Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I003108.849ON60860830230.0
TDEL0B001808.849ON58257815380.0
YMR284W (YKU70)8.849ON60257614570.0
Skud_13.4578.849ON60257514490.0
NCAS0C003208.849ON60858714490.0
Smik_13.5008.849ON60257614350.0
Suva_13.4748.849ON60257314330.0
KAFR0L019508.849ON58858214080.0
ZYRO0C14850g8.849ON59458214070.0
Kwal_27.101998.849ON57257813291e-177
NDAI0K003608.849ON62058813201e-175
SAKL0D01188g8.849ON58158913121e-175
KLTH0C03586g8.849ON57856712961e-172
Kpol_1068.18.849ON51448512501e-166
KNAG0M02650singletonON57458012411e-164
KLLA0C06226g8.849ON59258012141e-160
CAGL0I02662g8.849ON60656911521e-150
TBLA0B028908.849ON64862711101e-143
AFR443CsingletonON5765619041e-113
Ecym_46208.849ON5975647902e-96
ABL117C8.849ON6025496131e-70
Kpol_1056.211.506ON1064134724.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00310
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...  1169   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   597   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   565   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   562   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   562   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   557   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   556   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   546   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   546   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   516   e-177
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     513   e-175
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   509   e-175
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   503   e-172
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   486   e-166
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   482   e-164
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   472   e-160
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   448   e-150
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   432   e-143
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   352   e-113
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   308   2e-96
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   240   1e-70
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...    32   4.6  

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/608 (95%), Positives = 581/608 (95%)

Query: 1   MENSSKLLSHNXXXXXXXXXXXXXXSSIDNPKASYRKYESHEGYMFCIELSEHMFSEISQ 60
           MENSSKLLSHN              SSIDNPKASYRKYESHEGYMFCIELSEHMFSEISQ
Sbjct: 1   MENSSKLLSHNDEIYDDEDEFYIDYSSIDNPKASYRKYESHEGYMFCIELSEHMFSEISQ 60

Query: 61  LNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFNCDNKESKKRIYEFLPLRDINVSDM 120
           LNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFNCDNKESKKRIYEFLPLRDINVSDM
Sbjct: 61  LNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFNCDNKESKKRIYEFLPLRDINVSDM 120

Query: 121 KKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVF 180
           KKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVF
Sbjct: 121 KKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVF 180

Query: 181 LFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFFINKIXXXXXXXXXXXXXILKLR 240
           LFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFFINKI             ILKLR
Sbjct: 181 LFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFFINKIDSSDNFDDSFYSDILKLR 240

Query: 241 NSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHE 300
           NSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHE
Sbjct: 241 NSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHE 300

Query: 301 KPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKG 360
           KPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKG
Sbjct: 301 KPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKG 360

Query: 361 NDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKN 420
           NDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKN
Sbjct: 361 NDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKN 420

Query: 421 RNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELI 480
           RNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELI
Sbjct: 421 RNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELI 480

Query: 481 RNKDYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKE 540
           RNKDYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKE
Sbjct: 481 RNKDYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKE 540

Query: 541 QLKQKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKE 600
           QLKQKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKE
Sbjct: 541 QLKQKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKE 600

Query: 601 MKPKKQKN 608
           MKPKKQKN
Sbjct: 601 MKPKKQKN 608

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/578 (52%), Positives = 400/578 (69%), Gaps = 8/578 (1%)

Query: 31  PKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGV 90
           P   YR+Y+ HEG +FCIELS  MF E+ +LNYK+QLIE+LE+L +LMSQLVITRPSTG+
Sbjct: 12  PGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGI 71

Query: 91  GCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKG 150
           GC+FFNC+  ++K  IY FLPL+D+N   MKKL DLL+D++ ER ++R    +D    K 
Sbjct: 72  GCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDA--SKH 129

Query: 151 NSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDN 210
             LESL  L+++ F  ++P QK + NKK+F FTDND P E++D +   RLR L +D+ D 
Sbjct: 130 TPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDR 189

Query: 211 YIQFVTFFINKIXXXXXXXXXXXXXILKLRNSNSIEFDGPSTKPISVAYIKNKVLRKKEI 270
           +I F TFFI K               L      S EFDGP+T PIS AYIK++VLRK+EI
Sbjct: 190 FINFTTFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIKSRVLRKQEI 249

Query: 271 KRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKT 330
           KRIMFQCPLIL   S F V VKGYTIISHEKPG RYKLVYE+E+IR+EAFS+RK LN KT
Sbjct: 250 KRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKT 309

Query: 331 GTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIG 390
           G  + KD   K++  G+  I   E++  +  ++   +E FLK+IGF+S E  LH +NNI 
Sbjct: 310 GEEI-KDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIE 368

Query: 391 KALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQN 450
           KA F+VPDE R  GSIRTLSS+++ +R KN+ AIVWGKLKSNSNP I+   PSD     N
Sbjct: 369 KATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEAS-PN 427

Query: 451 EGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLEF 510
           EGFYLY+VPFLDE+R+IP       S   I++ DYENLK  T+ ++ +FNL NG+ P EF
Sbjct: 428 EGFYLYRVPFLDELRRIPPMLI---SHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEF 484

Query: 511 KNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASST 570
           KNP LQK++K+LHDYLLQ+E  PE +  + Q + K+LEEDD++R+   IRDKI +SA+S 
Sbjct: 485 KNPGLQKHFKILHDYLLQIEEEPEKDDVEWQ-RSKLLEEDDSLRRISQIRDKIDESANSK 543

Query: 571 ESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQKN 608
           + +KQ+LS    IWN +Y K+   E A+ +    K+K 
Sbjct: 544 DPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKG 581

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/576 (51%), Positives = 401/576 (69%), Gaps = 13/576 (2%)

Query: 32  KASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVG 91
           +  YRK++ HEG +FCIELSE MF E S L YK  L+E+LESL ELMSQLVITRP T +G
Sbjct: 20  ETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIG 79

Query: 92  CFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEI-NDKG 150
           C+F+ C+ +++K+ IYE  PLRDIN + MKKL+DLL+D+   R+S+ D F F +  ++K 
Sbjct: 80  CYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQ 139

Query: 151 NSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDN 210
             L  LF  + D F   IPGQK  +NK+VFLFTD DKP+E+ D ++  RLRRL  D+ DN
Sbjct: 140 VRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDN 199

Query: 211 YIQFVTFFINKIXXXXXXXXXXXXXILKL---RNSNS---IEFDGPSTKPISVAYIKNKV 264
            + F TFFI                IL+L    N N+    EFDGPSTKPI   YIK+++
Sbjct: 200 KVNFATFFIG--YADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRI 257

