Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I003008.848ON49349324340.0
Kpol_1068.28.848ON49149314100.0
YMR283C (RIT1)8.848ON51349313900.0
Smik_13.4968.848ON49449413850.0
Suva_13.4728.848ON51049413670.0
Skud_13.4558.848ON49449313630.0
KAFR0B039808.848ON48349212841e-174
NDAI0K003508.848ON50451012791e-172
TDEL0A079708.848ON48948912771e-172
SAKL0D01276g8.848ON50247812761e-172
ZYRO0G14344g8.848ON47249012401e-167
Kwal_27.102198.848ON50049412391e-166
NCAS0C003508.848ON48649112351e-166
KNAG0J002208.848ON49949612311e-165
KLLA0D01386g8.848ON48949612181e-163
KLTH0C03696g8.848ON47449611941e-160
Ecym_46238.848ON48049411771e-157
AFR451C8.848ON4084309721e-127
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00300
         (493 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   942   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   547   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   540   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   538   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   531   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   529   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   499   e-174
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   497   e-172
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   496   e-172
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   496   e-172
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   482   e-167
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   481   e-166
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   480   e-166
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   478   e-165
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   473   e-163
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   464   e-160
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   457   e-157
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   379   e-127

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/493 (94%), Positives = 464/493 (94%)

Query: 1   MVDDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFPYPLVPNERCGLWYCKR 60
           MVDDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFPYPLVPNERCGLWYCKR
Sbjct: 1   MVDDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFPYPLVPNERCGLWYCKR 60

Query: 61  ANFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTV 120
           ANFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTV
Sbjct: 61  ANFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTV 120

Query: 121 PIWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDG 180
           PIWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDG
Sbjct: 121 PIWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDG 180

Query: 181 KKLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSY 240
           KKLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSN               VLCTVSY
Sbjct: 181 KKLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSY 240

Query: 241 QVQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILL 300
           QVQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNI              DYVEEILL
Sbjct: 241 QVQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILL 300

Query: 301 SESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360
           SESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL
Sbjct: 301 SESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360

Query: 361 ASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKP 420
           ASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKP
Sbjct: 361 ASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKP 420

Query: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480
           ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP
Sbjct: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480

Query: 481 SRATLNSVNDFLM 493
           SRATLNSVNDFLM
Sbjct: 481 SRATLNSVNDFLM 493

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/493 (56%), Positives = 347/493 (70%), Gaps = 12/493 (2%)

Query: 3   DDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRA 61
           DD S+NQI KDI+KE KSLKNRI SILLD++FL++ VIPFFP +P++PNERCGLWYC   
Sbjct: 7   DDYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPK 66

Query: 62  NFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVP 121
            F  TSYFKSTDGHINQWDFSTRRLNFHL+P + +  GI+I+DSTRRGKKIPDALSKTVP
Sbjct: 67  LFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVP 126

Query: 122 IWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGK 181
           IWCAVLN+++L+  +   D   +VLFVPP+TV  SEY+RI  K+P L+E+L KL +IDG 
Sbjct: 127 IWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGS 186

Query: 182 KLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQ 241
            LY+QF G LLRPIWIHPGSS+LQS  D FTGE  S                +LCTVSY+
Sbjct: 187 DLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGE--STNDVWETPEDEEIIPIILCTVSYR 244

Query: 242 VQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLS 301
            QDGVD R GFTYVQGAADDHELWSHGL+P +FWDNI                VE++L +
Sbjct: 245 AQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAA 304

Query: 302 ESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLA 361
           +  +++  E    F  +D IT +++LG I DGL I  +L       +S+VI+ S S KL+
Sbjct: 305 KQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364

Query: 362 SDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSS-GSTKKP 420
             +  E+        T  I + +LQSGSKKSSK LR  LPE+   +    S+    ++ P
Sbjct: 365 VSKNEEKI-------TQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELP 417

Query: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480
           IL+CCN+G+DMSIA++L+ L K Y  +W  TS+  E+NKI IRKHLTK+ISHL GRNVNP
Sbjct: 418 ILICCNSGTDMSIALVLMLLCKHYDLDW-NTSKPNEVNKIIIRKHLTKLISHLKGRNVNP 476

