Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002908.847ON56956930230.0
Kpol_1068.38.847ON5665646796e-81
TDEL0B005108.847ON5505545948e-69
KLTH0C03718g8.847ON5514615949e-69
Kwal_27.102248.847ON5465065808e-67
SAKL0D01298g8.847ON5515045782e-66
ZYRO0G14322g8.847ON5504715652e-64
Suva_13.4718.847ON5814554294e-45
Smik_13.4958.847ON5764854242e-44
YMR282C (AEP2)8.847ON5804334232e-44
Skud_13.4548.847ON5804404198e-44
KAFR0B039708.847ON4745334141e-43
Ecym_46188.847ON5274703772e-38
KNAG0J002308.847ON4744493725e-38
TBLA0B033108.847ON6134173414e-33
NCAS0C003708.847ON4954552888e-27
KLLA0D01408g8.847ON5184462862e-26
NDAI0K003408.847ON6245472847e-26
CAGL0M03069g8.847ON5484832676e-24
ABL119C8.847ON5374381313e-07
KNAG0F016206.281ON608851063e-04
NCAS0H024205.500ON1520157780.79
Kwal_47.191103.532ON18673750.88
NCAS0B045808.140ON118678742.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00290
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...  1169   0.0  
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   266   6e-81
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   233   8e-69
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   233   9e-69
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   228   8e-67
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   227   2e-66
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   222   2e-64
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   169   4e-45
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   167   2e-44
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   167   2e-44
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   166   8e-44
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   164   1e-43
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   149   2e-38
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   147   5e-38
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   135   4e-33
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   115   8e-27
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   114   2e-26
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   114   7e-26
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   107   6e-24
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    55   3e-07
KNAG0F01620 Chr6 complement(291302..293128) [1827 bp, 608 aa] {O...    45   3e-04
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    35   0.79 
Kwal_47.19110 s47 (1098928..1099488) [561 bp, 186 aa] {ON} YER03...    33   0.88 
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    33   2.5  

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/569 (100%), Positives = 569/569 (100%)

Query: 1   MGLHQNVQAMGVKNLSNFLQSSLSTCLSNNLFIRNANATILKYRFQSRTLSSYTLSKDIT 60
           MGLHQNVQAMGVKNLSNFLQSSLSTCLSNNLFIRNANATILKYRFQSRTLSSYTLSKDIT
Sbjct: 1   MGLHQNVQAMGVKNLSNFLQSSLSTCLSNNLFIRNANATILKYRFQSRTLSSYTLSKDIT 60

Query: 61  AIDELSNIKRSGTGTTTLGMTPVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLES 120
           AIDELSNIKRSGTGTTTLGMTPVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLES
Sbjct: 61  AIDELSNIKRSGTGTTTLGMTPVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLES 120

Query: 121 KQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDKLSLLS 180
           KQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDKLSLLS
Sbjct: 121 KQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDKLSLLS 180

Query: 181 LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMF 240
           LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMF
Sbjct: 181 LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMF 240

Query: 241 QNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKS 300
           QNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKS
Sbjct: 241 QNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKS 300

Query: 301 NHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEV 360
           NHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEV
Sbjct: 301 NHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEV 360

Query: 361 MEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSL 420
           MEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSL
Sbjct: 361 MEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSL 420

Query: 421 VYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDE 480
           VYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDE
Sbjct: 421 VYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDE 480

Query: 481 ITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQK 540
           ITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQK
Sbjct: 481 ITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQK 540

Query: 541 VRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569
           VRRNSLQQKIKEKLEDHSDEDDTLLGRLW
Sbjct: 541 VRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  266 bits (679), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 170/564 (30%), Positives = 299/564 (53%), Gaps = 38/564 (6%)

Query: 18  FLQSSLSTCLSNNLFIRNANATILKYRFQSRTLSSYTLSKDITAIDELSNIKRSGTGTTT 77
            ++S   T +S + + ++ + T +KY  +S              +D L + + S T    
Sbjct: 29  LIKSKRITPISTSRYEKHYSTTSVKYAIESE-------------LDSLVHSRNSNTIIKQ 75

Query: 78  LGMTPVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLID 137
             + P  I W +  + + +      LL        F++ L +S  LT+NE SIF+NR+  
Sbjct: 76  SDVLPENI-WRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYK 134

Query: 138 RKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAI----GSDKLSLLSLRDMNLFIEFFIN 193
             G      V++   +  ++E+++++F+LY + I    G  KL+ L L+D+NLFI  FI 
Sbjct: 135 SNGHDIKR-VIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIK 193

Query: 194 EGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKF 253
           E  L +A+ VL ++++   SI  + D DT+ ++L+LRCG LP++W+    S  +      
Sbjct: 194 EAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVT----- 248

