL
Sbjct: 403 ENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYL 460

Query: 496 RMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
           +MP A EM K+ QP +GEY SDH+S+MC++  
Sbjct: 461 KMPRAKEMPKHSQPFEGEYASDHVSLMCQLRF 492

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  367 bits (943), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/456 (41%), Positives = 275/456 (60%), Gaps = 35/456 (7%)

Query: 87  KQKKMLANGLDPDCP-PELQFIRRPLLTLHDDEP-----------EKSFTFTLMTYNCLA 134
           ++  +++ G DPD P P+LQFI RP L ++ D             + S    +MTYN LA
Sbjct: 59  RRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLA 118

Query: 135 QALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGY 194
           Q LIRR  FP+SG A+KW++RS+VL++E K Y PD++ LQE+D+ +  +FWQE F K+G+
Sbjct: 119 QTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGF 177

Query: 195 ASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDIL-PRTKTNNTGLILSLKYS 253
              F R   K HG+ + W N  F+L +  ++D+D  L+G+++  RT+T N  LI+SL + 
Sbjct: 178 DVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFK 237

Query: 254 DSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNN 313
                    + +++  GII+  THLFWHPFG +ER RQ +++L K++E K          
Sbjct: 238 G--------ITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKAC-------- 281

Query: 314 DGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXX 373
               + W +   GDFN++P + PYL+IT +P+  K   + ++ECS +Y YSK RN     
Sbjct: 282 -SKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESD 340

Query: 374 XXXXXXXNIEK--FGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYK 431
                     +     DQPQ P P+S+T T E+  LV+++ +LHNSL++K  SLY +GY 
Sbjct: 341 QDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYG 400

Query: 432 KVHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKL 491
           KVHPEN+  +   GEP +SNWA++W GLLDYIFY++     D             N++K+
Sbjct: 401 KVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKI 458

Query: 492 RGYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
            GYLRMP A EM K+ QP +GEY SDH+S+MC+I L
Sbjct: 459 IGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  364 bits (935), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 187/455 (41%), Positives = 270/455 (59%), Gaps = 34/455 (7%)

Query: 87  KQKKMLANGLDPDCP-PELQFIRRPLLTLHDDE-----------PEKSFTFTLMTYNCLA 134
           ++  +++ G DPD P P+LQFI RP L ++ +            P  S    +MTYN LA
Sbjct: 61  RRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLA 120

Query: 135 QALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGY 194
           Q LIRR  FP SG A+KW++RS+VL++E K Y PD++ LQE+D+ +   FW E F K+G+
Sbjct: 121 QTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGF 179

Query: 195 ASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGD-ILPRTKTNNTGLILSLKYS 253
            S F R   K HG+ + W N  F+  +  ++D+D  L+G+ I  RT+T N  LI+SL   
Sbjct: 180 GSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSVK 239

Query: 254 DSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNN 313
           +        + N + SG+I+  THLFWHPFG +ER RQ F++L K++E K          
Sbjct: 240 N--------MTNLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEIKTCPKYYG--- 288

Query: 314 DGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXX 373
                 W +   GDFN++P + PY++IT +P+     A+ + ECS +Y YSK+RN     
Sbjct: 289 ------WHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESD 342

Query: 374 XXXXXXXNIEKFGK-DQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKK 432
                       G+ DQPQ P P  +  T EQ +LV+++ +LHNSL++K  SLY + Y K
Sbjct: 343 QDEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGK 402

Query: 433 VHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLR 492
           VHP+NS  ++  GEPE+SNWA++W GLLDYIFY++  D                N++K+ 
Sbjct: 403 VHPDNSKENH--GEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKII 460

Query: 493 GYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
           GYLRMP A EM K+ QP +GEY SDH+S+MC++ L
Sbjct: 461 GYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  364 bits (934), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/454 (40%), Positives = 274/454 (60%), Gaps = 38/454 (8%)

Query: 91  MLANGLDPDCP-PELQFIRRPLLTLHDDEPEKSFT------------FTLMTYNCLAQAL 137
           +++ G DPD P P+LQFI RPLL +  ++    F               +MTYN LAQ L
Sbjct: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122

Query: 138 IRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQ 197
           IRR  FP SG A+KW++RS+VL++E K Y PD++ LQE+D+ + + FW+E F K+G+   
Sbjct: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181

Query: 198 FHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDIL-PRTKTNNTGLILSLKYSDSV 256
           F R   K HG+ + W N  F+L +  ++D+D+ L+G+++  RT+T N  LI+SL++ D+ 
Sbjct: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT- 240

Query: 257 LAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGN 316
                   N + +GI++  THLFWHPFG +ER RQ +++L K++E K          D  
Sbjct: 241 -------RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIK----------DFP 283

Query: 317 MDH-WTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNXXXXXXX 375
             H W +   GDFN++P + PYL+ITSKP+      + ++ECS +Y YSK RN       
Sbjct: 284 KYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQD 343

Query: 376 XXXXXNIEKFGKD--QPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKV 433
                   +  ++  QP+ P P  +  T E+ DLV+++ +LHNSL++K  SLY +GY KV
Sbjct: 344 DEDYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKV 403

Query: 434 HPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRG 493
           HPEN+  +   GEPE+SNWA++W GLLDYIFY++  D +              N + + G
Sbjct: 404 HPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIG 461

Query: 494 YLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527
           YLRMP   EM K+ QP +GEY SDH+S+MC+I L
Sbjct: 462 YLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  355 bits (910), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/435 (43%), Positives = 271/435 (62%), Gaps = 24/435 (5%)

Query: 106 FIRRPLLTLHD-DEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNEFK 164
           FI+R +L L + +E + S    +MTYN L+Q+LIRR+++PD+ +A+KW+ RS+V+LNE K
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 165 YYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHS--KNHGVAIVWKNNLFRLTDR 222
           YYN D++C QE+D IQ+  FW  E  K+GY  +F++     K HGVAI W++NLF   D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 223 MLIDFDKELSGDILPRT-KTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWH 281
           + I+FD  ++G+ + +T +T N GLI++LK+  S  AK+       +SGI+IGTTHLFWH
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKFKSSN-AKF-------RSGIVIGTTHLFWH 224

Query: 282 PFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSIT 341
           PFGT+ERTRQ  +LL K ++    +N    + +   + W     GDFNSQP D PYLSIT
Sbjct: 225 PFGTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSIT 284

Query: 342 SKPVEYKERAKIVIECSTSYTYSKLRNXXXXX---------XXXXXXXNIEKFGKDQPQT 392
           SKPV     AK VIECST+Y +S+ R+                       E+  +  P  
Sbjct: 285 SKPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPID 344