Query: 481 SRATLNSVNDFLM 493
           SRATLNSVN++LM
Sbjct: 477 SRATLNSVNEYLM 489

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/493 (55%), Positives = 338/493 (68%), Gaps = 11/493 (2%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S++QI KDIRKENKS++NR+ SILLD+KFL ++VIP FP YPL+PNERCGLWYC  ++F 
Sbjct: 27  SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFK 86

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH+NQWDFSTRRLNFHL+  I + KGIII+DSTRRGKKIPDALSKTVPIWC
Sbjct: 87  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 146

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLNT++LQ  E      + VL++PP TV KSEY+ IK KIPELV KL KL++ID KKL 
Sbjct: 147 AVLNTLMLQETEKNVAIDK-VLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
           E F G LLRPIW+HPGSS+L    D FTGE V                 +LCTVSYQ QD
Sbjct: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGE-VQEYEAWETPEDQNIIPIILCTVSYQAQD 264

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLSESM 304
           G+D R GFTYVQGAADDHELWS GL   +FW +I              DY+ ++  ++  
Sbjct: 265 GMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLR 324

Query: 305 KITNLE----VDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360
               ++    +D VF +IDKIT E+ LG +  GL I +NL +     Y  VII SNS+ +
Sbjct: 325 NQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTV 384

Query: 361 ASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKP 420
           A D  +E+ +         I +++LQSG KKSSK LRS  P I   +    ++     KP
Sbjct: 385 AEDTDDEEESGTDP----FISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIKP 440

Query: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480
           +L+CCN G+DMSI VIL  L   YT+EW  TSE  +I+K+ +RKHLTK+ISHL GRNVNP
Sbjct: 441 MLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNP 500

Query: 481 SRATLNSVNDFLM 493
           SRATLNSVN FLM
Sbjct: 501 SRATLNSVNSFLM 513

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/494 (55%), Positives = 344/494 (69%), Gaps = 13/494 (2%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFPY-PLVPNERCGLWYCKRANFT 64
           S+ +I +D+RKENKS++NR+ SILLD+KFL ++VIP FPY PLVPNERCG+WYCK + + 
Sbjct: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH+NQWDFSTRRLNFHL+  I + KGIII+DSTRRGKKIPDALSKTVPIWC
Sbjct: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLNT++LQ  E   D  +  L++PP TV KSEY+ IK KIPELV KL KL++ID KKL 
Sbjct: 128 AVLNTIMLQETEENFDIDK-ALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLN 186

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
           E F G +LRPIW+HPGSS+L    D FTGEI                  +LCTVSYQ QD
Sbjct: 187 ELFMGKILRPIWVHPGSSLLNHSVDYFTGEI-QQHETWETPEDQNIIPIILCTVSYQAQD 245

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEIL---LS 301
           G+D R GFTYVQGAADDHELWS GL  ++FW ++              DY+ +++   L 
Sbjct: 246 GMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLK 305

Query: 302 ESMKITNL-EVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360
             M I +   +D +F  +DKIT+E+ LG +V GL I + L E     Y  V+ILS+S+ +
Sbjct: 306 SQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTV 365

Query: 361 ASDEQNEQSANAKTSKTN-IIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419
           A D     +   + +K+N  I +++LQSG KKSSK LRS LP+I + +    ++     +
Sbjct: 366 AED-----AGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479
           P+LVCCN G+DMSI VIL  L   YT+EW  T E  E+NKI IRKHLTK+ISHL GRNVN
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480

Query: 480 PSRATLNSVNDFLM 493
           PSRATLNSVN FLM
Sbjct: 481 PSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/494 (55%), Positives = 345/494 (69%), Gaps = 13/494 (2%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S++QI KD+RKENKS++NR+ SILLD++FL ++V+P FP +P+VPNERCGLWYC+ ++F 
Sbjct: 24  SLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPSSFE 83

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH+NQWDFSTRRLNFHL+ +I+E KGIII+DSTRRGKKIPDALSKTVPIWC
Sbjct: 84  QTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVPIWC 143

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLNT++LQ  E   D  + VL+VPP TV KSEY+ IK KIPELV+KL KL+ ID K L 
Sbjct: 144 AVLNTIMLQETEENVDIDK-VLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKTLN 202

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
           + F+G +LRPIW+HPGSS+L    D FTGEI                  +LCTVSYQ QD
Sbjct: 203 KLFKGKILRPIWVHPGSSLLNHSVDCFTGEI-EEQEIWESPEDQNIIPIILCTVSYQAQD 261