Query: 254 GNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVL-KIANKIITDDKWKSNHSAKLDATVVY 312
             + +K  +RL   +   +  + YK   P  VL ++ N I+    WKS HS  LD+T+VY
Sbjct: 249 --KQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVY 306

Query: 313 SLCYSGQLSNIPSYINSRWNVDISMSDGNS-DVGTQISNEASKPLPSEVMEAILSSYSYD 371
           SL ++ Q   +  +I   W +    S G+  D+  +    AS P  +E++ AI+SSY Y 
Sbjct: 307 SLAHTFQKQMMDGFIKEHWGIS---SHGDPLDLFIKKKKVASAP-SNEILIAIMSSYIYK 362

Query: 372 DKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKY 431
           D++I+ A+ I+DK +  YP++ L+  FWRRL+QW    WD K+DR+G+  YGC+  +K +
Sbjct: 363 DRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNW 422

Query: 432 HEM---RSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKL 488
           +     + + + +D  + +E Y L   T N +IAAE+VS  +     +++  +   E  L
Sbjct: 423 NGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNL 482

Query: 489 LFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNK---EELFKYYKDSIAKKLQKVRRNS 545
           L  +Q  +++ ++ ++ +  A+ FIE+WS+D  N+    E FK  K  + +KL    + S
Sbjct: 483 LNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKS 542

Query: 546 LQQKIKEKLEDHSDEDDTLLGRLW 569
             QK ++   D  +E+D ++GRLW
Sbjct: 543 QSQKKRQDRYDEMEEEDMIIGRLW 566

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  233 bits (594), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 167/554 (30%), Positives = 278/554 (50%), Gaps = 49/554 (8%)

Query: 36  ANATILKYRFQSRTLSSYTL-SKDITAIDELSNIKRSGTGTTTLGMTPVQIHWG----DL 90
           A A+I+    +     + TL S  I A   +SN++ +  G  +L   P  + +G    D 
Sbjct: 26  AQASIVGAPVKHEERHTQTLTSSSINACRSISNVRDTLRGLESLYALP-GVEYGRSTRDT 84

Query: 91  FQKSNLKTILEQ---------LLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGF 141
              + L+  L +         ++  N  +  +++ L E+K+L+ +EFS F+NRL+  K  
Sbjct: 85  VSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLFETKELSTSEFSTFINRLLLEKDL 144

Query: 142 IYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDK---LSLLSLRDMNLFIEFFINEGHLG 198
                 +   P+  H+E++F L+Q+Y   +  D    L+ L + D+N FI+ FI+E  L 
Sbjct: 145 DLKLSNI--IPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQLK 202

Query: 199 RAEIVLTFVLNKT--RSILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNR 256
           +A+  L F+++K    +IL   DV+T+T +LQLRCGAL ++W   + S ++         
Sbjct: 203 KAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKV--------- 253

Query: 257 LSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCY 316
                  LG  +   K    Y +L     L+I N ++ D  W+   S  +D+ +VYSL  
Sbjct: 254 -------LGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSN 306

Query: 317 SGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPS-EVMEAILSSYSYDDKSI 375
            GQ   I  YI  +W +     DG+      + NEA   +P  EV+  I+S+Y   +   
Sbjct: 307 LGQTKLIDQYIQLKWGIS---EDGH----VAVKNEA---VPGHEVLINIVSAYCLKNGDT 356

Query: 376 ERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMR 435
            + + I+D+ M  YP  EL + FWRRL+Q S   WD + D+K  + +GC+  +K++HE +
Sbjct: 357 GKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQK 416

Query: 436 SIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKR 495
            + I +D G L+ LY L  +T+N R AAEVV       + K+  +I+  E  LL  FQK 
Sbjct: 417 GVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKL 476

Query: 496 SIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLE 555
           ++  M  K  Y      I++W++D  N+  L  Y+     K      +   +Q+ ++   
Sbjct: 477 ALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDKARAKQQQQQAQY 536

Query: 556 DHSDEDDTLLGRLW 569
           D+ +E+D LLGRLW
Sbjct: 537 DNMEEEDMLLGRLW 550

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  233 bits (594), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 160/461 (34%), Positives = 237/461 (51%), Gaps = 32/461 (6%)

Query: 113 FLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIG 172
           F  ++ ++  L+  EFS F+  L+     ++   +    PN   +EMVF L+QLY   + 
Sbjct: 119 FGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHK--LSATLPNVSGTEMVFSLYQLYLKTVT 176

Query: 173 SDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCG 232
              LS L L D N FI FFI    L +A+ VL  +L    + L   D  T THYLQLRCG
Sbjct: 177 PGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPC-DSATATHYLQLRCG 235