Query: 393 PVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNW 452
           P P  +  T EQ DL++K+E +HNS+N+KATSL+ + YKKVH  + GL N K EPE+S+ 
Sbjct: 345 PRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSHT 401

Query: 453 AHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPHQG 512
           +  W GLLDYIF ++ W+  +               ++++G L+MP   E+ K  QPHQG
Sbjct: 402 SIFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQG 461

Query: 513 EYPSDHLSMMCKIEL 527
           +YPSDHLSM+C + +
Sbjct: 462 QYPSDHLSMICDLNV 476

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  332 bits (851), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/437 (42%), Positives = 249/437 (56%), Gaps = 30/437 (6%)

Query: 106 FIRRPLLTLH--DDEPEKS--FTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLN 161
           FI+RPLL +      P +       +MTYN LAQ LIRR  FPD+ +A+KW+RRS+VL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 162 EFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLT- 220
           E +YY+ D++CLQE D IQ+  FW EEF ++GY   F     K HGVAIVWK ++F  T 
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 221 -DRMLIDFDKELSG-DILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHL 278
            D++ +  D  ++G DI   T T    L ++L+             +     II  TTHL
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKH----------HKTSRPIIFSTTHL 212

Query: 279 FWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYL 338
           FWH FGT+ERTRQ FV+L+++ +F K+V    + +         FF GDFNSQP D PYL
Sbjct: 213 FWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYL 269

Query: 339 SITSKPVEYKERAKIVIECSTSYTYSKLRNXX------XXXXXXXXXXNIEKFGKDQPQT 392
           S+T KPV+ K RAK +IECS SY YSK RN                  ++E    ++PQ 
Sbjct: 270 SLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQD 328

Query: 393 PVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSG--LDNKKGEPEIS 450
           P P +Y   PEQ + V  +++LHN + ++  SLY +GY  VHPENS     +   EP++S
Sbjct: 329 PRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLS 388

Query: 451 NWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMSKYGQPH 510
           + A  W GLLDYIF +  W   +               +K+ GYLRMP   EM  + +PH
Sbjct: 389 HRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPH 447

Query: 511 QGEYPSDHLSMMCKIEL 527
           + EYPSDHL+MMC I L
Sbjct: 448 ENEYPSDHLAMMCDISL 464

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 105/236 (44%), Gaps = 38/236 (16%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+++YN L Q     K++  +   A+ W  R   L  +   YN D++CLQE++   ++
Sbjct: 407 SFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYE 466

Query: 183 SFWQEEFKKMGYASQFH------RIHSKNH----GVAIVWKNNLFRLTDRMLIDFDK--- 229
            FW    ++ GY+  FH       +HSK+     G    +K++ F+L  +  +DF     
Sbjct: 467 DFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWM 526

Query: 230 -----ELSGDILPRT-KTNNTGLILSLKYSDSVLAKYPELGNNNKSG--IIIGTTHLFWH 281
                + + D L R    +N  L++ L++               KSG  +   TTHL W 
Sbjct: 527 KHKKFQRTEDYLNRAMNKDNVALVVKLQHI--------------KSGEHVWAATTHLHWD 572

Query: 282 PFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPY 337
           P     +T Q  VLL+ +++  K  N    NN   +       CGDFNSQ     Y
Sbjct: 573 PQFNDVKTFQVGVLLDYMEKVIKEQN--NCNNTQELKKVPVVICGDFNSQTNSAVY 626

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 104/228 (45%), Gaps = 34/228 (14%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FTL++YN L       K++  +   A+ W  R   L  +   ++ D+ICLQE++ + ++
Sbjct: 453 SFTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYE 512

Query: 183 SFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDK--- 229
            +W    +K  Y+  FH       +H+K+     G AI +K + F+L  +  IDF     
Sbjct: 513 EYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWR 572

Query: 230 -----ELSGDILPRT-KTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHPF 283
                  + D L R    +N  LI  LK+             N    + + TTHL W P 
Sbjct: 573 SHKKFHRTEDYLNRAMNKDNVALIAELKHL------------NTNENVWVVTTHLHWDPQ 620

Query: 284 GTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQ 331
               +T Q  V+L+ ++   K+ + + NNND  +       CGDFNSQ
Sbjct: 621 FNDVKTFQVGVMLDYLETLIKQHHHVNNNND--IKKIPMVICGDFNSQ 666

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 109/236 (46%), Gaps = 23/236 (9%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKW-YRRSRVLLNEFKYYNPDLICLQEIDHIQF 181
           +FT+++YN L Q     K++  +   A+ W YRR++ L ++   Y+ D++CLQE++   F
Sbjct: 434 SFTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAK-LRDQILSYSCDIMCLQEVEARTF 492

Query: 182 QSFWQEEFKKMGYASQF----------HRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKEL 231
           + FW    +K GY+  F          HR   K  G  + +K   FRL  +  +DF    
Sbjct: 493 EDFWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDF---- 548

Query: 232 SGDILPRTKTNNTGLILSLKYSDSVLAKYPELGN-NNKSGIIIGTTHLFWHPFGTYERTR 290
           S   +   K   T   L+   +   +A Y +L +  +   I + TTHL W P     +T 
Sbjct: 549 SSTWMKHEKFQRTEDFLNRAMNKDNIALYFKLQHIASGEHIWVATTHLHWDPKFNDVKTF 608

Query: 291 QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVE 346
           Q  VLL+ ++       + Q+N   ++       CGDFNS      Y  ++S  V+
Sbjct: 609 QVGVLLDHLQTL-----IRQDNPRQDVKKAPVIICGDFNSYIDSAVYELLSSGSVK 659

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 120/271 (44%), Gaps = 36/271 (13%)

Query: 96  LDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGE-AVKW-Y 153
           ++ D  P  +F      T H  +     +FTL++YN L Q     K++  +   A+ W Y
Sbjct: 370 VNTDGEPTEEFNSLQESTQHLSKETLKRSFTLLSYNTLCQHYATPKMYRYTPSWALSWDY 429

Query: 154 RRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFH------RIHSKNH- 206
           RR + L  +   +  D++CLQE++   F+ FW    +K GY   FH       + SK+  
Sbjct: 430 RRDK-LKEQIISFQADVVCLQEVECKTFEDFWAPFLQKHGYTGVFHAKTRARTMQSKDSK 488