Query: 265 LRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRK 324
           LRKKE+KRIMFQCPLIL+  ++F V VKGYT+ +HEK G RYKLVYEHE+IR+EA+SKRK
Sbjct: 258 LRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRK 317

Query: 325 LLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLH 384
            LN  TG  VT   T K++  G+  IN  +++ +   +    ++ FLK+IGFRS   S+H
Sbjct: 318 FLNPITGEDVTG-KTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIH 376

Query: 385 LFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSD 444
            FNNI K+ FIVPDE++  GSIRTL+S+ + +R K++ AI+WGKLKSNS+P+++ LSPS 
Sbjct: 377 YFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPS- 435

Query: 445 PTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNG 504
             KD NEGFYLY+VPFLDEIRK PS  ++    E     DY+N+K+VT++I+GYFNL +G
Sbjct: 436 SVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSE--HKLDYDNMKKVTQSIMGYFNLRDG 493

Query: 505 YSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKII 564
           Y+P +FKNPLLQK+YK+LHDYLLQ+ET  +   +    K +++ EDD++RK + IR+KI+
Sbjct: 494 YNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRNKIL 553

Query: 565 KSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKE 600
           +S  S +   QRL+    IWN  Y K   + I++KE
Sbjct: 554 ESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKE 589

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/575 (49%), Positives = 396/575 (68%), Gaps = 9/575 (1%)

Query: 33  ASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGC 92
           A YRK++ HEG +FC+ELSE MF E  +L+YK  L+E+LESL ELMSQLVITRP T +GC
Sbjct: 21  AGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAIGC 80

Query: 93  FFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEIN-DKGN 151
           +F+ C   ++K+ I+EF PLRDIN + MK+L+DLL+D+   R+++ + F F      +  
Sbjct: 81  YFYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPTEKQRQM 140

Query: 152 SLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNY 211
            L  LF  + D F  +IPGQ+  ++KKVFLFTDND P+E+ D +   RLR L  D+ DN 
Sbjct: 141 PLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLTIDLFDNK 200

Query: 212 IQFVTFFINKIXXXXXXXXXXXXXILKLRNSNSI----EFDGPSTKPISVAYIKNKVLRK 267
           + F TFFI                 L    +  +    EFDGP+TKPI+  YIK+K+LRK
Sbjct: 201 VNFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPINAKYIKSKILRK 260

Query: 268 KEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLN 327
           KEIKRIMFQCPL+   + DF V VKGYT+ SHEK G RYKLVYEHE++RREAFSKRK LN
Sbjct: 261 KEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKFLN 320

Query: 328 GKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFN 387
             TG  VT   T K++  G+  IN  EN+ +   +    ++ FL++IGFRS   ++H FN
Sbjct: 321 PMTGEDVTS-STVKVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHYFN 379

Query: 388 NIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTK 447
           NI K+ FIVPDE++  GS+RTL+S+++T+R K++ AI+WGKLK+NS+ ++++LSPS   K
Sbjct: 380 NIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSS-IK 438

Query: 448 DQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSP 507
           + NEGFYLY+VPFLDEIRK PS  ++   ++     DYEN+K++T+NI+GYFNL +GY+P
Sbjct: 439 EYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKY--KLDYENMKKITQNIMGYFNLKDGYNP 496

Query: 508 LEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSA 567
            +F+NP LQK++K+LHDYLLQ+ET PE   + +    +I+ EDD++RK + IR+KI+ S 
Sbjct: 497 SDFRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLRKLYHIRNKILDSE 556

Query: 568 SSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMK 602
            S +   QRL+    IWN  Y+K   + I+VKE K
Sbjct: 557 KSEDPAIQRLNKYVKIWNVFYNKFNDDSISVKEEK 591

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/587 (50%), Positives = 395/587 (67%), Gaps = 33/587 (5%)

Query: 29  DNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPST 88
           D+P  S++KY+ HEG +FCIELS+ MF E+ +LNYKVQL+E+LESL ELMSQLVI RPST
Sbjct: 10  DHP--SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPST 67

Query: 89  GVGCFFFNCD--NKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEI 146
           G+GC+F  CD  N +SK  IYEF PLRD+N  DMKK+ DL++D+  +R+++ + F FD  
Sbjct: 68  GIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPT 127

Query: 147 NDKGNS----LESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRR 202
            D  +     LE+LF  + D+F+        Y +KK+FLFTDND P E NDK+ T+R+RR
Sbjct: 128 LDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRR 187

Query: 203 LFDDISDNYIQFVTFFINKIXXXXXXXXXXXXXILKLR---------------NSNSIEF 247
           + DD++DNYI FVTFFI +              ILKL                +    E+
Sbjct: 188 IVDDMNDNYINFVTFFIGR--EGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEY 245

Query: 248 DGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYK 307
           DGP+T PI  +YIK+K+LRKKEIKR MFQCPLIL  +++F V+V+GY I++ EKP +RYK
Sbjct: 246 DGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYK 305

Query: 308 LVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQ 367
           LVYEHENIR+EA S+RK LN  TG  +  D+  K+F  G+  I   + E  K ND+    
Sbjct: 306 LVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKH 365

Query: 368 EPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWG 427
           E FLK+IGFRS +NS+  FNNI KALF+VPDES+  G+I+T++S++R ++ +++  IVWG
Sbjct: 366 ESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWG 425

Query: 428 KLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKIPS--QYTHFPSDELIRNKDY 485
           K+KSNSN  ++ILSP+    D+NEGFYLY++PFLDEIRK P    Y H  + E     DY
Sbjct: 426 KVKSNSNLRLYILSPT-TNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-----DY 479

Query: 486 ENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQK 545
            NL R+T NI+GYFNL  GY P +FKNP LQ++YK LHDYLLQVE     +   +    +
Sbjct: 480 LNLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSR 539

Query: 546 ILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLE 592
            L+EDDT+ K   IR+KII S  S +  +QRLS   ++WN  Y K+E
Sbjct: 540 FLKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKME 586

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/576 (50%), Positives = 397/576 (68%), Gaps = 11/576 (1%)

Query: 28  IDNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPS 87
           +D P   YRK++ HEG +FC+ELSE MF E S+L+YK  L+E+LESL ELMSQLVITRP 
Sbjct: 18  MDEP--GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPG 75

Query: 88  TGVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEI- 146
           T +GC+F+ C   ++K+ IYE  PLRDINV  MKKL+DLL+D+  ER+++ + F F +  
Sbjct: 76  TAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTE 135

Query: 147 NDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDD 206
           N K   L SLF  I D F  +  GQK   NK+VFLFTDNDKP+E+ + +   RLRRL  D
Sbjct: 136 NQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVD 195