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEIL---LS 301
           G+D R GFTYVQGAADDHELWS GL  ++FW +I               Y+ +++   L 
Sbjct: 262 GMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKLE 321

Query: 302 ESMKITNL-EVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360
             + I +   +D +F++IDKIT E+ LG ++ GL I + L +     Y  VII SNS+ +
Sbjct: 322 YQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVAI 381

Query: 361 ASDEQNEQSANAKTSKTN-IIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419
           A+      + + + S+T+  I +++LQSG KKSSK LRS  P I   +    ++     K
Sbjct: 382 AA-----HADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKGMK 436

Query: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479
           PILVCCN G+DMSI VIL  L   Y +EW  TSE   +NKI IRKHLTK+ISHL GRNVN
Sbjct: 437 PILVCCNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRNVN 496

Query: 480 PSRATLNSVNDFLM 493
           PSRATLNSVN FLM
Sbjct: 497 PSRATLNSVNSFLM 510

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/493 (54%), Positives = 343/493 (69%), Gaps = 11/493 (2%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S++QI KD+R+ENKS++NR+ SILLD+KFL E+V+  FP +P+VPNERCGLWYC+ + F 
Sbjct: 8   SLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWYCEPSTFK 67

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH+NQWDFSTRRLNFHL+  I ++KGIIIIDSTRRGKKIPD+LSKTVPIWC
Sbjct: 68  RTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLSKTVPIWC 127

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLNT++LQ  E E+    +VL+VPP TV KSEY+ IK KIPELV KL KL+V+D +KL 
Sbjct: 128 AVLNTIMLQK-EKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVVDSEKLN 186

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
           + F G +LRPIW+HPGSS+L    D FTGE+                  +LCTVSYQ QD
Sbjct: 187 DLFMGKILRPIWVHPGSSLLNHSVDYFTGEL-KEQETWEAPKDQNIIPIILCTVSYQAQD 245

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEIL---LS 301
           G+D R GFTYVQGAADDHELWS GL  ++FW ++              DY+ +++   L 
Sbjct: 246 GMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLVAKKLE 305

Query: 302 ESMKITNL-EVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360
             + I +   +D +F +ID IT E+ LG ++ GL I   L +     Y  VI+ S+S+ +
Sbjct: 306 NQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFSDSVAI 365

Query: 361 ASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKP 420
             D  +E+    ++S  + I +F+LQSG KKSSK LR+  P I + L    ++     KP
Sbjct: 366 TEDTDHEE----ESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTKP 421

Query: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480
           IL+CCN G+DMSI VIL  L   YT++W+ T E  E+NKI IR+HLTK+ISHL GRNVNP
Sbjct: 422 ILICCNTGTDMSIGVILSILCTKYTEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNVNP 481

Query: 481 SRATLNSVNDFLM 493
           SRATLNSVN FLM
Sbjct: 482 SRATLNSVNSFLM 494

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  499 bits (1284), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 338/492 (68%), Gaps = 15/492 (3%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S++ I KDI+ E +SLKNR+ SI+LD+ FL+ +V+P FP YP++PNERCGLWYC   +F 
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGHINQWDFSTRRLNFHL+P++ +  GIII+DSTRRGKKIPDALSKT+PIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLN +IL+H  NE     +VLFVPPATVS SEY RI  KI ELV KL  L+V+  K+LY
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
               G L+RP W++PGSS+L +  DPFTGE                   +LCTVSYQ QD
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE--PTGERWSVPENENIIPIILCTVSYQAQD 240

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLSESM 304
           GVD R GF YVQGAADDHELWS GL P+ FW+NI              ++V+ + L E+ 
Sbjct: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300

Query: 305 -KITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363
            K  +  +  +F+S++++T E+ LG I+D   I   L    +  +SLVIILS +I++   
Sbjct: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKL 360

Query: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELS-SSGSTKKPIL 422
           E+         + T IIKLF+LQSGSKKSSK LR  LPEI D +      +S   KKPIL
Sbjct: 361 EE---------ATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPIL 411

Query: 423 VCCNNGSDMSIAVILVTLSKFYTQEWR-RTSEHTEINKITIRKHLTKVISHLGGRNVNPS 481
           +CCN+G+DMS+AVIL  LSK Y++ W+  TS+   I+K  IRKHL K+IS L GRNVNPS
Sbjct: 412 ICCNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPS 471