Query: 233 ALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLG-RKNFAVKLTNRYKILDPLGVLKIANK 291
           ALPR W   +        +  G       TRLG RKN    +++ YK LD   VL   + 
Sbjct: 236 ALPRNWKVLD--------ENLGR-----STRLGARKNRYQLVSHSYKALDHKSVLTFMS- 281

Query: 292 IITDDK--WKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQIS 349
           +++D K  W    SA L++ VVYSL + GQL  +  ++   W   IS+ + N     Q++
Sbjct: 282 LLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWG--ISLQEHN-----QVT 334

Query: 350 NEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLC 409
           + +     SEV+ A+L+SY+  +K+I  A+++ID  M  YP LEL+  FWRRL QWS   
Sbjct: 335 DASFTSPSSEVLVAVLTSYA-SNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRV 393

Query: 410 WDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEF 469
           W  K D +G L  GC++ ++++H  R+ ++  D  LL E + ++  T N R A EVV + 
Sbjct: 394 WSEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQC 453

Query: 470 MPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKY 529
              FF K +  ++  E  L   F K  +  M     Y     FI++WS +   +  L  Y
Sbjct: 454 YSSFFQKAN--LSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAY 511

Query: 530 Y-KDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569
           + K   A   +K RR    QK +++ +D  +ED  LLGRLW
Sbjct: 512 FEKHRNAYSARKQRRTEAAQKAQKRFDD-EEEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  228 bits (580), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 261/506 (51%), Gaps = 42/506 (8%)

Query: 71  SGTGTTTLGMTPVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLESKQLTFNEFSI 130
           S +  TT GM  ++     L  K  +K ++E  +Q   NS  F  ++ E   LT NEFS 
Sbjct: 76  SPSSDTTQGMNRLR---SLLNTKDYIKFMIELTIQSKLNSN-FSHKIFEDNLLTPNEFST 131

Query: 131 FLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDKLSLLSLRDMNLFIEF 190
            LN L+  +     + +    P+ + +EM+F L+Q Y   I +  L+ L L D+N F+++
Sbjct: 132 LLNGLLTERNL--STKLETVLPSVQSTEMIFGLYQTYLMTIPAGSLNPLQLHDLNSFVQY 189

Query: 191 FINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYK 250
           FI    LG+A+IVL  +L      L   D  T  HYLQLRCGALPR W            
Sbjct: 190 FIETAQLGKAQIVLDRILASNNDQLPC-DTTTGIHYLQLRCGALPRNWKV---------- 238

Query: 251 DKFGNRLSKYKTRLG-RKNFAVKLTNRYKILDPLGVLKIANKIITDD--KWKSNHSAKLD 307
             F +R+  +  RLG  +N +  +++ YK LD   VL+  N ++ D+  +W    S  L+
Sbjct: 239 --FDSRVG-HSCRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDENSEWFHKKSPTLE 294

Query: 308 ATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPS-EVMEAILS 366
           A V+YSL + GQL+ +  +I  RW        G +++G  ++ E ++  PS EV+ AI +
Sbjct: 295 AAVIYSLGFMGQLTLLKEHIAVRW--------GITELGASLATEVNEVPPSPEVLIAIFT 346

Query: 367 SYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFK 426
           S++   + +   + ++D  +  Y  + L+  FWRRL QW+ L WD K D +G L  GC++
Sbjct: 347 SFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWR 405

Query: 427 TLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGER 486
            + ++HE  S ++  D  LL E Y ++  T N + A  V+S+  PQ + K +  ++  E 
Sbjct: 406 VMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPT--LSSKEM 463

Query: 487 KLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEEL---FKYYKDSIAKKLQKVRR 543
            ++  + K  +  M     Y     FI +WS +   ++ L   FK ++D   K+ +++R 
Sbjct: 464 AIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKERLRE 523

Query: 544 NSLQQKIKEKLEDHSDEDDTLLGRLW 569
            S   + K+   D  +ED+ LLGRLW
Sbjct: 524 ES---RRKQNTYDDEEEDNMLLGRLW 546

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  227 bits (578), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 149/504 (29%), Positives = 257/504 (50%), Gaps = 43/504 (8%)

Query: 84  QIH-WG---DLFQKSNLKTILEQLLQHNDNSYMFLRELLESKQ-------------LTFN 126
           Q+H WG   +  + S  +  L Q LQ N+++   +  LLE K              +T  
Sbjct: 73  QLHKWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKL 132

Query: 127 EFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAI-GSDKLSLLSLRDMN 185
           E+S+F+N+L+        S +    P   H+E++FKL+++Y +++ G+  L+ + L D+N
Sbjct: 133 EYSVFVNKLLSNTNL--KSELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLN 190