Query: 207 ISDNYIQFVTFFINKIXXXXXXXXXXXXXILKLRNSNSI----EFDGPSTKPISVAYIKN 262
           + DN I F TFFI  +              L    + +I    EFDGP+TKPI   YIK+
Sbjct: 196 LFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKS 255

Query: 263 KVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSK 322
           ++LRK+E+KRIMFQC LI +  +DF + +KGYT+ SHEK G RYKLVYEHE+IR+EA+SK
Sbjct: 256 RILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSK 315

Query: 323 RKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENS 382
           RK LN  +G  VT D+T K++  G+  IN  E++ +   +    ++ FLK+ GFRS   S
Sbjct: 316 RKFLNFMSGEDVT-DNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSIS 374

Query: 383 LHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSP 442
           +H FNNI K+ FIVPDE +  GSIR L+S+ + +R K++ AI+WGKLKSNS+P++++LSP
Sbjct: 375 MHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSP 434

Query: 443 SDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLT 502
           S+  K+ NEGFYLY+VPFLDEIRK PS  ++   D      DY+N+K+VT++I+GYFNL 
Sbjct: 435 SN-IKEYNEGFYLYRVPFLDEIRKFPSLLSY--DDGSDHEIDYDNMKKVTQSIIGYFNLR 491

Query: 503 NGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDK 562
           +GY+P +FKNPLLQK+YK+LHDYLLQ ET  E   + +    +I+ EDD++RK + IR+K
Sbjct: 492 DGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNK 551

Query: 563 IIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAV 598
           I++S  S +   QRL+    IWN  Y K   ++I+V
Sbjct: 552 ILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/573 (49%), Positives = 395/573 (68%), Gaps = 9/573 (1%)

Query: 33  ASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGC 92
           ASYRK++ HEG +FCIELS  MF E  +LNYK  L+E+LESL ELMSQLVITRP T +GC
Sbjct: 21  ASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGC 80

Query: 93  FFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGN- 151
           +F+ C   ++K+ IYE  PLRDIN   MK L+DLL+DV   R+++ + F F     +   
Sbjct: 81  YFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQM 140

Query: 152 SLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNY 211
            L  LF  + D F  +IPGQK  ++KK+FLFTDNDKP+ES D ++  RLRRL  D+ DN 
Sbjct: 141 PLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNK 200

Query: 212 IQFVTFFINKIXXXXXXXXXXXXXILKLRNSNSI----EFDGPSTKPISVAYIKNKVLRK 267
           + F TFFI                 L    +  +    EFDGP+TKPI   YIK+K+LRK
Sbjct: 201 VNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRK 260

Query: 268 KEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLN 327
           KE+KRI FQCPLI + D++F + VKGYT+ SHEK G RYKLVYEHE+IR+EA+SKRK LN
Sbjct: 261 KEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLN 320

Query: 328 GKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFN 387
             TG  VT   T K++  G+  IN  E + +   +    ++ FL++IGFRSP +S+H FN
Sbjct: 321 PTTGADVT-GSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFN 379

Query: 388 NIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTK 447
           NI K+ FIVPDE++  GSIRTL+S+ +T+R K++ AIVWGKLKSNS+P++++LSPS   +
Sbjct: 380 NIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSS-IE 438

Query: 448 DQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSP 507
           + NEGFYLY++PFLDEIRK PS  ++   ++     +Y+N+KR++++I+GYFNL +GY+P
Sbjct: 439 EYNEGFYLYRIPFLDEIRKFPSLLSYDSGEK--HELEYDNMKRISQSIMGYFNLRDGYNP 496

Query: 508 LEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSA 567
            +FKNP LQ+++K+LHDYLLQ+E   E   + E    +++ EDD++RK + IR+KI++S 
Sbjct: 497 SDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESE 556

Query: 568 SSTESHKQRLSANFNIWNDIYSKLEGNEIAVKE 600
            S +   QRL+    IWN  Y+K   + I+VK+
Sbjct: 557 KSEDPAIQRLNKYVKIWNTFYNKFNDDNISVKD 589

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/582 (47%), Positives = 398/582 (68%), Gaps = 14/582 (2%)

Query: 29  DNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPST 88
           D+  ASY+K+ESHE  +F +ELS+ MF  + +LN K+QLIE+LESL ELMSQL++ RP+ 
Sbjct: 11  DDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQLIVVRPNA 69

Query: 89  GVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEIND 148
            +GC+F  C  + +   IYEF PL DIN  +MKKL DLL+D++ +R+++ D F+++  N 
Sbjct: 70  AIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQYN--NA 127

Query: 149 KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDIS 208
           K  S+E LF    ++FS  + GQ+ YT +++FLFTDND P +  DKE    LR++ DD+ 
Sbjct: 128 KKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLD 187

Query: 209 DNYIQFVTFFINKIXXXXXXXXXXXXXILKLRNSNSIEFDGPSTKPISVAYIKNKVLRKK 268
           ++++ FV FFI +               L  R  +S E+DGP+T PI  +YIK+KVLRK+
Sbjct: 188 ESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIKSKVLRKR 247

Query: 269 EIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNG 328
           EIKR+ F+CPLILN   +F V ++GY  +SHEK  +RYKLVYE+EN+R+EAFS+RK L+ 
Sbjct: 248 EIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSS 307

Query: 329 KTGTVVTKDDTEKIFQLGNFSINSFENEF---EKGNDNPLPQEPFLKLIGFRSPENSLHL 385
           +T   +   +  KIF LG+  I   E  F   EK +D+      FLK++GFRS ++ +  
Sbjct: 308 ETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDD---VRSFLKVVGFRSIKSCVKY 364

Query: 386 FNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDP 445
            NNI K +F+VPDE + V SI+ L+S+++T+RTK + AI+WGKLK+NSNP++++L PS  
Sbjct: 365 INNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSG- 423

Query: 446 TKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGY 505
            KD NEGFYL++VPFLDEIRK+P+  T+   +      DYENL +VT  I+ YFNL  GY
Sbjct: 424 EKDPNEGFYLHRVPFLDEIRKLPTMITYECGE---NTSDYENLIKVTEYIMAYFNLKGGY 480

Query: 506 SPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIK 565
           +P++ KNP +QKY+K+LHDYLLQ+E     E S E+ KQ++L EDDT+RK   IR+KII 
Sbjct: 481 NPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTER-KQRLLREDDTLRKVSHIREKIIS 539

Query: 566 SASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607
           S+ S ++  Q+LS    +WN+ Y+K+E   ++++  K KK+K
Sbjct: 540 SSRSEDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRK 581

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/582 (48%), Positives = 383/582 (65%), Gaps = 23/582 (3%)

Query: 34  SYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCF 93
           SYRKYE HEG +FCIELS  MF E+S+LNYKVQL+E+LE+L +LMSQLVI RP TG+GC+
Sbjct: 23  SYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTGIGCY 82