Query: 207 ---GVAIVWKNNLFRLTDRMLIDFDK--------ELSGDILPRT-KTNNTGLILSLKYSD 254
              G  + +KN+ F+L  +  +DF          + + D L R    +N  L + L++  
Sbjct: 489 KVDGCCVFYKNSEFKLVFKDAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALFVKLQH-- 546

Query: 255 SVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNND 314
                   L  N +  I + TTHL W P     +T Q  VLL+ +++  +  N + NN +
Sbjct: 547 --------LKTNEQ--IWVTTTHLHWDPQFNDVKTFQVGVLLDYMEKLLRDQNGVGNNQE 596

Query: 315 GNMDHWTAFFCGDFNSQPFDTPYLSITSKPV 345
             M       CGDFNSQ     Y   +S  V
Sbjct: 597 --MKKVPLVICGDFNSQLDSAVYELFSSGTV 625

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 107/236 (45%), Gaps = 20/236 (8%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+M+YN L Q     K++  +   A+ W  R + L  E   Y  D++CLQE++   ++
Sbjct: 523 SFTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYE 582

Query: 183 SFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDKELS 232
             W     K GY+  FH       +HSK+     G  + +K + F+L  +  +DF    S
Sbjct: 583 EHWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDF----S 638

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG--IIIGTTHLFWHPFGTYERTR 290
              +   K   T   L+   +   +  Y +L N+ KSG  + I TTHL W P     +T 
Sbjct: 639 STWMKHKKFQRTEDYLNRAMNKDNVVIYIKL-NHLKSGESVWIATTHLHWDPQFNDVKTF 697

Query: 291 QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVE 346
           Q  +L++ ++E  K      +  D          CGDFNSQ     Y  +++  V+
Sbjct: 698 QVGILMDHLEELIKEHGSPSSRQDPKKS--PVIICGDFNSQKDSAVYELLSTGHVQ 751

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 110/242 (45%), Gaps = 20/242 (8%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+++YN L Q     K++  +   A+ W  R   L  +   Y  D+ICLQE++   F+
Sbjct: 463 SFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFE 522

Query: 183 SFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDKELS 232
            +W    +K GY+  FH       +HSK+     G  + ++ N F+L  +  +DF    S
Sbjct: 523 EYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDF----S 578

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG--IIIGTTHLFWHPFGTYERTR 290
           G      K   T   L+   +   +A Y +L  + KSG  + I TTHL W P     +T 
Sbjct: 579 GVWQKHKKFQRTEDYLNRAMNKDNVAIYLKL-QHIKSGESVWIVTTHLHWDPQFNDVKTF 637

Query: 291 QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKER 350
           Q  VL++ ++   K  +  Q+  +          CGD NS+     Y  +++  V+  + 
Sbjct: 638 QVGVLMDHIENLLKEQSNAQSKQEAK--KCPVILCGDLNSEIHSAVYELLSTGRVQAHDD 695

Query: 351 AK 352
            K
Sbjct: 696 IK 697

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 110/240 (45%), Gaps = 18/240 (7%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+++YN L Q     K++  +   A+ W  R   L  +   Y+ D++CLQE++   F+
Sbjct: 498 SFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFE 557

Query: 183 SFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDKELS 232
            +W    +K GY   FH       +HSK+     G  I +K + F++ +R  +DF    S
Sbjct: 558 DYWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDF----S 613

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGII-IGTTHLFWHPFGTYERTRQ 291
           G  +   K   T   L+   +   +A + +L + +    I + TTHL W P     +T Q
Sbjct: 614 GAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHVSSGDTIWVVTTHLHWDPKFNDVKTFQ 673

Query: 292 CFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERA 351
             VLL+ ++   K      +N+  ++       CGDFNS      Y  I++  V+  +  
Sbjct: 674 VGVLLDHLETLLKEDTT--HNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQAHQEG 731

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 100/231 (43%), Gaps = 40/231 (17%)

Query: 124 TFTLMTYNCLAQALIRRKLFP-DSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FTL++YN L Q     K++      A+ W  R   L  E   Y  D+ICLQE++   ++
Sbjct: 444 SFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYE 503

Query: 183 SFWQEEFKKMGYASQFH----------RIHSKNHGVAIVWKNNLFRLTDRMLIDFDK--- 229
            FW    +K GY+  FH          +   K  G  I +KN+ F    +  IDF     
Sbjct: 504 EFWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWM 563

Query: 230 -----ELSGDILPRT-KTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHPF 283
                + + D L R    +N  LI+ LK+         EL   +   + + TTHL W P 
Sbjct: 564 KHKKFQRTEDYLNRAMNKDNIALIVKLKH---------ELSGEH---VWVVTTHLHWDPH 611

Query: 284 GTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDH---WTAFFCGDFNSQ 331
               +T Q  VLL+ +++  K     Q +N GN           CGDFNSQ
Sbjct: 612 FNDVKTFQVGVLLDYIEKLLK-----QQSNIGNPQEKKKVPLIICGDFNSQ 657

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 104/239 (43%), Gaps = 34/239 (14%)

Query: 113 TLHDDEPEKSFTFTLMTYNCLAQALIRRKLFP-DSGEAVKWYRRSRVLLNEFKYYNPDLI 171
           T H +E     +FTL++YN L Q     K++      A+ W  R   L +E   Y  D+I
Sbjct: 386 TNHLNEELLKKSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDII 445

Query: 172 CLQEIDHIQFQSFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTD 221
           CLQE++   ++ FW    +K GY+  FH       + SK+     G  I +KN+ F    
Sbjct: 446 CLQEVESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVF 505

Query: 222 RMLIDFDK--------ELSGDILPRT-KTNNTGLILSLKYSDSVLAKYPELGNNNKSGII 272
           +  IDF          + + D L R    +N  LI+ L++  +               + 
Sbjct: 506 KDAIDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLRHERT------------GEHVW 553

Query: 273 IGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQ 331
           + TTHL W P     +T Q  V+L+ +++  K+   + +  D          CGDFNSQ
Sbjct: 554 VVTTHLHWDPHFNDVKTFQVAVMLDYIEKLLKQHGGVGSPQDKK--KIPLVICGDFNSQ 610

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 99/219 (45%), Gaps = 18/219 (8%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           TFT+++YN L Q     K++  +   A+ W  R   L  +   Y+ DL+CLQE++   F+
Sbjct: 504 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 563

Query: 183 SFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDKELS 232
            +W     K GY   FH       +HSK+     G  I +K + F+L  +  +DF    S
Sbjct: 564 EYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDF----S 619