Query: 482 RATLNSVNDFLM 493
           RATLNS+N +LM
Sbjct: 472 RATLNSINSYLM 483

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  497 bits (1279), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 261/510 (51%), Positives = 345/510 (67%), Gaps = 36/510 (7%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S++QI KDI+KE KSL+NR+ SILLD++FL++++I  FP YP++PNERCGLWY   + + 
Sbjct: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH NQWDFSTRRLNFHL+  I + KGI IIDSTRRGKKIPDALSKT+PIWC
Sbjct: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128

Query: 125 AVLNTMILQHCENEED--KSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKK 182
           AVLN ++L+  +   D  K  + LFVPPATV KSEY+ I  KIP LVEKL KL++I+  +
Sbjct: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188

Query: 183 LYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQV 242
           L   F G LLRP+WI+PGSSIL S  D FTGE                   VLCT+SYQ 
Sbjct: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGE---KTKALAWEAPENIIPIVLCTISYQA 245

Query: 243 QDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEI---- 298
           QDGVD R GFTYVQGAADDHELWS GL+P+LFW +I              +YV  +    
Sbjct: 246 QDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMK 305

Query: 299 LLSESMKITNLEVDGVF-KSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNS 357
           +   + K   L +D +F   +D IT E+ LG I + ++I ++++  F K +SLV+ILS +
Sbjct: 306 IKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSET 365

Query: 358 IKLASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGST 417
           + L SD+++EQ +++       +K+++L SGSKKSSK LR+ +P+I +++ + L++    
Sbjct: 366 VTLNSDDKDEQQSDS-------VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG--- 415

Query: 418 KKPILVCCNNGSDMSIAVILVTLSKFY------TQEWRRTSEHTE--------INKITIR 463
            KPIL+CCN G+D+SI +IL  L K Y       + W R  + T+        ++K  IR
Sbjct: 416 -KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIR 474

Query: 464 KHLTKVISHLGGRNVNPSRATLNSVNDFLM 493
           K+LT +ISHL GRNVNPSRATLNSVND+LM
Sbjct: 475 KNLTTLISHLEGRNVNPSRATLNSVNDYLM 504

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  496 bits (1277), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 254/489 (51%), Positives = 329/489 (67%), Gaps = 13/489 (2%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S+  I KDI+KE KSL+NR+ SILLD  FL  +V+P FP YPLVPNERCGLWYC   +FT
Sbjct: 13  SLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKDFT 72

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH NQWDFS+RRLNFH+IP I +  GIII+DSTRRGKK+PDALSKT+PIWC
Sbjct: 73  QTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPIWC 132

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLN ++L+         +E L+VPP TVS+SE+  IK++IPELVEKL  L+VI+GK+L+
Sbjct: 133 AVLNHLMLE--SQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKELH 190

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
           +Q  G LLRP WI+PGSSILQS  D FTGE+ S+               +LCTVSYQ QD
Sbjct: 191 KQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSD---KWIPVDNSIIPIILCTVSYQAQD 247

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLSESM 304
           GVD R GFTYVQGAADDHELWSHGL+ ++FW NI               +V ++ L    
Sbjct: 248 GVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCD 307

Query: 305 KITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASDE 364
               ++    F  ID +T EL LG ++D LE    L+    +++SLVI+LS S+      
Sbjct: 308 LSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFP--- 364

Query: 365 QNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILVC 424
              Q      + +  I + +LQSGSK SS+ L++ L +I  L+   +      +KP+L+C
Sbjct: 365 ---QKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLIC 421

Query: 425 CNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPSRAT 484
           CN+G+DMSI ++LV L + Y  +W+  +  T ++KI ++KHL K+ISHL GRNVNP RAT
Sbjct: 422 CNSGTDMSIGLLLVVLCRNYNMDWQLNTP-TSVSKIVVKKHLAKLISHLKGRNVNPPRAT 480

Query: 485 LNSVNDFLM 493
           LNSVN +LM
Sbjct: 481 LNSVNSYLM 489

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  496 bits (1276), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 254/478 (53%), Positives = 326/478 (68%), Gaps = 26/478 (5%)

Query: 20  SLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFTTTSYFKSTDGHINQ 78
           SL+NR+ SI+ D +FL   VIP FP YPLVPNERCGLWYC   +F+  SYFKSTDGHINQ
Sbjct: 47  SLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQ 106