Query: 94  FFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSL 153
           F+NC+  ++K  IYEF PLRDIN   MKKL DLLDD+  +R++++    +DE   +   L
Sbjct: 83  FYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDE--SERTPL 140

Query: 154 ESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQ 213
           + L+  IQD F   + GQK + NKKVFLFTDND P E+ D E   RLR L DD+ D++I 
Sbjct: 141 DFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDMDDHFIN 200

Query: 214 FVTFFINKIXXXXXXXXXXXXXILKLRNSN---SIEFDGPSTKPISVAYIKNKVLRKKEI 270
           F TFFI K              +LKL  +    + EFDGP+T PIS +YIK++VLRK+E+
Sbjct: 201 FTTFFIGK--EEAPFDDSFYSDVLKLGATAEDPNTEFDGPNTTPISASYIKSRVLRKQEV 258

Query: 271 KRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKT 330
           KRIMFQC LIL     F V +KGYTII  E+PG RY+LVYE + +R+EA SKRK L+  T
Sbjct: 259 KRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFLDSNT 318

Query: 331 GTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIG 390
           G V+ +  T K+F  G+  I   + E  +   +   +E FLK+IGFR     +H FNNI 
Sbjct: 319 GEVIEEGLT-KVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFNNID 377

Query: 391 KALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQN 450
           +ALF+VPDE R  GSIRTL+S+++ +R K + A+VWGKLK+NS+P +++LSPS   +D N
Sbjct: 378 RALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSR-NEDPN 436

Query: 451 EGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYEN-----LKRVTRNILGYFNLTNGY 505
           EGFYLY++PF +E+R+ P          LIR+  Y+      LK  T++I+ +F    GY
Sbjct: 437 EGFYLYRIPFAEELRRFPQS--------LIRHNSYDTPEYNQLKDTTKSIIDHFQFAKGY 488

Query: 506 SPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIK 565
            P EF+NP LQK++K+LHDYLLQVE   E + S E  KQ++L EDD++ K   IRDKI+ 
Sbjct: 489 RPSEFRNPDLQKHFKILHDYLLQVEQEEEDD-SPESSKQRLLSEDDSLLKLAQIRDKIMD 547

Query: 566 SASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607
           SA S++  K +L   F +WN +Y  +          +PK ++
Sbjct: 548 SAQSSDPKKFQLDEYFQLWNRLYEDVSKATTLEDAPRPKPKQ 589

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  516 bits (1329), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 268/578 (46%), Positives = 377/578 (65%), Gaps = 21/578 (3%)

Query: 35  YRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFF 94
           Y+K+E HEG +FCIELS+ MF + S +N KVQL+E+LE+L+ELMSQ++I+ P TG+GC+F
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 95  FNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLE 154
           F+C ++ +   IYE LPL D+N   MKKL+DLLDD+     ++   F  DE       LE
Sbjct: 69  FHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDE--QLSTPLE 126

Query: 155 SLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQF 214
           ++F+L+Q++F N +PGQK Y NKK+FLFTDND PKE++D +  +RLR++ DD+ D +I F
Sbjct: 127 TVFILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINF 186

Query: 215 VTFFINKIXXXXXXXXXXXXXILKL-----RNSNSIEFDGPSTKPISVAYIKNKVLRKKE 269
            TFFI                ILKL      +     F+GPST PI+   IK + LRKKE
Sbjct: 187 TTFFIG--TEQKPFDQSFYSDILKLGAKKTASQGGSTFNGPSTAPINANLIKARALRKKE 244

Query: 270 IKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGK 329
           IKRI FQC L LN  +DF+V++KGYT++SHE+ G++YK VY+H  +R+E  S RK LN  
Sbjct: 245 IKRIRFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNAN 304

Query: 330 TGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNI 389
           TG  VT D   ++F+     I   E E  K + +  P + FLKLIGFR     L  ++NI
Sbjct: 305 TGEDVT-DSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNI 363

Query: 390 GKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQ 449
           G + F+VPDES   GSI+T+SS++R++  K ++A+VWGKLKSNSNP ++ILSPS  +KD 
Sbjct: 364 GNSSFVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPS-TSKDL 422

Query: 450 NEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLE 509
           NEGFYL +VPF+DE+RK P    +   DE +  K++E + ++T  ++ YF+L   Y P +
Sbjct: 423 NEGFYLTRVPFVDEVRKFPPIPRY---DEELGGKNFEQMCKITETLISYFSLRRPYKPSD 479

Query: 510 FKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASS 569
           FKNP LQK++KLL+DYLLQVE    +E     LK      DDT+ K + +R KI +S SS
Sbjct: 480 FKNPTLQKHFKLLYDYLLQVEVDCSSESVDGALKH-----DDTLLKLYQVRRKIQESLSS 534

Query: 570 TESHKQRLSANFNIWNDIYSKLEGNEIAV-KEMKPKKQ 606
            +  ++RL      WN +Y+K+   E+   K MK +K+
Sbjct: 535 KDPEEERLGTYVKAWNSLYNKISNQELTPDKGMKKQKK 572

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  513 bits (1320), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 282/588 (47%), Positives = 379/588 (64%), Gaps = 33/588 (5%)

Query: 31  PKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGV 90
           P ASY+KY+ HEG +FCIELS+ MF E+ +LNY VQL+E+LESL+ELMS LVI RPSTGV
Sbjct: 21  PSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGV 80

Query: 91  GCFFFNCD---------NKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAF 141
           GC+   C+         N +    IYE  PLRD+N  DMKKL DL +D++ ER+++   F
Sbjct: 81  GCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYF 140

Query: 142 KFDEIND----KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKT 197
           +FD  ND    K   LE LF  + D+F+     +  Y ++K+FLFTDND P ES + E  
Sbjct: 141 QFD--NDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAK 198

Query: 198 IRLRRLFDDISDNYIQFVTFFINK-------------IXXXXXXXXXXXXXILKLRNSNS 244
           +R+RRL DD++DNYI F TFFI               +              +   +   
Sbjct: 199 LRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEY 258

Query: 245 IEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGS 304
            EFDGP+TKPI   YIK+++LRKKEIKRI FQ PLILN D++F + ++GY + SHEKP +
Sbjct: 259 SEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNT 318

Query: 305 RYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNP 364
           RYKLVYE EN+R+EAFS RK LN  TG  +  D+  KIF  G+ +I   + E  K  +  
Sbjct: 319 RYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEI 378

Query: 365 LPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAI 424
              E FLK+IGFRS    L+ FNNI    F+VPDES+  GSIRT++S++RT++ K++ AI
Sbjct: 379 SCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAI 438