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIG-TTHLFWHPFGTYERTRQ 291
           G  +   K   T   L+   +   +A + +L +      I   TTHL W P     +T Q
Sbjct: 620 GAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIWAVTTHLHWDPKFNDVKTFQ 679

Query: 292 CFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
             VLL+ ++   K      +N   ++  +    CGDFNS
Sbjct: 680 VGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 107/244 (43%), Gaps = 38/244 (15%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FTL++YN L Q     K++  +   A+ W  R   L  +  YY+ D+ICLQE++   ++
Sbjct: 409 SFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYE 468

Query: 183 SFWQEEFKKMGYASQFH----------RIHSKNHGVAIVWKNNLFRLTDRMLIDFDK--- 229
            FW    ++ GY   FH          +   K  G  + ++++ F+L  +  +DF     
Sbjct: 469 DFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWM 528

Query: 230 -----ELSGDILPRT-KTNNTGLILSLKYSDSVLAKYPELGNNNKSG--IIIGTTHLFWH 281
                + + D L R    +N  L++ L++               KSG  +   TTHL W 
Sbjct: 529 KHKKFQRTEDYLNRAMNKDNVALLVKLQHL--------------KSGEHVWAATTHLHWD 574

Query: 282 PFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSIT 341
           P     +T Q  VLL+ +++  K  +    NN   +       CGDFNSQ     Y  ++
Sbjct: 575 PQFNDVKTFQVGVLLDHMEKVIKEHSGY--NNSQELKKVPVIICGDFNSQVDSAVYELLS 632

Query: 342 SKPV 345
           +  V
Sbjct: 633 TGSV 636

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 112/241 (46%), Gaps = 20/241 (8%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKW-YRRSRVLLNEFKYYNPDLICLQEIDHIQF 181
           TF++++YN L Q     K++  +   A+ W YRRS+ L  +   Y+ D++CLQE++   F
Sbjct: 536 TFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSK-LKEQILSYDSDVLCLQEVESKTF 594

Query: 182 QSFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDKEL 231
           + +W     K GY   F+       +HSK+     G  I +K + F+L  +  +DF    
Sbjct: 595 EDYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDF---- 650

Query: 232 SGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGII-IGTTHLFWHPFGTYERTR 290
           SG  +   K   T   L+   +   +A + +L + +    I + TTHL W P     +T 
Sbjct: 651 SGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHVSSGDTIWVVTTHLHWDPKFNDVKTF 710

Query: 291 QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKER 350
           Q  VLL+ ++   K      +N+  ++       CGDFNS      Y  I++  V+  + 
Sbjct: 711 QVGVLLDHLESLLKEDTT--HNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQVHQE 768

Query: 351 A 351
            
Sbjct: 769 G 769

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 120/271 (44%), Gaps = 25/271 (9%)

Query: 96  LDPDCPPELQF--IRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGE-AVKW 152
           ++ D  PE ++  ++     L  D  +KSFT  +++YN L Q     K++  +   A+ W
Sbjct: 509 INADGEPEKEYDTVQEAERNLSSDMQKKSFT--MLSYNTLCQHYATPKMYRYTPSWALSW 566

Query: 153 YRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHR------IHSKNH 206
             R   L  +   +N D+ICLQE++   F+ FWQ   +K GY   FH       + SK+ 
Sbjct: 567 DYRREKLKEQILNFNTDIICLQEVEAKTFEDFWQPLLEKHGYTGLFHAKTRAKTMQSKDS 626

Query: 207 ----GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPE 262
               G    +K + F++  +  +DF    SG  +   K   T   L+   +   +A   +
Sbjct: 627 KKVDGCCAFYKTSKFKMLFKECVDF----SGLWMKHKKFQRTEDYLNRAMNKDNVAIVMK 682

Query: 263 LGNNNKSGII-IGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWT 321
           L +     I+ + TTHL W P     +T Q  VLL+ ++   K  N  Q     ++  + 
Sbjct: 683 LQHIQSGEIMWLVTTHLHWDPKFNDVKTFQVGVLLDHMETLLKEQNPKQ-----DVKKYP 737

Query: 322 AFFCGDFNSQPFDTPYLSITSKPVEYKERAK 352
              CGD NS    + Y   ++  V++    K
Sbjct: 738 LVICGDLNSYLSSSVYELFSTGRVQHHHDGK 768

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 105/240 (43%), Gaps = 18/240 (7%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           TFT+++YN L Q     K++  +   A+ W  R   L  +   Y+ DL+CLQE++   F+
Sbjct: 506 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 565

Query: 183 SFWQEEFKKMGYASQFHR------IHSKNH----GVAIVWKNNLFRLTDRMLIDFDKELS 232
            +W     K GY   FH       +HSK+     G  I +K + F+L  +  +DF    S
Sbjct: 566 DYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDF----S 621

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIG-TTHLFWHPFGTYERTRQ 291
           G  +   K   T   L+   +   +A + +L +      I   TTHL W P     +T Q
Sbjct: 622 GAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIWAVTTHLHWDPKFNDVKTFQ 681

Query: 292 CFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERA 351
             VLL+ ++   +      +N   ++       CGDFNS      Y  I++  V+  +  
Sbjct: 682 VGVLLDHLETLLREETT--HNFRQDIKKSPVLICGDFNSYINSAVYELISTGRVQINQEG 739

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 114/266 (42%), Gaps = 18/266 (6%)

Query: 96  LDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGE-AVKWYR 154
           ++ D  P+ +F    L   H        +FT+++YN L Q     K++  +    + W  
Sbjct: 511 INADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDT 570

Query: 155 RSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHR------IHSKNH-- 206
           R   L N+      D+ICLQE++   ++ FW    +K GY   FH       + SK+   
Sbjct: 571 RREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKK 630

Query: 207 --GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELG 264
             G  I +K + F+L  +  +DF    SG  +   K   T   L+   +   +A + +L 
Sbjct: 631 VDGCCIFYKESEFKLQHQESVDF----SGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLE 686

Query: 265 N-NNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAF 323
           + N+   + + TTHL W P     +T Q  VLL+ ++   K  N   +  +  +      
Sbjct: 687 HINSGESVWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYNNASSKQE--IRKCPVI 744

Query: 324 FCGDFNSQPFDTPYLSITSKPVEYKE 349
            CGD NS      Y  +++  V+  E
Sbjct: 745 ICGDLNSHLQSAVYELLSTGHVKVHE 770

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 96/219 (43%), Gaps = 21/219 (9%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+++YN L Q     K++  +   A+ W  R   L  +   Y  D++CLQE++   F+
Sbjct: 568 SFTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFE 627