Query: 79  WDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWCAVLNTMILQHCENE 138
           WDFSTRRLNFHL+P I +  GI+IIDSTRRGKKIPDALSKT+PIWCAV+NT+IL+     
Sbjct: 107 WDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILE----A 162

Query: 139 EDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLYEQFEGNLLRPIWIH 198
            ++S EVLF PP TV +SEY+RIKN+IP LVEKL  L ++ G +L +QF G +LRP+W++
Sbjct: 163 SNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVY 222

Query: 199 PGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQDGVDVRDGFTYVQGA 258
           PGSS+  S  D FTG+  +                +LCT SYQ QDGVD R GFTYVQGA
Sbjct: 223 PGSSLFSSSTDIFTGK-QTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGA 281

Query: 259 ADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEI---LLSESMKITNLEVDGVF 315
           ADDHELW+ GL+P +FWDN               +YV +        + + +  +++  F
Sbjct: 282 ADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCF 341

Query: 316 KSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASDEQNEQSANAKTS 375
            S+D IT+EL+LG +VDGLE+ + L+   +  Y+L ++LS S+K+AS ++N  +      
Sbjct: 342 -SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIASIQENPNT------ 394

Query: 376 KTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILVCCNNGSDMSIAV 435
                K+F L SG+KKSSKELRS L EIC L+   L+S      PIL+CCN G DMS+ V
Sbjct: 395 -----KIFPLTSGNKKSSKELRSKLIEICPLIQASLNSP----LPILICCNTGKDMSVGV 445

Query: 436 ILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPSRATLNSVNDFLM 493
           +L TL + Y ++W   S ++  NK  IRKHLT++ISHL GRNVNPSRATLNSVN +LM
Sbjct: 446 LLATLCQNYDEDWCIGSPNS-FNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  482 bits (1240), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 331/490 (67%), Gaps = 27/490 (5%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S+NQI +DI+KE  SL+NRI SIL D+ F+ ++VIP FP YPL+PNERCGLWYC   +F 
Sbjct: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH NQWDFSTRRLN HL+P+++E+ GIII+DSTRRGK +PDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLN+++      + DKS EVLF PP  VS+SE++ IK +IP LV++L KLD++D + L 
Sbjct: 128 AVLNSLM------QPDKS-EVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR 180

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
            +F+G +LRP W++PGS +L+S  DPFTGEI+                 +LCT SY+ QD
Sbjct: 181 NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIE--IQWEPGPNEQIIPIILCTASYRAQD 238

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEIL-LSES 303
           GVD R GFTYVQGAADDHELWS GL P+L W+N                +V+ ++ L+E+
Sbjct: 239 GVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAET 298

Query: 304 MKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363
               N   D V   +D IT+EL LG + D   I  N+    +  +SLVIILS S+ L+  
Sbjct: 299 TDHRNHLADIV--EMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLS-- 354

Query: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILV 423
                         + IK + LQSGSK+SSK+LR+ L EI  +++  L+     +KPI+V
Sbjct: 355 -----------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMV 403

Query: 424 CCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPSRA 483
           CCN+G+D+S+ VIL+ L K+Y+Q+W    +   +NK  IR+HL ++I+ +  RNVNPSRA
Sbjct: 404 CCNSGTDISVGVILMILCKYYSQDW-LLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRA 462

Query: 484 TLNSVNDFLM 493
           TLNS+N FLM
Sbjct: 463 TLNSINSFLM 472

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  481 bits (1239), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 240/494 (48%), Positives = 337/494 (68%), Gaps = 29/494 (5%)

Query: 4   DASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRAN 62
           D ++N + K+I+KENK+L+NR+ SIL D +FL+E+V+  FP YPL+PNERCGLWYC    
Sbjct: 32  DQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPER 91

Query: 63  FTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPI 122
           ++ TSYFKSTDGH NQWDFS RRLN HL+P I ++ GI+I+DSTRRGK++PDALSKTVPI
Sbjct: 92  YSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPI 151

Query: 123 WCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKK 182
           WCAVLN+++L+  ++EE    EVLF PP TVS SE+ERIK++IP LV +  +L +    +
Sbjct: 152 WCAVLNSIMLEGRQSEE----EVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDE 207

Query: 183 LYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQV 242
           L++  +G +LRPIW++PG+S+L S  DPFTG+IV+                VLCTVSYQ 
Sbjct: 208 LFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVT---PTWEAQNENFMPVVLCTVSYQC 264