Query: 425 VWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKD 484
           +WGK+K+NS P +++L P+    D+NEGFYLY++PFL+EIRK P    +    +   N D
Sbjct: 439 IWGKMKTNSKPCLYLLCPTS-NSDRNEGFYLYRMPFLEEIRKFPKLLDY---KDRSSNPD 494

Query: 485 YENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQ 544
           Y NL ++T  I+ YF+L NGY P EF+NP LQ++Y++LHDYLLQVE        + Q+ Q
Sbjct: 495 YTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQI-Q 553

Query: 545 KILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLE 592
           K+LEEDDT+RK   IRDKI+ S  S +  +QRL    N+WN  Y KL+
Sbjct: 554 KLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQ 601

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  509 bits (1312), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 272/589 (46%), Positives = 385/589 (65%), Gaps = 25/589 (4%)

Query: 26  SSIDNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITR 85
           S+  + +  Y+KYE H G +FCIEL+  M+ ++++LN+K+QL+E+LESL ELMSQL++T 
Sbjct: 10  SNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTS 69

Query: 86  PSTGVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDE 145
           P+TGVGC+FF C+   S+  IYEFLPL+D+N  +MKKL+DLL+D++ +R ++ + F F  
Sbjct: 70  PNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPF-- 127

Query: 146 INDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFD 205
           +     SLES+ + ++++F   +P +K Y N KVFLFTDN KP    + E    LR++ +
Sbjct: 128 VPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVN 187

Query: 206 DISDNYIQFVTFFINKIXXXXXXXXXXXXXILKLRN-----SNSIEFDGPSTKPISVAYI 260
           D++D YI F  FFI+               ILKLR        S  FDGP+T PI  +YI
Sbjct: 188 DLNDCYINFTPFFID--TEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYI 245

Query: 261 KNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAF 320
           K++V RKKE +R+ FQCPLIL+  ++F +++KGYTIISHEKPG+RYKLVYE+E +R+EAF
Sbjct: 246 KSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAF 305

Query: 321 SKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPE 380
           S R+ L+  TG  V+ D   KIF  G+ +I   + +  K +        FLK+IGFRS +
Sbjct: 306 SHRRYLDASTGVDVS-DKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTD 364

Query: 381 NSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWIL 440
             L  +NN+ K  F+VPDE    GSIR ++S+YR +RTK ++A+VWGKLK NSNP I+++
Sbjct: 365 QCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLM 424

Query: 441 SPSDPTKDQNEGFYLYKVPFLDEIRKIPS--QYTHFPSDELIRNKDYENLKRVTRNILGY 498
           +PS    D NEGFYL ++PF+DEIR+ PS  QY      +++ ++DY ++ + T  I+ Y
Sbjct: 425 TPS-TENDPNEGFYLTRIPFIDEIRRFPSVPQYG-----DVLSSQDYGHMCQATETIIAY 478

Query: 499 FNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFS 558
           FNL NGY P EFKNP LQ Y+ LLHD LL+ +     +  +E LK      DDT+ K   
Sbjct: 479 FNLRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLK------DDTLLKLSQ 532

Query: 559 IRDKIIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607
           IRDKII+S+ S E  +QRLS  F  WN +Y+K E N+    E   KK K
Sbjct: 533 IRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK-EYNQHLSFECGEKKTK 580

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  503 bits (1296), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 272/567 (47%), Positives = 384/567 (67%), Gaps = 22/567 (3%)

Query: 30  NPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTG 89
           + ++ Y+K+E HEG +FC+ELSE MF E   LN KVQL+E+LE+L+ELM+Q++I  P TG
Sbjct: 11  DSESKYKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQVIIILPGTG 69

Query: 90  VGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDK 149
           +GCFFF C ++ +K  IYEFLPL D+N   MKKL+DLLDD+K    ++ + F F   NDK
Sbjct: 70  IGCFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPF---NDK 126

Query: 150 GN-SLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDIS 208
            N SLE++F+L+Q++FS ++ GQK Y NKK+FLFTDND+PKES+D+E   RLR++ DD+ 
Sbjct: 127 QNTSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLD 186

Query: 209 DNYIQFVTFFINKIXXXXXXXXXXXXXILKL-----RNSNSIEFDGPSTKPISVAYIKNK 263
           D++I  + FF+                ILKL      +    +++GP+T PIS   IK++
Sbjct: 187 DSFINIIPFFVG--SEQRPFDQSFYSDILKLGAKKKASDGPFKYEGPNTTPISAKLIKSR 244

Query: 264 VLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKR 323
           VLRKKEIKR+ FQC LILN  SDFQV++KGYT ISHE+ GS+YK VY+H+ +R+EA S R
Sbjct: 245 VLRKKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHR 304

Query: 324 KLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSL 383
           K L+  TG  VT +   K+F+     I   E+E  K N +    + FLKL+GFR     +
Sbjct: 305 KYLDANTGEDVT-ERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCV 363

Query: 384 HLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPS 443
             FNNI  + F+VPD+S   GSI+T++S++R +R K ++A+VWGKLKSNSNP+++ L+PS
Sbjct: 364 FYFNNISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPS 423

Query: 444 DPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTN 503
           +   D NEGFYL +VPF+DEIRK P    H     L + K +E + ++T  ++ YF+L +
Sbjct: 424 N-FNDHNEGFYLTRVPFIDEIRKFPPTAYH---GNLSKTKTFEQMCKITETLISYFSLRH 479

Query: 504 GYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKI 563
            Y P +F+NP LQK+++LLHDYLLQVE  P T  SKE L    L++DDT+ K   +R KI
Sbjct: 480 SYRPSDFENPTLQKHFELLHDYLLQVEVDP-TSGSKEHL----LKKDDTLLKLHQVRAKI 534

Query: 564 IKSASSTESHKQRLSANFNIWNDIYSK 590
           ++SA S +  + RLS     WN +Y++
Sbjct: 535 LESAESDDPVQARLSNYVKAWNSMYNR 561

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  486 bits (1250), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 262/485 (54%), Positives = 341/485 (70%), Gaps = 12/485 (2%)

Query: 29  DNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPST 88
           D  + SYRKY+ HEG MFC+ELSE MF ++ +LNYKVQL+E+LESL+ELMSQLVITRP T
Sbjct: 35  DGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGT 94

Query: 89  GVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEIND 148
           GVGC+ +NC    S   I+ F+PL D+NV  MKK++DLLDD+  ER ++   F +D+   
Sbjct: 95  GVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKT-- 152

Query: 149 KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDIS 208
           +   LESL  L QD    N+   K + NKKVFLFTDND P E++DK    RLRRLFDD +
Sbjct: 153 QRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNN 212