Query: 183 SFWQEEFKKMGYASQFH----------RIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELS 232
            FW    +K  Y   FH          +   K  G  I +K + F+L  +  +DF    S
Sbjct: 628 EFWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDF----S 683

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGN-NNKSGIIIGTTHLFWHPFGTYERTRQ 291
           G  +   K   T   L+   +   +A Y +L +  +   + + TTHL W P     +T Q
Sbjct: 684 GTWMKHKKFQRTEDYLNRAMNKDNVALYMKLQSITSGETVWVVTTHLHWDPKFNDVKTFQ 743

Query: 292 CFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
             +LL+ ++   K  N  Q+    N+       CGD NS
Sbjct: 744 VGILLDHMETLLKEENPKQDVKKANV-----VICGDLNS 777

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 104/224 (46%), Gaps = 28/224 (12%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+++YN L Q     K++  +   A+ W  R   L ++   +  D+ICLQE++   ++
Sbjct: 451 SFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYE 510

Query: 183 SFWQEEFKKMGYASQFH----------RIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELS 232
            FW    +K GYA  F+          +   K  G  I +K + F +  +  +DF    S
Sbjct: 511 EFWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDF----S 566

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG--IIIGTTHLFWHPFGTYERTR 290
           G  +   K   T   L+   +   +A Y +L  + KSG  + + TTHL W P     +T 
Sbjct: 567 GVWMKHKKFQRTEDYLNRAMNKDNVALYMKL-EHIKSGESVWVVTTHLHWDPQFNDVKTF 625

Query: 291 QCFVLLNKVKEFKKRVNVLQNNNDGN----MDHWTAFFCGDFNS 330
           Q  +LL+ ++E      +L++NN+ +    +       CGD NS
Sbjct: 626 QVGILLDHLEE------LLKDNNNASSKQEIRKCPVIICGDLNS 663

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 116/267 (43%), Gaps = 20/267 (7%)

Query: 96  LDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGE-AVKWYR 154
           ++ D  P+ ++      T H     +  +FT+++YN L Q     K++  +   A+ W  
Sbjct: 535 INTDGEPQTEYDSIEDATSHLSRDLEKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWEY 594

Query: 155 RSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFH----------RIHSK 204
           R   L ++   +  D++CLQE++   +  FW+   +K GY   FH          +   K
Sbjct: 595 RRDKLKDQILSFKSDILCLQEVESRTYDDFWEPLLQKHGYKGIFHAKTRAKTMQTKDSKK 654

Query: 205 NHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELG 264
             G  I +K + F++  +  +DF    SG  +       T   L+   +   +A Y +L 
Sbjct: 655 VDGCCIFYKESEFKVLFKEAVDF----SGIWMKHKNFQRTEDYLNRAMNKDNVAIYMKL- 709

Query: 265 NNNKSGII--IGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTA 322
            + KSG +  I TTHL W P     +T Q  VLL+ ++   K  + + +  D  +     
Sbjct: 710 QHIKSGEVTWIVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKEHSNIHSKQD--VKKCPI 767

Query: 323 FFCGDFNSQPFDTPYLSITSKPVEYKE 349
             CGD NS      Y  +++  VE  E
Sbjct: 768 IICGDLNSYLDSAVYELLSTGHVEAHE 794

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 99/220 (45%), Gaps = 23/220 (10%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FT+++YN L Q     K++  +   A++W  R   L  +   Y  D++CLQE++   ++
Sbjct: 465 SFTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYE 524

Query: 183 SFWQEEFKKMGYASQFH----------RIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELS 232
            FW    +K GY   FH          +   K  G  + +K + F+L  +  +DF    S
Sbjct: 525 DFWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDF----S 580

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG--IIIGTTHLFWHPFGTYERTR 290
           G      +   T   L+   +   +A Y +L  + +SG  + + TTHL W P     +T 
Sbjct: 581 GAWQKHKRFQRTEDYLNRAMNKDNVAIYMKL-QHVQSGEYLWVVTTHLHWDPKFNDVKTF 639

Query: 291 QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
           Q  VLL+ ++   K  N  Q     ++  +     GDFNS
Sbjct: 640 QVGVLLDHMESIIKEENPKQ-----DVKKFPIIITGDFNS 674

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 19/83 (22%)

Query: 445 GEPEISNWAHSWRGLLDYIFYVDHWDFSDCXXXXXXXXXXXXNHMKLRGYLRMPPATEMS 504
           GE   +N+  S+  ++DYI+Y  H                    +++RG L       +S
Sbjct: 722 GELPFTNFTPSFTNVIDYIWYSTHV-------------------LRVRGLLGPIDEDYVS 762

Query: 505 KYGQPHQGEYPSDHLSMMCKIEL 527
           K+      ++PSDHL ++ +IE 
Sbjct: 763 KFIGFPNDKFPSDHLPLIARIEF 785

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 104/231 (45%), Gaps = 22/231 (9%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGE-AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           +FTL++YN L Q     K++  +   A+ W  R   L ++   Y  D++CLQE++   F+
Sbjct: 525 SFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFE 584

Query: 183 SFWQEEFKKMGYASQFH------RIHSKNH----GVAIVWKNNLFRLTDRMLIDFDKELS 232
            FW    +K  Y   FH       + SK+     G  I +K + F+L  +  +DF    S
Sbjct: 585 EFWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDF----S 640

Query: 233 GDILPRTKTNNTGLILSLKYSDSVLAKYPELGN-NNKSGIIIGTTHLFWHPFGTYERTRQ 291
           G  +   K   T   L+   +   +A Y +L +  +   + + TTHL W P     +T Q
Sbjct: 641 GTWMKHKKFQRTEDYLNRAMNKDNVALYLKLQSLTSGESVWVVTTHLHWDPKFNDVKTFQ 700

Query: 292 CFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITS 342
             +LL+ ++   K  N  Q+    N+       CGD NS  FD+    + S
Sbjct: 701 VGILLDHMEALLKEENPKQDVKKANV-----VICGDLNSY-FDSAVYELLS 745

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 102/247 (41%), Gaps = 41/247 (16%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNE-FKYYNPDLICLQEIDHIQF 181
           TFTLMTYN L+   +  +++    E  K W  R R+L  E    Y  D++C+QE+    +
Sbjct: 29  TFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDY 88

Query: 182 QSFWQEEFK-KMGYASQF---------HRIHSKNHGVAIVWKNNLFR--------LTDRM 223
           + FW+  FK KM Y S +          R   +  GV I +  N F         L D +
Sbjct: 89  EGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLI 148