Query: 186 LFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQNKSA 245
            FI+ F  +  L +A+ VL FVL    SI    D  T+ +YL+L+CGA+PR W       
Sbjct: 191 QFIKRFTGDAQLAKAQQVLGFVLENYGSIPR--DPQTLINYLELKCGAMPRNWSIPLSRP 248

Query: 246 ELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSNHSAK 305
           EL             KT LG ++F   L + YK+L+   +L + ++++ D  W    +  
Sbjct: 249 ELG------------KT-LGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCD 295

Query: 306 LDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAIL 365
           L+A V+YSL Y GQ + +  YI   W V +S     S+  T++    +    S ++ +I+
Sbjct: 296 LEAAVIYSLGYMGQFALLERYIKHTWGVSVS-----SNTSTEVEVPKNLYPTSNLLISIV 350

Query: 366 SSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCF 425
           S Y+    ++ +A+ IID  ++ +P +EL   FWRRL QWS   W+ K D KG L  GC+
Sbjct: 351 SCYAMKG-NLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCW 409

Query: 426 KTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGE 485
           + +K++H  +   +  D G+L E Y ++  T N   A  +  E +   + KR+  +   E
Sbjct: 410 QVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRN--LIDPE 467

Query: 486 RKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNS 545
             ++  FQK  +  M G+  Y     +I +W ++ +N+ E+ +Y+       + ++ +  
Sbjct: 468 VDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRK 527

Query: 546 LQQKIKEKLEDHSDEDDTLLGRLW 569
            +Q+  +   D  +EDD LLGRLW
Sbjct: 528 QKQETAQVTFDAEEEDDMLLGRLW 551

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  222 bits (565), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 152/471 (32%), Positives = 248/471 (52%), Gaps = 39/471 (8%)

Query: 106 HNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQ 165
           H +N Y  +  L  +  LT +E+S+F+N+L+  +    D  +    P+  H+E+++KL++
Sbjct: 112 HLNNEY--ISGLFTTGGLTKSEYSLFINKLLSEEEL--DVKLSNVIPDTPHTELIYKLYE 167

Query: 166 LYGNAI-GSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY---DVD 221
            Y + I     L+ L L D+NLF++ FI E  L +A  VL F+L + R + DL    DV+
Sbjct: 168 FYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLR-RPLNDLLANTDVE 226

Query: 222 TVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILD 281
            +  +L+L+CGAL ++W  Q  S             +     LG K     L   YK  +
Sbjct: 227 ILIQFLRLKCGALSKFWKIQPASQR-----------NSTAITLGEKASDCHLAKSYKFQN 275

Query: 282 PLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGN 341
              +L+I N ++ +  WK+  S KLDA ++YSL Y GQ   I  Y+N  W+        +
Sbjct: 276 EKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWS-------PS 328

Query: 342 SDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRR 401
            D G + +        S+++ A+L+SY   + ++ + + ++D+ +  YP +EL+  FWRR
Sbjct: 329 KDEGVKTNPN------SDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRR 382

Query: 402 LMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRI 461
           L+Q S L WD K DRK +L +GC+  +K++H  R  +I +D G+++ELY +   TKN   
Sbjct: 383 LLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNG 442

Query: 462 AAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQ 521
           A EV+++     F +    I   E  LL  +Q+  +  +  K +Y     F ++WS  + 
Sbjct: 443 ALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSST 502

Query: 522 NKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLE---DHSDEDDTLLGRLW 569
           NK EL  Y+     + + + RR S Q K K  L+   D  +EDD LLGRLW
Sbjct: 503 NKFELQSYFMK--WRGIHEQRRTS-QSKQKAALQEKYDEMEEDDMLLGRLW 550

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 127/455 (27%), Positives = 230/455 (50%), Gaps = 34/455 (7%)

Query: 110 SYMFLREL-LESKQ-LTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLY 167
           +Y+F++ +  E+++ L+  + S  LN L  ++  I    + K+  N ++SE  FKLF LY
Sbjct: 122 TYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKK--ICKDI-NVRYSEFWFKLFSLY 178

Query: 168 GNAIGSDKLSLLSLR----------DMNLFIEFFINEGHLGRAEIVLTFVLNKTRSIL-- 215
              +   K + ++LR          DMNL I+ FI  G LG+A+ VL+F+L++   IL  
Sbjct: 179 AEKVDV-KRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLS 237

Query: 216 -DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLT 274
               D+ T+ H+LQLRCGAL  YW   + S +         + S+   RLG KN ++++T
Sbjct: 238 PKNADIGTIIHFLQLRCGALAAYWKMPDNSEQ---------KYSRKMVRLGAKNTSIRIT 288