Query: 209 DNYIQFVTFFINKIXXXXXXXXXXXXXILKLRNSNS------IEFDGPSTKPISVAYIKN 262
           +N+I FV FFIN+              I KL NS +      IEFDGPST+PIS +YIK+
Sbjct: 213 ENFITFVPFFINR--ENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKS 270

Query: 263 KVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSK 322
           +VLRK+EIKR++FQC LILN + +F V +KGY+I+S EK GSRYK+VYEHE++R+EAFSK
Sbjct: 271 RVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSK 330

Query: 323 RKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENS 382
           RK+LN  T   V K+   K+F  G+ +I   E + +K  +  L   PFLKL+GFRS E S
Sbjct: 331 RKILNCITAEEV-KEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEIS 389

Query: 383 LHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSP 442
           LH +NNI K  F+VPDES+  GSIR L+S++RTMR KN+ A++WGKLK NS+P +W+LS 
Sbjct: 390 LHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSA 449

Query: 443 SDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLT 502
           S+ + D NEGF+LY++PFLDEIRK P   T    +  +   +YEN+KR T NI+GYFNL 
Sbjct: 450 SNAS-DPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLK 508

Query: 503 NGYSP 507
           +GY P
Sbjct: 509 HGYIP 513

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  482 bits (1241), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 263/580 (45%), Positives = 363/580 (62%), Gaps = 27/580 (4%)

Query: 34  SYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCF 93
            Y+KY++HEG +FCIEL+  +F  +  L  +  L+E+L SL ELM QLVI RP + VGC 
Sbjct: 15  GYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVGCI 74

Query: 94  FFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSL 153
           F   D   +   +YEFLPLRD+N  DMK L D L+D++E+R++I   FKFD    K  SL
Sbjct: 75  FHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKFD--GSKHVSL 132

Query: 154 ESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQ 213
           E LF LI +++S      K +T+K+ FLFTDND P ESND E T R+ ++ DD+ +  + 
Sbjct: 133 ERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDETAVS 192

Query: 214 FVTFFINKIXXXXXXXXXXXXXILKLRNS-NSIEFDGPSTKPISVAYIKNKVLRKKEIKR 272
           F TFFI                +LKL       ++DGPS +PI+ + IK ++LR KEIKR
Sbjct: 193 FTTFFIGS--EEAPFDNRFYSNVLKLGAQLKHSDYDGPSVRPITGSDIKARILRGKEIKR 250

Query: 273 IMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGT 332
            MFQCPL LN DS+F + ++GY I++HEK G+RYKL YE E+IR+EAFSKRK LN KTG 
Sbjct: 251 TMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYLNSKTGE 310

Query: 333 VVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKA 392
            V   D  K+   G+ +I       ++   +   + PF+K++GFRS +  +  FNNI K 
Sbjct: 311 EVDPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYFNNIDKP 370

Query: 393 LFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQNEG 452
            FIVPDE +  GSI+TL+S++RT+R+KN++AI+WGK KSNSN  ++I+ PS   +D+N+G
Sbjct: 371 SFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSH-REDRNDG 429

Query: 453 FYLYKVPFLDEIRKIP-----SQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSP 507
           FY++++PFLDE+RK+P     + +T   +D          L  VT  IL YFNL  GY P
Sbjct: 430 FYMHRIPFLDELRKVPIKMVDNDWTQLDND----------LLTVTETILKYFNLRQGYIP 479

Query: 508 LEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSA 567
            EFKNP +Q YYK+LHDY+LQVE +        Q  +++L +DDT++K   IR KI    
Sbjct: 480 SEFKNPGIQNYYKVLHDYILQVEEIKHEGWDFSQ--EELLRQDDTLKKISHIRGKI---E 534

Query: 568 SSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607
           +S +S K  LS   N+WN  Y  LE N +   E   KK K
Sbjct: 535 ASNDSDKV-LSGYMNMWNLFYKSLETNNVKWSEPVAKKAK 573

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  472 bits (1214), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 254/580 (43%), Positives = 367/580 (63%), Gaps = 25/580 (4%)

Query: 35  YRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFF 94
           +R+YE+H+G +FCI+L+  M+     L  K+QL+E+L+SL +LMSQLV+  PST VGC+ 
Sbjct: 28  WRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVGCYI 87

Query: 95  FNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLE 154
           +NC +  ++  +YE +PLRD+N  +MK++ DLL+D++++R+ ++D      I D  N +E
Sbjct: 88  YNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIP---IADPNNPIE 144

Query: 155 SLFLLIQDR--FSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYI 212
              +LI+ R  F   I GQK  TNKK+F FTD+DKP E  + +   RLR++ DD+ D YI
Sbjct: 145 LSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYYI 204

Query: 213 QFVTFFINKIXXXXXXXXXXXXXILKLRN-----SNSIEFDGPSTKPISVAYIKNKVLRK 267
            FVTFFI                ILK  +      + +   GPST PI+ +YIK+KV R 
Sbjct: 205 NFVTFFIGS--EDKPFDDSMYADILKWGSKINEAQSWLSSHGPSTNPINASYIKSKVKRT 262

Query: 268 KEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLN 327
           KEIKRI F+CPL+L+  +D  V+V GYTI+SHE PGS+YKLVY + ++RREA+S R+ L+
Sbjct: 263 KEIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLD 322

Query: 328 GKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFN 387
            +TG  V      K++  G+  I   E+E  K        E FLKLIGFRS E  LH ++
Sbjct: 323 AETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYD 382

Query: 388 NIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTK 447
           NI    F+VP+E    GSI+TL+S+YRTM  K ++A+VWGKL+ NS P++++L+PS   K
Sbjct: 383 NIDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSS-KK 441

Query: 448 DQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSP 507
           D N+GFYLYKVPF++E+RK+P    H     LI + DY+ + +VT  ++ +FNL NGY P
Sbjct: 442 DYNQGFYLYKVPFMEEVRKLPDFLNH---SALIESDDYKVMSKVTETLINFFNLKNGYRP 498

Query: 508 LEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSA 567
            +F NP LQK++K+L +YLLQ+    E + SK +      E D+T++K   I  +I  SA
Sbjct: 499 SDFHNPALQKHFKILREYLLQI----EVDKSKPE-----DEGDETLQKVKQIYARIASSA 549

Query: 568 SSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607
            S +  +QRL     +WN  Y++L   E+  K  K KK K
Sbjct: 550 KSDDVKQQRLVKYLKLWNSFYNRLSNLEVDTKPTKNKKAK 589

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  448 bits (1152), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 248/569 (43%), Positives = 364/569 (63%), Gaps = 17/569 (2%)

Query: 30  NPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTG 89
           N +AS++++E HEG MFCIELSEHMF    +L+ K Q+  +L SL ELM  L++TRPST 
Sbjct: 26  NKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPSTA 85