Query: 224 LIDFDKELS---GDILPRTKTNNTG-------LILSLKYSDSVLAKYPELGNNNKSGIII 273
            +    EL+     I+  T TN  G       L+  L   + V      L    ++  ++
Sbjct: 149 GLFNISELNYLKSTII--TLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVV 206

Query: 274 GTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQ 331
             THL+W     Y+  +  QC  ++ K+    K  ++L              F GD NS 
Sbjct: 207 VNTHLYW----KYDEVKLCQCLTIMRKLHRVIK--SLLMGMEGVTYSKVKILFAGDLNSA 260

Query: 332 PFDTPYL 338
           P D+P +
Sbjct: 261 P-DSPVI 266

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 104/239 (43%), Gaps = 43/239 (17%)

Query: 125 FTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNE-FKYYNPDLICLQEIDHIQFQ 182
           F L+TYN L+   +  +++    E  K W  R ++L  E F  Y+ D++CLQE+    ++
Sbjct: 42  FNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLLEYELFHKYHADILCLQELTGKDYE 101

Query: 183 SFWQEEFK-KMGYASQF---------HRIHSKNHGVAIVWKNNLFR--LTDRMLIDFDKE 230
            FW+++ K +M + SQ+          R   +  GV   +  + F    TD   +++  +
Sbjct: 102 KFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGVGTFYNADKFEHVATD---LEYLSD 158

Query: 231 LSGDILPRTK----------TNNTGLILSLKYSDSVLAKYPE-------LGNNNKSGIII 273
             G + P  K          T+ TG ++  +   +VL +  +       L     S  ++
Sbjct: 159 TLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQRNQVCLFVTLLHKPTGSLFVV 218

Query: 274 GTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
             T L+W     Y+  +  QCF+++ ++K   KR   L    D +  +      GD NS
Sbjct: 219 VNTQLYWK----YDEVKLAQCFIIMRRLKAIVKR---LLTRKDTSYSNIKVLLSGDLNS 270

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 100/248 (40%), Gaps = 47/248 (18%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNE-FKYYNPDLICLQEIDHIQF 181
           TFT MTYN L+   +  +++    E  K W  R R+L  E    Y  D++C+QE+    +
Sbjct: 33  TFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDY 92

Query: 182 QSFWQEEFK-KMGYASQF---------HRIHSKNHGVAI--------------VWKNNLF 217
             FW+  FK KM Y S F          R   +  GV I              ++ N+L 
Sbjct: 93  DGFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLI 152

Query: 218 RLTDRMLIDFDKELSGDILPRTKTNNTG-------LILSLKYSDSVLAKYPELGNNNKSG 270
            L +   +++   L   I+  T TN  G       L+  L   + V      +    ++ 
Sbjct: 153 GLFNISELNY---LKSTII--TLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTL 207

Query: 271 IIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDF 328
            ++  THL+W     Y+  +  QC  ++ K+    K  ++L              F GD 
Sbjct: 208 FVVINTHLYW----KYDEVKLCQCLTIMRKLHRVIK--SLLMGREGVTYSKVKILFAGDL 261

Query: 329 NSQPFDTP 336
           NS P D+P
Sbjct: 262 NSAP-DSP 268

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 112/265 (42%), Gaps = 52/265 (19%)

Query: 107 IRRPLLTLHDDEPEKSF------TFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVL 159
           +R P L++   +P ++       TFT ++YN L+   +  +++    +  K W  R  +L
Sbjct: 20  VRGPSLSIPIQQPHQTLPAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLL 79

Query: 160 LNE-FKYYNPDLICLQEIDHIQFQSFWQEEFKK-MGYASQFHRIHSKNH---------GV 208
             E    Y  D++C+QE+  I + SFW++  +K   Y S+F   +  N+         GV
Sbjct: 80  EKEILDKYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGV 139

Query: 209 AIVWK--------------NNLFRLTDRMLIDF--DKELS-----GDILPRTKTNNTGLI 247
            I +               N+L    DR  +D+   KE++     GD+  +        +
Sbjct: 140 GIFYNLDMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKES------L 193

Query: 248 LSLKYSDSVLAKYPELGNN-NKSGIIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKK 304
             L  S + +  +  + +  +K   +I  THL+W     YE  +  QC +++ K+ +   
Sbjct: 194 YELALSKNQVCLFVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVN 249

Query: 305 RVNVLQNNNDGNMDHWTAFFCGDFN 329
            +     + D N +     F GD N
Sbjct: 250 ELLFNAESRDMNYNKVKILFSGDLN 274

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 110/239 (46%), Gaps = 43/239 (17%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNE-FKYYNPDLICLQEIDHIQF 181
           +FTL+TYN L+Q+ +  +++       K W  R ++L  E  K YN D+ICLQE+    +
Sbjct: 21  SFTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDY 80

Query: 182 QSFWQEEFKKMGYASQF---------HRIHSKNHGVAIVWKNNLF--------RLTDRML 224
           + +W+++  K    S F          +      GV I +  ++F        RL+D ++
Sbjct: 81  EYYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLI 140

Query: 225 IDFDK-ELSGDILPRTK---TNNTGLILSLKYSDSVLAKYPELG-----NNNKSGI--II 273
            DF++ EL  D L   K   T+  G  + +     VL +  ++       + ++G   ++
Sbjct: 141 SDFEQPEL--DYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVV 198

Query: 274 GTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
            TTHL+W     Y+  +  QC +++ ++ +  K     Q   DG+       F GD NS
Sbjct: 199 VTTHLYWK----YDEIKLTQCMIIMRQLSKIMKD----QLKKDGS-SFVKVLFAGDLNS 248

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 99/236 (41%), Gaps = 36/236 (15%)

Query: 125 FTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEFKY-YNPDLICLQEIDHIQFQ 182
           FT++TYN L+   +  +++    +  K W  R R+L +E  Y Y  D+ICLQE+    + 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 183 SFWQEE-FKKMGYASQFHRIHSKNH---------GVAIVWKNNLFR-------LTDRMLI 225
            FW+++   +M Y S F       +         GV I +  + F          + ++ 
Sbjct: 94  EFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVG 153

Query: 226 DFDKELSGDILPR--TKTNNTGLILS-------LKYSDSVLAKYPELGNNNKSGIIIGTT 276
            FD++    +     T TN  G ++         K  + V          +KS I++  T
Sbjct: 154 TFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVINT 213

Query: 277 HLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
           HL+W     Y+  +  QC +++ K++   K   +L         +    F GDFNS
Sbjct: 214 HLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSGDFNS 263