Query: 243 QDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLS- 301
           QDGVD R GFTYVQGAADDHELW+ GL+ +LFW +I               YV  ++ S 
Sbjct: 265 QDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSG 324

Query: 302 -ESMKIT-NLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIK 359
             + K+T +L +D +  + +++T EL+LG + + +E+ +NL++     YSLV++LS SI 
Sbjct: 325 DANNKLTKSLRLDDMLNA-NELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLSTSIS 383

Query: 360 LASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419
           +  + +N             I++F+LQSGSKKSS+ LR+ L +IC L+   L +S     
Sbjct: 384 VYEEAEN-------------IRIFKLQSGSKKSSRALRAALTQICPLIEANLQNS----L 426

Query: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479
           P+L+CCNNG DMS+ V+L  L + +  E  +  +   ++K  I+KHL K+I+ L GRN+N
Sbjct: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLN 486

Query: 480 PSRATLNSVNDFLM 493
           P R +LNSVND+LM
Sbjct: 487 PPRVSLNSVNDYLM 500

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  480 bits (1235), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 247/491 (50%), Positives = 330/491 (67%), Gaps = 15/491 (3%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           S+ QI KDIRKENKS++NR+ SILLD+KFL+++V+P FP +P++PNERCGLWY    +F 
Sbjct: 8   SLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPEDFK 67

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            TSYFKSTDGH NQWDFSTRRLNFHL P +    GIII+DSTRRGKKIPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIWC 127

Query: 125 AVLNTMILQHCENEEDKS-REVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKL 183
           AVLN ++L      +D    +VLF PP T+SK+EY+ I  +IP+LV KL KLD++DG +L
Sbjct: 128 AVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNEL 187

Query: 184 YEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQ 243
           +   +G LLRP W++PGSS+LQS  D FTGEI  +               +LCT+SY+ Q
Sbjct: 188 FILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGD--SWNVPQHANIIPIILCTISYRAQ 245

Query: 244 DGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLSES 303
           DG D R GFTYVQGAADDHELWS GL+P LFW +I               +VE ++  + 
Sbjct: 246 DGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQD 305

Query: 304 MKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363
                 +++  F  ID +T +L LG I D + I + L E  +  ++L IILS +++L  D
Sbjct: 306 DAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVEL--D 363

Query: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILV 423
             + ++    T       +F+LQSGSKKSSK LR+ + EI  L+  ++++  +  KPIL+
Sbjct: 364 PVDNENLPIST------HIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNN--ALNKPILI 415

Query: 424 CCNNGSDMSIAVILVTLSKFYTQEWRRTS-EHTEINKITIRKHLTKVISHLGGRNVNPSR 482
           CCN G+DMSI ++L  L + Y++ W     E   ++KI IRK LT++ISHL GR +N SR
Sbjct: 416 CCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSR 475

Query: 483 ATLNSVNDFLM 493
           ATLNSVN++LM
Sbjct: 476 ATLNSVNNYLM 486

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  478 bits (1231), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 242/496 (48%), Positives = 328/496 (66%), Gaps = 21/496 (4%)

Query: 5   ASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANF 63
            S+ QI+K+++++++SL+NR+ SILLD++FL+ +V   FP +PL+PNERCGLWYC  ++F
Sbjct: 18  TSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSHF 77

Query: 64  TTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIW 123
             TSYFKSTDGH NQWDFSTRRLNFHL+P ++E  G++I+DSTRRGKKIPDALSKTVP+W
Sbjct: 78  AQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLW 137

Query: 124 CAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKL 183
           CAVLN+++L+    ++    +VLFVPP TV +SE +++  K+P+LVEKL  L+V DG K 
Sbjct: 138 CAVLNSLMLESV-GKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKT 196

Query: 184 YEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQ 243
               +G LLRP W+ PGSS+LQS  D FTGE + N               +LCTVSYQ Q
Sbjct: 197 SRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQN--KWEVSRDENIVPIILCTVSYQAQ 254

Query: 244 DGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLSES 303
           DG+D R+GFTYVQGAADDHELWSHGL   +FW NI              + V++++  ++
Sbjct: 255 DGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQN 314

Query: 304 MKITNL----EVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIK 359
             +        +D +   IDK+T  L LG I D + +    +    K YS VI+LS ++ 
Sbjct: 315 NNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVH 374

Query: 360 LASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419
           L  D   +           ++K+FRL SGSKKSSK LR+ LP+I   + + +       K
Sbjct: 375 LDKDASQDNE---------MVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIIL--QPIK 423