Query: 90  VGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFD-EIND 148
           +GC+F+NC+ ++SK+ I+EF+PL D+NV  MKK++DLL+DV  +R++ ++   ++ + N 
Sbjct: 86  IGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYNIDQNK 145

Query: 149 KGNS---LESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFD 205
           K N    LE LF LI + F+ NI GQK + +KKVFLFTDND P   + +     L+ +  
Sbjct: 146 KLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDVLKGILK 205

Query: 206 DISDNYIQFVTFFINKIXXXXXXXXXXXXXILKLRNSNSI---EFDGPSTKPISVAYIKN 262
           DI DN I F  FFI+K              +   R+ NS+    + GPSTKPI V  IK 
Sbjct: 206 DIDDNMINFTNFFISK-KDKPFNPAFYSKVLRNDRDYNSLGSQAYFGPSTKPIGVNDIKE 264

Query: 263 KVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSK 322
           ++ ++KEI+R++FQCPL+L+  ++F +++KGY+I +HEK   RYKLVYE++ IR+EAFSK
Sbjct: 265 RIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKEAFSK 324

Query: 323 RKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENS 382
           RK +N KTG  V+K  T KI   G   I   +       +        L +IGF + +NS
Sbjct: 325 RKFINPKTGEDVSK-QTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNEDNS 383

Query: 383 LHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSP 442
           L  +NNI K LFI PDE+   GS    +S++RT++   +  +VWG  KSNS+P++++L P
Sbjct: 384 LVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYLLWP 443

Query: 443 SDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLT 502
           S    D N+GFYL KVPF+DEIRK P+      ++E    ++Y+N+K +T+ I+ +FNL 
Sbjct: 444 S-KDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEW---EEYKNVKELTQGIISHFNLK 499

Query: 503 NGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDK 562
           +GY   EF+NP L ++YKLLHDYLLQVE +P+ +     ++ + L EDDT+ K   IR++
Sbjct: 500 SGYHAEEFRNPALNRHYKLLHDYLLQVE-IPQDD---NDIRDRYLREDDTLLKITKIRER 555

Query: 563 IIKSASSTESHKQRLSANFNIWNDIYSKL 591
           I+K  +  +  K+RLS    +WN  Y K 
Sbjct: 556 IMKDTTIDDVEKRRLSKYLEVWNIYYRKF 584

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  432 bits (1110), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/627 (40%), Positives = 367/627 (58%), Gaps = 73/627 (11%)

Query: 33  ASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGC 92
           ASY+K+  HEG +FC+ELS  MF  + +L  K QL+E+LESL +L  QL+I+RP+T +G 
Sbjct: 21  ASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGF 80

Query: 93  FFFN--CDNKESKK-RIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDK 149
           + F+   D+ E  K  IYEF  L DINV  MKK+ DLL+D+  +R  + D FKFD  N +
Sbjct: 81  YLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFD--NSR 138

Query: 150 GNSLESLFLLIQDRFSN--NIPGQKIYTNKKVFLFTDNDKPKES---------------- 191
              LE +F ++Q++F N  ++   K +  KKVFLFT+NDKP ES                
Sbjct: 139 PTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDL 198

Query: 192 --------------------------------NDKEKTIRLRRLFDDISDNYIQFVTFFI 219
                                           ND    I +   +DD  +N   ++   I
Sbjct: 199 NESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYL--LI 256

Query: 220 NKIXXXXXXXXXXXXXILKLRNSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPL 279
           N +                LR      F  P+TKPI  + IK ++LRK+EI+R+ FQCPL
Sbjct: 257 NDLKDTSKSKTTDRKINPSLR-----RFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPL 311

Query: 280 ILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDT 339
           IL+  S+F + + GY I S EKPG+RYKLVYEHEN+R+EAFS+RK L+  TG  +  +D 
Sbjct: 312 ILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDF 371

Query: 340 EKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDE 399
           +K+++ G+ +I   +   +   +  +   PF+KL+GFRS + SL  +NNI KA F+VPDE
Sbjct: 372 QKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDE 431

Query: 400 SRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVP 459
           S   GSI+T++S++RT+  K + AIVWG   S  +P I ILSPS+   + NEG YL++VP
Sbjct: 432 SSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNEN-EHNEGLYLFQVP 490

Query: 460 FLDEIRKIPSQYTHFPSDELIRNK---DYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQ 516
           FLDEIR+ P+  ++ P      NK   +YE +K++T  ILG  +L  GY P  ++NP LQ
Sbjct: 491 FLDEIRRFPALTSYSPG----TNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQ 546

Query: 517 KYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASSTESHKQR 576
           KYYK+LHDYLLQ+E    T+  +E L++++  EDDT+ +   +R +II+S+ + E + QR
Sbjct: 547 KYYKILHDYLLQIEDTSLTDTPQEVLEREVY-EDDTLYRLDKLRKRIIQSSQAPELYNQR 605

Query: 577 LSANFNIWNDIYSKLEGNEIAVKEMKP 603
           LS     WN ++ K+  NE A  +++P
Sbjct: 606 LSKFIEHWNRVFKKI--NEDAQMDIEP 630

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  352 bits (904), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/561 (36%), Positives = 322/561 (57%), Gaps = 36/561 (6%)

Query: 37  KYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFN 96
           +Y  HEG +FC+ELS +M+    +L  K QL+E+LE+L+ELM QLV   P TGVGC+FF 
Sbjct: 27  RYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGCYFFQ 86

Query: 97  CDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESL 156
           C ++E+K+ IYE  PLRD+NV+ MKK+  LL+ ++  + S+ +   +D       SL+ +
Sbjct: 87  CRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPYD--GRHPTSLDVV 144

Query: 157 FLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVT 216
           F  IQD+F   +P Q++Y NKK+FLFTDND P E        RLR++ DD++D YI F T
Sbjct: 145 FTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDYYINFST 204

Query: 217 FFINKIXXXXXXXXXXXXXILKLRNSNSIE------FDGPSTKPISVAYIKNKVLRKKEI 270
           FFI                ILKL    + E      +DGPSTKPISV+YI+++VLRKKE+
Sbjct: 205 FFIG--TEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISVSYIRSRVLRKKEV 262

Query: 271 KRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKT 330
           +R+ + CPL LN +    V+VKGY   ++E+PG+RY++VY+HE+++REAFS R+ L+  T
Sbjct: 263 RRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQREAFSHRRYLDPDT 322

Query: 331 GTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLP-QEPFLKLIGFRSPENSLHLFNNI 389
           G   T +D  K++Q+G+  ++  ++      +   P  + FL+++G R+    L  +NNI
Sbjct: 323 GEEAT-EDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSRTAVAVLPYYNNI 381