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 101/248 (40%), Gaps = 60/248 (24%)

Query: 125 FTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNE-FKYYNPDLICLQEIDHIQFQ 182
           FTL+TYN L+   +  +++    E  K W  R R+L +E FK Y  D++CLQE+    + 
Sbjct: 30  FTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYH 89

Query: 183 SFWQEEFKK-MGYASQF---------HRIHSKNHGVAIVWKNNLFR--------LTDRML 224
           +FW ++ K+ + Y S F          R   +  GV I +  + F         L D + 
Sbjct: 90  NFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSIYLNDVLG 149

Query: 225 IDFDKEL-------------SGDILPRTKT-------NNTGLILSLKYSDSVLAKYPELG 264
           I   +EL             +G+ + +          N   L +SL++ D+         
Sbjct: 150 IFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDT--------- 200

Query: 265 NNNKSGIIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTA 322
               +  ++  THL+W     Y+  +  QC  ++ K++   K  ++L             
Sbjct: 201 ---NTVFVVINTHLYWK----YDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKI 251

Query: 323 FFCGDFNS 330
            F GD NS
Sbjct: 252 LFSGDLNS 259

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 105/237 (44%), Gaps = 38/237 (16%)

Query: 125 FTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEF-KYYNPDLICLQEIDHIQFQ 182
           FTL++YN L+ + +  +++    E  K W  R ++L  E    Y  D++CLQE+    + 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 183 SFWQEEFK-KMGYASQF---------HRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKEL- 231
           +FW++  +  M Y S +          R   +  GV I +  + F    R  I  ++ L 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 232 --SGDIL------PRTKTNNTG------LILSLKYSDSVLAKYPELGNNNKSGI-IIGTT 276
             S + L      P T T+  G       +L +  S + +A +  L +     + ++  T
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINT 201

Query: 277 HLFWHPFGTYERTR--QCFVLLNKV-KEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
           HL+W     Y+  +  QC +++ ++ +  +K +  L+N  D   D     F GD NS
Sbjct: 202 HLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTD---DKIKILFTGDLNS 251

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 96/242 (39%), Gaps = 36/242 (14%)

Query: 119 PEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEF-KYYNPDLICLQEI 176
           P+    FTL+TYN L+ A +  +++    E  K W  R  +L  E    Y  D++C+QE+
Sbjct: 33  PKHDNRFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEM 92

Query: 177 DHIQFQSFWQ----------EEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLT------ 220
               +Q FW            EF        + R   +  GVAI +   +F         
Sbjct: 93  TKRDYQQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIY 152

Query: 221 -DRMLIDFD---------KELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270
            ++ML  F+         K+L         T  T L+  LK  + V         +    
Sbjct: 153 LNQMLDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMY 212

Query: 271 IIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDF 328
            ++  THL+W     Y+  +  QC V++ ++ +     ++L++  D   +     F GD 
Sbjct: 213 FVVINTHLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDL 266

Query: 329 NS 330
           NS
Sbjct: 267 NS 268

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 103/252 (40%), Gaps = 68/252 (26%)

Query: 125 FTLMTYNCLAQALIRRKLF---PDSGEAVKWYRRSRVLLNE-FKYYNPDLICLQEIDHIQ 180
            +++TYN L+   +  +++   PD  E  KW  R ++L  E    Y  D++CLQE+  + 
Sbjct: 22  LSVLTYNMLSPYYMWPQVYTYVPD--EYKKWNYRHKLLQKEILGLYRADIMCLQELTSLD 79

Query: 181 FQSFWQEEF-KKMGYASQF---------HRIHSKNHGVAI--------------VWKNNL 216
           +Q +W +   +K  Y S++          R  S+  GV +              ++ N+L
Sbjct: 80  YQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDL 139

Query: 217 F----------------RLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKY 260
           F                +LTD      +K    D+L     N   + +SL++  +     
Sbjct: 140 FGTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVL--KGRNQVCMFVSLRHKAT----- 192

Query: 261 PELGNNNKSGIIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMD 318
                   + +I+  THL+W     Y+  +  QC +++ ++ +  K  ++L    D   +
Sbjct: 193 -------NTFLIVINTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYN 239

Query: 319 HWTAFFCGDFNS 330
                F GD NS
Sbjct: 240 KVKIIFAGDMNS 251

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 96/238 (40%), Gaps = 40/238 (16%)

Query: 125 FTLMTYNCLAQALIRRKLF---PDSGEAVKWYRRSRVLLNE-FKYYNPDLICLQEIDHIQ 180
           FT MTYN L+   +  +++   PD  E   W  R ++L  E    Y  D++CLQE+    
Sbjct: 29  FTFMTYNMLSPHYMWPQVYTYVPD--EYKDWNYRHKLLEKEILNSYRADIMCLQELTASD 86

Query: 181 FQSFWQEEF-KKMGYASQF---------HRIHSKNHGVAIVWKNNLFRL---TDRMLIDF 227
           +  +W+E   +   Y S+F          +      GV I +  N F     T   L D 
Sbjct: 87  YHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDL 146

Query: 228 DKELSGDILPRTKTNNTGL------------ILSLKYSDSVLAKYPELGNNNKSGI-IIG 274
                 D L   K+    L            +L +  S + +  +  L + + + I ++ 
Sbjct: 147 IGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKDTNTIFVVI 206

Query: 275 TTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330
            THL+W     Y+  +  QC +++ K+ +  +  ++L   +    +     F GD NS
Sbjct: 207 NTHLYW----KYDEVKLTQCLIIMRKLAKIIR--DLLVGEHGTTYNKMKVVFAGDLNS 258

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 101/252 (40%), Gaps = 69/252 (27%)

Query: 125 FTLMTYNCLAQALIRRKLF---PDSGEAVKWYRRSRVLLNEF-KYYNPDLICLQEIDHIQ 180
           FTL+TYN L+   +  +++   PD  E   W  R  +L +E  + Y  D++CLQE+    
Sbjct: 37  FTLLTYNMLSPYYMWPQVYNYVPD--EFKDWKYRHMLLEDELLRTYKADVMCLQELTWED 94

Query: 181 FQSFWQEEF-KKMGYASQF---------HRIHSKNHGVAIVW------------------ 212
           + S+W+  F K++ Y S+F          +   +  G  I +                  
Sbjct: 95  YLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFLNDV 154

Query: 213 ------------KNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKY 260
                       K  + +LTD       +E   +IL     N   L +SLK+ ++     
Sbjct: 155 VNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEIL--KNRNQVCLFVSLKHKET----- 207