Query: 275 NRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVD 334
           + YK +D   +LKIA+ ++  ++    +S  L +T++ S  + GQ   +   I   W   
Sbjct: 289 SSYKAMDHQTLLKIADLVLQKERLL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWQ-- 344

Query: 335 ISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLEL 394
           IS+ +  S    +       P  S+++ +IL S+  +D  + R ++I+D  +  YP +++
Sbjct: 345 ISLQEFPSHATIKPKTRGCCP-SSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKV 403

Query: 395 NQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVY 454
           ++ FWRRL Q S   W    D++ + +  C+  +K++HE +   ++ D   L++LY L  
Sbjct: 404 DELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTK 463

Query: 455 YTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIE 514
            T N  +  +V+  F P    + S   T     ++   QK  I  ++ +     A  FI 
Sbjct: 464 KTGNYSLGIDVLQNFKPG-ITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFIN 522

Query: 515 KWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQK 549
            +S D    +EL  +  + I  + +K++  +  +K
Sbjct: 523 DFSFDIGAVKELNVFCTNRILLRSKKLKNKTENRK 557

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 129/485 (26%), Positives = 236/485 (48%), Gaps = 50/485 (10%)

Query: 110 SYMFLRELLESKQ--LTFNEFSIFLNRL----IDRKGFIYDSIVLKEFPNGKHSEMVFKL 163
           SY+F + +    +  L+  E S  LN+L       +G   D  V       K+SE  FK+
Sbjct: 117 SYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKV-------KYSEFWFKI 169

Query: 164 FQLYGNAIGSDK---------LSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSI 214
           F LY   + + +         L    + D+NL I  FI  G LG+A+ +LTF++++   I
Sbjct: 170 FSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDI 229

Query: 215 L---DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAV 271
           L   +  D+ T+ H+L+LRCGAL  YW   + S +         +  +   RLG KN ++
Sbjct: 230 LLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQ-------DQKQLRKIVRLGAKNTSI 282

Query: 272 KLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRW 331
           +L++ YK++D   +LKIA+ ++ + ++ +  S  L +T++ S  + GQ   +   I   W
Sbjct: 283 RLSSTYKVMDHQTLLKIADLVLHEKRFLN--SEDLLSTLIQSFGHLGQTQILERCIEHIW 340

Query: 332 NVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPN 391
           +  I+  +  S V   I      P  S+++ +IL S+ Y+D  + R ++I+D  +  YP 
Sbjct: 341 H--ITTQEFPSHVA--IKPRGCYP-SSKILISILVSFHYNDNDLHRGLSILDSFIKHYPE 395

Query: 392 LELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYT 451
           ++L+  FWRRL Q S   W    D+K + V  C+  +K++H  + + ++ D   L++LY 
Sbjct: 396 VKLDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYD 455

Query: 452 LVYYTKNSRIAAEVVSEF---MPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFT 508
           ++  T N  +  +V+  F   + +     SD++      +L  +QK  I  ++ +     
Sbjct: 456 IMKKTGNFPLGIDVLKSFKSGIERLRETNSDKLNI----VLIKYQKYIIKQLVDRGRISA 511

Query: 509 ASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLE----DHSDEDDTL 564
              FI  +  D    + L  +  + +  + +K +     +K + KLE    D  ++D  +
Sbjct: 512 VREFINDFGFDRTITKNLNIFCTNRLLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMI 571

Query: 565 LGRLW 569
           +G LW
Sbjct: 572 IGSLW 576

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/433 (28%), Positives = 221/433 (51%), Gaps = 31/433 (7%)

Query: 153 NGKHSEMVFKLFQLYGNAIGSD---------KLSLLSLRDMNLFIEFFINEGHLGRAEIV 203
           N K+SE  FKLF LY   + +          KL    + D NL I+ FI  G LG+A+ +
Sbjct: 163 NAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKI 222

Query: 204 LTFVLNKTRSIL---DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKY 260
           L+F+L++   IL      D+ T+ H+LQLRCGAL  YW   + S +   K  F  ++   
Sbjct: 223 LSFILDRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQ---KQGFLRKM--- 276

Query: 261 KTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQL 320
             RLG KN +++L++ YK +D   +LKIA+  + + K    +S  L +T++ S  + GQ 
Sbjct: 277 -VRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQEKKLL--NSEDLLSTLIQSFGHLGQT 333

Query: 321 SNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAIN 380
             +   I   W   IS  +  S V   I +    P  S+++ +IL S+ ++D  + R ++
Sbjct: 334 QILERCIEHIWQ--ISPQEFPSHV--VIKHRGCYP-SSKILVSILVSFYFNDHDLHRGLS 388

Query: 381 IIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRIN 440
           I+D  +  YP+++L+  FWRRL Q S   W    D+K + V  C+  +K+++  + +R +
Sbjct: 389 ILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPS 448