Query: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTE--INKITIRKHLTKVISHLGGRN 477
           P+L+CCN G DMSI V+L  L + Y + W    E  +  ++KI IR+HLTK+I+HL GRN
Sbjct: 424 PLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRN 483

Query: 478 VNPSRATLNSVNDFLM 493
           VNPSRATLNS+N FLM
Sbjct: 484 VNPSRATLNSINSFLM 499

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  473 bits (1218), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 246/496 (49%), Positives = 326/496 (65%), Gaps = 24/496 (4%)

Query: 7   VNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFPYPLVPNERCGLWYCKRANFTTT 66
           + +I+K++RKE+KSLKNR+ SI+ D+ FL E+V P F YP+VPNERCGLWYC    + TT
Sbjct: 9   IKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTFQYPVVPNERCGLWYCDPKIYDTT 68

Query: 67  SYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWCAV 126
           SYFKSTDGH+NQWDFSTRRLNFHL+PL+ E  G++I+DSTRRGKKIPDALSKTVPIWCAV
Sbjct: 69  SYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALSKTVPIWCAV 128

Query: 127 LNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKL--- 183
           LN ++L+    +     E+LFVPP+TV +SE++R+  K+PELV+KL KLD+ID KKL   
Sbjct: 129 LNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDIIDVKKLRKS 188

Query: 184 --YEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQ 241
              E+    LLRPIW++PGSS+LQ + D F+GE++ N               +LCTVSYQ
Sbjct: 189 LQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIEN---THWEPPSNIIPVILCTVSYQ 245

Query: 242 VQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEILLS 301
            QDG D R GFTYVQGAADDHELW+  L+PQLFW+NI              D    ++L 
Sbjct: 246 CQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDSYNAVILR 305

Query: 302 ESMKITNLEVDGVFK---SIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSI 358
             ++  +L++ G       ID IT  L+LG I     I    ++  N+ YS V++   +I
Sbjct: 306 AKVQ-NSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYSAVVLCHEAI 364

Query: 359 KLASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTK 418
                     S    T     I +F L SGSKKSS+ELRS L +I  L+ ++LS   +  
Sbjct: 365 ----------SVTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAA 414

Query: 419 K-PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRN 477
             PIL+ C++G D+S++++LV L K+Y  +W    + + +NK  I+KHL K+I  L GRN
Sbjct: 415 NLPILIACDSGKDISVSILLVALCKYYNLDWELQPQDS-VNKTIIKKHLAKIIESLQGRN 473

Query: 478 VNPSRATLNSVNDFLM 493
           VNPSRA+LNSVN FLM
Sbjct: 474 VNPSRASLNSVNSFLM 489

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  464 bits (1194), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 242/496 (48%), Positives = 326/496 (65%), Gaps = 27/496 (5%)

Query: 1   MVDDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCK 59
           +  D ++N + ++I+KE +SL+NR+ SI+ D KFLDE+V   FP YP++PNERCG+WYC 
Sbjct: 3   LTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCD 62

Query: 60  RANFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKT 119
             ++  TSYFKSTDGH NQWDFS RRLNFHL+P +    GI+++DSTRRGK++PDALSKT
Sbjct: 63  PKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKT 122

Query: 120 VPIWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVID 179
           VPIWCAVLN+++L++    +    EVLF PP TVS+ E+ERIK++IP+LV K  K++++ 
Sbjct: 123 VPIWCAVLNSLLLEY----QGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILT 178

Query: 180 GKKLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVS 239
           G  +   F+G +LRP+W+ PG+S+L SQ DPFTGE++S                VLCTVS
Sbjct: 179 GADIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQ--KWHTAELENFIPVVLCTVS 236

Query: 240 YQVQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEE-I 298
           YQ QDGVD R GFTYVQGAADDHELW+ GL+ +LFW +I               +VE+ I
Sbjct: 237 YQCQDGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKI 296

Query: 299 LLSESMKITN-LEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNS 357
              E     N L +D +  + D +TEEL+LG I   + + ++L++     YSLVIILSN+
Sbjct: 297 HPQEPNSAENGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNT 355

Query: 358 IKLASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGST 417
           + L+ DE               IK+F+LQS  KKSSK LR+ L +IC L    L +S   
Sbjct: 356 VTLSEDEA-------------AIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNS--- 399