Query: 261 PELGNNNKSGIIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMD 318
                 N   ++I  THL+W     Y+  +  QC +++ K+ +    +N L    D ++ 
Sbjct: 208 ------NNVFVVIN-THLYW----KYDEVKLTQCMIIMRKLSQI---INELLIGADPSLS 253

Query: 319 HWTAFFCGDFNS 330
               F  GD NS
Sbjct: 254 KDVIFITGDLNS 265

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 120 EKSFTFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVL----LNEFKYYNPDLICLQ 174
            K   FTL+TYN L+ + +  +++    E  K W  R R+L    LN FK    D++CLQ
Sbjct: 22  RKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFK---ADIMCLQ 78

Query: 175 EIDHIQFQSFWQEEFK-KMGYASQF 198
           E+    ++ +W +     + Y S+F
Sbjct: 79  EMTARDYEDYWHDSIGVDVNYGSKF 103

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 9/84 (10%)

Query: 121 KSFTFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVL----LNEFKYYNPDLICLQE 175
           K   FTL+TYN L+ + +  +++    E  K W  R ++L    LN FK    D++CLQE
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFK---ADIMCLQE 79

Query: 176 IDHIQFQSFWQEEFK-KMGYASQF 198
           +    ++ +W +     + Y S+F
Sbjct: 80  MTRRDYEDYWHDSIGVNINYGSKF 103

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 98/238 (41%), Gaps = 38/238 (15%)

Query: 124 TFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEFKY-YNPDLICLQEIDHIQF 181
           T +++TYN L+   +  +++    +  K W  R ++L  E  Y +  D++CLQE+    +
Sbjct: 29  TLSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDY 88

Query: 182 QSFWQEEFK-KMGYASQF---------HRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKEL 231
             FW+++ K ++ Y S F              +  GV   +           +I  +  L
Sbjct: 89  NQFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFL 148

Query: 232 SG------DILPR---TKTNNTGLILSLKYSDSVLAKYPELG-------NNNKSGIIIGT 275
           S       D + R   T+TN     ++ +   S+L    ++         + KS I++  
Sbjct: 149 SMFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTKSLIVVVN 208

Query: 276 THLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDG-NMDHWTAFFCGDFNS 330
           THL+W     Y+  +  QC  ++ K+K+    +N L    +G           GD NS
Sbjct: 209 THLYWK----YDEVKLSQCLTIMRKLKQV---INKLTTTLEGVTYSQIKIILGGDLNS 259

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 120 EKSFTFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRR----SRVLLNEFKYYNPDLICLQ 174
           +K   FTL+TYN L+ + +  +++    E  K W  R     R LLN FK    D++CLQ
Sbjct: 22  QKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFK---ADIMCLQ 78

Query: 175 EIDHIQFQSFWQEEFK-KMGYASQF 198
           E+    ++ +W++     + Y S+F
Sbjct: 79  EMTARDYEDYWRDYIGVDINYGSKF 103

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 95/250 (38%), Gaps = 67/250 (26%)

Query: 125 FTLMTYNCLAQALIRRKLFPDSGEAVK-W-YRRSRVLLNEFKYYNPDLICLQEIDHIQFQ 182
           FT+++YN L+ + +  +++    +  K W YR + + L     Y  D++C+QE+    + 
Sbjct: 30  FTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDYI 89

Query: 183 SFWQEEF-KKMGYASQF---------HRIHSKNHGVAIVW-------------------- 212
            +WQ +    +GY S+F          R      GVAI +                    
Sbjct: 90  DYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFLD 149

Query: 213 ----------KNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPE 262
                     K     LTD   I  D++   +IL  +  N   L + LK+ ++       
Sbjct: 150 VFNPEELQYLKEKTLELTDGAGIKIDEKTLFEIL--SVKNQVSLFVCLKHKET------- 200

Query: 263 LGNNNKSGIIIGTTHLFWHPFGTYERTR--QCFVLLNKVKEFKKRVNVLQNNNDGNMDHW 320
                    II  THL+W     Y+  +  QC +++   +E  K ++ L    D      
Sbjct: 201 -----GQVFIIINTHLYW----KYDEVKLSQCIIIM---RELSKIIDELL--QDVRHSKV 246

Query: 321 TAFFCGDFNS 330
              F GD NS
Sbjct: 247 KIIFAGDLNS 256

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 117 DEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEF-KYYNPDLICLQ 174
           + P+K FT  ++TYN L+   +  +++    +  K W  R ++L  E  + Y  D++CLQ
Sbjct: 42  ENPDKKFT--MLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQ 99

Query: 175 EIDHIQFQSFWQEEF-KKMGYASQF 198
           E+    + S+W+ +  +KM Y S+F
Sbjct: 100 ELTWEDYISYWKPKCNEKMNYGSKF 124

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 121 KSFTFTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEF-KYYNPDLICLQEIDH 178
           K   FTL+TYN L+ + +  +++    E  K W  R ++L  E    +  D++CLQE+  
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTT 82

Query: 179 IQFQSFWQEEFK-KMGYASQF 198
             ++++W       + Y S+F
Sbjct: 83  RDYENYWHNSIGVDINYGSKF 103

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 125 FTLMTYNCLAQALIRRKLFPDSGEAVK-WYRRSRVLLNEF-KYYNPDLICLQEIDHIQFQ 182
           FTL+TYN L+ + +  +++    +  K W  R ++L +E    Y  D++CLQE+    + 
Sbjct: 30  FTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYN 89

Query: 183 SFWQEEF-KKMGYASQF 198
             W+      +GY S+F
Sbjct: 90  ENWKRLLGSGIGYGSKF 106

>AER107W Chr5 (838830..840740) [1911 bp, 636 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR424W (SPP382)
          Length = 636

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 390 PQTPVPDSYTPTPEQADLVS-KMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPE 448
           P  P+  SY    E  D++S  M+S  ++LN   T +Y + ++++H   + +D +KG   
Sbjct: 244 PLDPLDPSYLILLELVDVLSYVMDSSTSTLNQTQTVIYNIVWERLHGFWTNIDMQKGHV- 302

Query: 449 ISNWAHSWRGLLDYIFYVDH 468
           ++     ++ +LD++   D+
Sbjct: 303 LAGILLDYKSILDFVHCSDY 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,401,870
Number of extensions: 2515869
Number of successful extensions: 6254
Number of sequences better than 10.0: 75
Number of HSP's gapped: 6205
Number of HSP's successfully gapped: 78
Length of query: 529
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 415
Effective length of database: 40,409,475
Effective search space: 16769932125
Effective search space used: 16769932125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)