Query: 441 FDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGM 500
            D   L++LY ++  T N  +  +V+  F P     R+ E       ++  +QK  I  +
Sbjct: 449 VDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRA-ENAGKVNNIIIKYQKCIIKEL 507

Query: 501 LGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSI---AKKLQ-KVRRNSLQQKIKEKLED 556
           + +  +     FI+ +  D +  ++L  +  + +   +KK++ K+     ++K++    D
Sbjct: 508 VNRGRFSAVREFIDSYGFDRKMTKDLNIFCANRMFLRSKKMKNKIENKKEREKVRLDSFD 567

Query: 557 HSDEDDTLLGRLW 569
             ++D  ++G LW
Sbjct: 568 DDEDDGMIIGSLW 580

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  166 bits (419), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 123/440 (27%), Positives = 225/440 (51%), Gaps = 32/440 (7%)

Query: 146 IVLKEFPNGKHSEMVFKLFQLYGNAIGS--DKLSL-------LSLRDMNLFIEFFINEGH 196
           ++ KE  N K+SE  FKLF LY   + +  D+++L         + D+NL I+ FI  G 
Sbjct: 157 LICKEI-NVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQ 215

Query: 197 LGRAEIVLTFVLNKTRSIL---DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKF 253
           L +A+ +L+F+L++   IL      D+ T+ H+LQLRCGAL  YW   + S       + 
Sbjct: 216 LSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSG------RK 269

Query: 254 GNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYS 313
            N+L +   RLG KN +++L++ YK +D   +LKIA+ ++ D ++ +  S  L +T++ S
Sbjct: 270 QNQLRRM-VRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRFLN--SEDLLSTLIQS 326

Query: 314 LCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDK 373
             + GQ   +   I   W   IS  +  S V   I      P  S+++ +IL S+  +DK
Sbjct: 327 FGHLGQTQILERCIEHIWQ--ISSQEFPSHVA--IKPRGCYP-SSKILISILVSFHLNDK 381

Query: 374 SIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHE 433
            + R ++I+D  +  YP ++L+  FWRRL+Q S   W    D++ + +  C+  +K ++E
Sbjct: 382 DLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYE 441

Query: 434 MRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQ 493
            + +  + D   L++LY ++  T N  +  +V+  F       R+      E  +L  +Q
Sbjct: 442 SKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEKLE-AILIKYQ 500

Query: 494 KRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEK 553
           K  I  ++ +     A  FI  +  + +  ++L  +  + I  + +K++ +   +K ++ 
Sbjct: 501 KCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSRSKKIKNDIENKKKRDG 560

Query: 554 LE----DHSDEDDTLLGRLW 569
           L     D  ++D  ++G LW
Sbjct: 561 LAPGNYDDDEDDGMIIGSLW 580

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  164 bits (414), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 146/533 (27%), Positives = 253/533 (47%), Gaps = 79/533 (14%)

Query: 43  YRFQSRTLSSYTL---SKDITAIDELSNIKRSGTGTTTLGMTPVQIHWGDLFQKSNLKTI 99
           Y F+    SSYT    SK +T + EL   ++      +L M P ++   +L  K+  +  
Sbjct: 15  YMFRPTQCSSYTTTIQSKQLT-LGELIQKRQESYNNKSLCM-PFEVPKIELRIKTPKELD 72

Query: 100 LEQLLQHNDNSYMFLRELLESKQLT--FNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHS 157
            E            ++E++ S   T   N F+  +N  +  K   Y+   +KE    +  
Sbjct: 73  AE------------IQEIITSMHATIDLNRFARLINIALSEK---YNIQRIKE----RRP 113

Query: 158 EMVFKLFQLYGNAIGS-DKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILD 216
           E++F+LF+ Y   I S ++L++L + DMN FI +F+    L +A++V+ +++ K+  +L+
Sbjct: 114 EIIFQLFETYVKLISSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVLE 173

Query: 217 LYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNR 276
            YDV T  +YL+L CGA    W    K  +      F N                     
Sbjct: 174 KYDVSTTRNYLKLNCGACHELWYTNYKIFD------FNN--------------------- 206

Query: 277 YKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDIS 336
              LD L    + NKI              D  +++SL YSG++ ++  YI  +W   IS
Sbjct: 207 -TTLDKLVKYSLDNKI-----------GYWDVEIIHSLGYSGRIRSLEDYILKKWG--IS 252

Query: 337 MSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQ 396
           + D  + V T  +NEA +   SEV+EAI++ + Y DK + RAI I+++ +N YP+L L  
Sbjct: 253 LCD-RAQVNT--TNEAPE---SEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKI 306