Query: 390 GKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQ 449
               F+VPD+S   GS   L+S++RT+R   R  +++GKL++ S                
Sbjct: 382 HHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSL-PALYALAPAAAPLP 440

Query: 450 NEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLE 509
           +  F L ++PF +E+RK P+     P    + + DY  L+++T  I+    L++ Y+P +
Sbjct: 441 DAVFILARLPFQEEVRKFPALS---PPQASLASPDYAVLQKITSRIIDLLVLSSPYAPAD 497

Query: 510 FKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASS 569
           FKNP++  +++LL D+L +    P T              DDTI +       +      
Sbjct: 498 FKNPVIATHFRLLSDHLFETAQDPRT--------------DDTIARL------LRLRHRV 537

Query: 570 TESHKQRLSANFNIWNDIYSK 590
            +  + RL+     WN  Y++
Sbjct: 538 LDDPESRLAKYLRHWNAFYAR 558

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  308 bits (790), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 189/564 (33%), Positives = 309/564 (54%), Gaps = 25/564 (4%)

Query: 37  KYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFN 96
           K+E  +  + CIELS  ++   S+++ K QL E+LE+L+ELM QL +  P++ V C+ + 
Sbjct: 17  KHERRQSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 97  CDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESL 156
           C     K  IYE LPL  +NV  + K+  LL D+K +++ ++D   F+EI+  G+ L S+
Sbjct: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEID--GSPLSSV 133

Query: 157 FLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVT 216
              IQ +       +  + NK++ L T ND P E  D E   + +   + + D+    VT
Sbjct: 134 LAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVT 193

Query: 217 FFINKIXXXXXXXXXXXXXILK-LRNSNSIE-----FDGPSTKPISVAYIKNKVLRKKEI 270
           FFI+               +LK LR    ++     +DGP+TKPI +  +K K+L+KKE 
Sbjct: 194 FFIH--SQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKKEG 251

Query: 271 KRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKT 330
            +  F+C  I+N  +DF +++KG+  I+ EK G R+K +Y+     ++AFS RK  N   
Sbjct: 252 NKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAND 311

Query: 331 GTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIG 390
           G       T K+F +G  +I   E + +K  ++    E FL+LIGFRS +     +NNI 
Sbjct: 312 GEAADSRLT-KVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNIS 370

Query: 391 KALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQN 450
            + +++PD++   GS +TLS +Y +M  K + AIVWGKL   ++P ++++   D  K+ N
Sbjct: 371 TSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMD-RKNTN 429

Query: 451 EGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLEF 510
           +GFYL ++PF++EIR+ P        +  +  ++Y  +K++T NI+ +FNL + Y   EF
Sbjct: 430 QGFYLVRLPFIEEIRRFPQT---LQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEF 486

Query: 511 KNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASST 570
            +P+L+ +Y  L D LLQ     +  M  +      L  D T+ K   +R+ I KS+ + 
Sbjct: 487 PSPVLKSFYTTLSDKLLQKSLSDQWGMGFK------LSNDITLGKVQHLRELINKSSQNM 540

Query: 571 ESHKQRLSANFNIWNDIYSKLEGN 594
           E  +  L+     WN  Y+K EGN
Sbjct: 541 E--QPILAKYMKYWNTYYNK-EGN 561

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  240 bits (613), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/549 (27%), Positives = 273/549 (49%), Gaps = 29/549 (5%)

Query: 45  MFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFNCDNKESKK 104
           + CIELS+ + S    L     ++EV+ +L+ ++ +L+I +P++ VGC  F  + + ++ 
Sbjct: 31  VLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-NGRRAED 89

Query: 105 RIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESLFLLIQDRF 164
            I E  PLR ++ + ++ + D + D++E  + +   F F        SL+ +       F
Sbjct: 90  GIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPA--SLDVMLAASDRYF 146

Query: 165 SNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFFINKIXX 224
           + +        + ++FL TD D P E  D  +  +++     +    I   TFF++    
Sbjct: 147 TEDTQN----ADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLH--TE 200

Query: 225 XXXXXXXXXXXILKLRNSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNAD 284
                      ILK R    I     ST P+S+  ++ K+L +K++ R  F CPL++N  
Sbjct: 201 HAAFNDSSYAEILKTREWG-IPGAPQSTSPLSICKLREKMLSQKDLNRAYFSCPLVINKT 259

Query: 285 SDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQ 344
           +D  V+V GY   +HE+PG+RYK + +H+   +     RK         +   D   ++ 
Sbjct: 260 ADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYW 319

Query: 345 LGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVG 404
           +G   I   + E  K        E FL+++GFR+   +   ++NIG+A +I+P E    G
Sbjct: 320 IGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSG 379

Query: 405 SIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEI 464
           S + L+S+ R+M  K + AIVWG+LK+  +P ++ L PSD    +     L ++PF++E+
Sbjct: 380 SAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSD---GETCALRLVRIPFIEEV 436

Query: 465 RKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHD 524
           R  P   T    D L   ++YE +K V++N++ +F+L   Y P + +NPLL+ +Y  L+ 
Sbjct: 437 RCFP---TLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYH 493

Query: 525 YLLQVETVPETEMSKEQLK--QKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFN 582
                    +++ +K ++   Q + E D T+ K   +RD+I  S    E     +S   N
Sbjct: 494 --------EQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDE--PPIISEYIN 543

Query: 583 IWNDIYSKL 591
            WN  Y+ +
Sbjct: 544 CWNIYYNHI 552

>Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {ON}
            complement(47832..51026) [3195 nt, 1065 aa]
          Length = 1064

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 63/134 (47%), Gaps = 20/134 (14%)

Query: 484  DYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPE---TEMSKE 540
            D  NL R+++       LT GYS  + +      Y K +H YL   +++ E   T  SKE
Sbjct: 906  DETNLNRISQ-------LTQGYSGADLQGLCYTAYLKGVHRYLSDKDSIKEIATTTSSKE 958

Query: 541  QLKQKILEEDDTIRKTFSIRDKI-IKSASSTESHKQRLSANFNIWND---IYSKLEGNEI 596
            +L  +I+ +       +SI+D   IK+    +  +  L++  +  +D   I  ++   ++
Sbjct: 959  ELNLEIINK----TSNYSIQDYTKIKNKLQEKLDEHNLNSRLDSKDDNDQITVRISTEDL 1014

Query: 597  --AVKEMKPKKQKN 608
              AVKE KP   KN
Sbjct: 1015 LEAVKESKPSISKN 1028

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,803,087
Number of extensions: 3470855
Number of successful extensions: 12734
Number of sequences better than 10.0: 74
Number of HSP's gapped: 13148
Number of HSP's successfully gapped: 74
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)