Query: 418 KKPILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRN 477
             P+LVCCN G DMS+ V L  L + Y       +    I+KI I+KHL+K+I+ L GRN
Sbjct: 400 -LPMLVCCNTGKDMSVCVSLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRN 458

Query: 478 VNPSRATLNSVNDFLM 493
           VNP RA+LNSVN +LM
Sbjct: 459 VNPPRASLNSVNAYLM 474

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  457 bits (1177), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 230/494 (46%), Positives = 322/494 (65%), Gaps = 28/494 (5%)

Query: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64
           ++ QI K+IR++  SL+NR+ S+  DSKF+  +V+P FP YPLVPNERCGLWYC    + 
Sbjct: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
            T YFKSTDGH NQWDFSTRRLNFH++  + E  GIII+DSTRRGKK+PDALSKT+PIWC
Sbjct: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLN ++L + + +ED S   LF PP TVSK E++ I +K+P+LVEKL KL++I G++LY
Sbjct: 129 AVLNNLMLDY-KGKED-SIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELY 186

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
             F+G +LRP W++PGS +L +  D FTGE++ N               +LCT SYQ QD
Sbjct: 187 NMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGN----VWQSEQNSIPVILCTASYQCQD 242

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEI-----L 299
           G D   GFTYVQGAADDHELW++GL+P++FW NI              D+V+ I     L
Sbjct: 243 GEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKL 302

Query: 300 LSESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIK 359
            ++S K ++ E    F  +D+IT+ LYLG + +G+ + +N+ +     YSL II S S+ 
Sbjct: 303 TAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVT 362

Query: 360 LASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419
             +D   E+           IK++ + + SKKSS++LR  L EI  L+   ++     + 
Sbjct: 363 AKADCNCER-----------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITD----QL 407

Query: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479
           PIL+CCN G D+SI ++L  L + Y  +W    + T +NK  ++KHL ++I+ L G N+N
Sbjct: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHLEEQET-VNKTIVKKHLARIITKLSGININ 466

Query: 480 PSRATLNSVNDFLM 493
           PSR+TL +VN FL+
Sbjct: 467 PSRSTLKNVNAFLL 480

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  379 bits (972), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 268/430 (62%), Gaps = 26/430 (6%)

Query: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124
           TT YFKSTDGH+N WDFS RRLNFHL+PL+ E+ G II+DSTRRGKKIPDALSKT+PIWC
Sbjct: 4   TTCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWC 63

Query: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184
           AVLNT+IL+H E     S EVLF PP TVS+ EY RI+ K+PELV+KL ++D I G +L 
Sbjct: 64  AVLNTLILEHTEG----SGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELC 119

Query: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNXXXXXXXXXXXXXXXVLCTVSYQVQD 244
               G LLRP W++PG+++L +  D FTGE +                 +LCT S Q QD
Sbjct: 120 SLLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQE----PWQPPPGVIPLILCTASRQCQD 175

Query: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIXXXXXXXXXXXXXXDYVEEIL-LSES 303
           GVD   G+ YVQGAADDHELW++GL+P LFW N+               +VE I+ L +S
Sbjct: 176 GVDKSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKS 235

Query: 304 MKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363
                +  +   +  D +TE L LG++    +I     E+  + YSLV++  +SI+L++ 
Sbjct: 236 THTEAVAHELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSAA 294

Query: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILV 423
             + +           I+++ L SG KKSS+ LR  L EI  L++  L  +     P+L+
Sbjct: 295 APHPR-----------IRIYPLNSGCKKSSRALRPALIEIIPLISTALCEA----LPVLI 339

Query: 424 CCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPSRA 483
           CC++GSD+S+ ++L  L K Y  EWR   +  ++ K  I+KHL K+ S + GR +NPSR 
Sbjct: 340 CCSSGSDISVGIVLAALCKNYDLEWRH-EDQKDMTKTIIKKHLIKLTSKIHGRIINPSRT 398

Query: 484 TLNSVNDFLM 493
           TLNSVN FLM
Sbjct: 399 TLNSVNAFLM 408

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,674,149
Number of extensions: 2146075
Number of successful extensions: 7675
Number of sequences better than 10.0: 47
Number of HSP's gapped: 7817
Number of HSP's successfully gapped: 47
Length of query: 493
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 379
Effective length of database: 40,409,475
Effective search space: 15315191025
Effective search space used: 15315191025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)