Query: 397 QFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYT 456
            FW+  M   +  WD K+D+KG ++   ++T+K+++ + + RI F+   L+ + T     
Sbjct: 307 TFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKN 366

Query: 457 KNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKW 516
            N  +A ++       F++  +  +   E  ++  +Q   +  ++ KK +  A  FI   
Sbjct: 367 NNLVLATDIFQNCFHNFYFC-ATRMNDSELNVIKEYQNFILSRLIEKKGFSNALTFINDH 425

Query: 517 SMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569
               +NK +L  YY      KL+K+ RN       EK  D   E+D ++G+LW
Sbjct: 426 CFSLENKRQLMNYYHGRKEHKLKKMTRNENL----EKTYDDMVEEDFIIGKLW 474

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  149 bits (377), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 218/470 (46%), Gaps = 59/470 (12%)

Query: 82  PVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLE---------------SKQLTFN 126
           PV++      ++  LK  L +   + ++ Y  LR  L+                ++++  
Sbjct: 47  PVRV------ERKALKNTLSKSYLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQEMSSE 100

Query: 127 EFSIFLNRLIDRKGFIYDSIVLKE-FPNGKHSEMVFKLFQLYGNAIGSDK---LSLLSLR 182
           EFSIF NRL+   G    S  LKE  P      +  KL+Q Y   +  +K    + + L 
Sbjct: 101 EFSIFFNRLLPTSG---SSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELH 157

Query: 183 DMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQN 242
           D+N F  +F+NE  L  A  VL  +L +T S     D  T+  Y QL  G+L   W    
Sbjct: 158 DLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLW--PT 215

Query: 243 KSAELAYKDKF--GNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVL-KIANKIITDDKWK 299
              + A  DK   G+R  KY                Y  L P G++  +  K++ +D WK
Sbjct: 216 PKVQSACYDKLVRGSRRPKYVV--------------YNSL-PEGIMYDVLQKLLENDDWK 260

Query: 300 SNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSE 359
              S++LDA ++YSLC+  ++     ++   W +         +V   IS+  + P  SE
Sbjct: 261 HLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISS-GTYP-GSE 318

Query: 360 VMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGS 419
           V+ AI++S+SY +  +E+A+ ++D  +N YP ++L  +FW +L  W+ + +D KLD  GS
Sbjct: 319 VLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGS 377

Query: 420 LVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRS- 478
           L   C+  +  +++ R   + +   L    Y ++  T N + A  +  ++M   + K + 
Sbjct: 378 LQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAA 437

Query: 479 --DEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEEL 526
               +T   +   F  ++ S     GK+D    + FIE+W  + +N++EL
Sbjct: 438 AKHNLTVVRKYQKFVIRELSAR---GKRD--ACTQFIEQWRFNEENEKEL 482

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  147 bits (372), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 120/449 (26%), Positives = 214/449 (47%), Gaps = 63/449 (14%)

Query: 124 TFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIG--SDKLSLLSL 181
           T  +FS+ LNR++  + +       +   + ++ E  F +F  Y  AI   S+KL+ + L
Sbjct: 86  TAMQFSVLLNRVLASQNY-------RHLDSKENVEKFFAIFMRYKGAIALQSNKLTQIQL 138

Query: 182 RDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQ 241
            D NL  ++FI    L +A++++ F+L +       +DV  + +Y +LRCG+        
Sbjct: 139 HDFNLMCDYFIACNQLKKAQLIMDFLLQQDVK----FDVFMIKNYTKLRCGS-------- 186

Query: 242 NKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSN 301
                      FG      K  L  K         YK+ D   V ++  K+  D K+   
Sbjct: 187 ----------SFG------KQTLNNK--------AYKVFDQNTVFQLIGKVEADRKF--- 219

Query: 302 HSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDI-SMSDGNSDVGTQISNEASKPLPSEV 360
             A  +  +V SL Y+  ++ +  YI   W + I   S  N  +      +A  P  S+V
Sbjct: 220 --AFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYP-SSKV 276

Query: 361 MEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSL 420
           +  I+SSY+  D++++RA++I+++   SYP L LN  FW  L+  ++ C   K     S 
Sbjct: 277 LATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK---DPSQ 333

Query: 421 VYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDE 480
              C+  +KK+H  RS  + F   LL  +   +  T N     +++  ++   + KR + 
Sbjct: 334 FLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNI 393

Query: 481 ITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQK 540
             F ER +L  +QK+ +  ++ K+ Y   + FI++WS+D  NKE+L  +Y+  +  +  K
Sbjct: 394 PEF-ERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVRESK 452

Query: 541 VRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569
            RR       ++  +D  D++D ++GRLW
Sbjct: 453 TRR-------EKAYDDMDDDEDMIIGRLW 474

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  135 bits (341), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 110/417 (26%), Positives = 191/417 (45%), Gaps = 68/417 (16%)

Query: 156 HSEMVFKLFQLYGNAI-------------------GSDKLSLLSLRDMNLFIEFFINEGH 196
           HSE++FK++Q+Y   I                    S  L+ + L D+N  I +FI  G 
Sbjct: 182 HSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQ 241

Query: 197 LGRAEIVLTFVLNKTRS-ILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGN 255
           L +A   L ++L +  + I  + D  T+ ++L+L CG LP  W  +          +F  
Sbjct: 242 LKKATTALMYILKRYNAEIFQIPDSKTIINFLKLYCGGLPTNWRIE------PINHRFIK 295

Query: 256 RLSKYKTRLGRKNFAVKLTNRYKIL---DPLGVLKIANKIITDDKWKSN-----HSAKLD 307
              K   +LG  +   +L + YK +    P+ +++   K   D K          + + D
Sbjct: 296 NQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFD 355

Query: 308 ATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSS 367
           +T++YSL   G+      Y    W     +SD   DV           L S+++ AI SS
Sbjct: 356 STLIYSLTSLGRFDLAEQYFKDNW-----LSDSCDDVE----------LTSDIVIAIFSS 400

Query: 368 YSYDDKS-IERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFK 426
           Y Y++ + IE+A  +I +I+  YP+L LN   W R+++W++  WD   D  G + Y  F 
Sbjct: 401 YVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFY 460

Query: 427 TLKKYHE--------MRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFF---- 474
           T+  Y+          +S  I +++ LL +LY L     N++I+       M   F    
Sbjct: 461 TMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLF----NTKISLNKCLFIMDNCFKKSL 516

Query: 475 YKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTAS--NFIEKWSMDNQNKEELFKY 529
           +K   ++T  + ++L  +QK  +  ++  +   +    +FIEK+S+D  NKE+L +Y
Sbjct: 517 FKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEY 573

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  115 bits (288), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 112/455 (24%), Positives = 223/455 (49%), Gaps = 63/455 (13%)

Query: 121 KQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNA-IGSDKLSLL 179
           +  T  E+S+FL +++  K    DS V        +  +VF+LF++Y     G   L+ L
Sbjct: 98  EHFTLEEYSLFLGKVLSMK----DSDV--------NVNVVFQLFEIYARMYCGEGSLNAL 145

Query: 180 SLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY---DVDTVTHYLQLRCGALPR 236
            + D+N  I++FI    L + +IVL F++ K   I ++    D+ ++ ++L+L+ G+L +
Sbjct: 146 QIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVK 205

Query: 237 YWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDD 296
            W F+            G  L   ++R GR N        YK LD   +LKIA+ ++ D 
Sbjct: 206 DWKFE------------GKNLRYLQSRQGRLN--------YKFLDGWSLLKIADLVLNDP 245

Query: 297 KWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPL 356
               N    L  +++YSL +  Q+  +  +I+  W  +           T+  N    P 
Sbjct: 246 MKCQN---VLTNSIIYSLGHLRQVELLDHFIDQMWMQE-----------TRPRNGLLYPD 291

Query: 357 PSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDR 416
            + ++ AI++SY Y+  +++++ +++D+I+  Y  L+ ++ FWRRL QW +L   +    
Sbjct: 292 TNNII-AIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNA--N 348

Query: 417 KGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYK 476
           KG ++  C+  ++K       ++ FD  LL+ L   +   ++  +A  V+   + +   K
Sbjct: 349 KGFILGQCWSLMEKQE-----KVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIEL--K 401

Query: 477 RSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFI--EKWSMDNQNKEELFKYYKDSI 534
           + + I   + +LL  +QK     +        A   +  + ++++ +NK  +  YY ++ 
Sbjct: 402 KVNFINELDMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFENK 461

Query: 535 AKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569
            +K +K +R++    ++ K  D  DE+D ++G+LW
Sbjct: 462 REKRKKNKRSNQYDDLQRKY-DEMDEEDMIIGKLW 495

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  114 bits (286), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 104/446 (23%), Positives = 218/446 (48%), Gaps = 37/446 (8%)

Query: 120 SKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDKLSLL 179
           +++LT  ++S+F+N+L+D   +  D  +L +    K    ++++F +  NA+  D  + +
Sbjct: 94  NEKLTPEDYSVFVNQLMDV--YSKDIELLNKTEVWKSLYHIYRVFVV--NAV--DDGNAM 147

Query: 180 SLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWM 239
            L D+N F+  FIN   L  A  V   +L  +++     DV T+  YL+L CGAL   W 
Sbjct: 148 VLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWT 207

Query: 240 FQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDP-LGVLK---IANKIITD 295
            Q  ++   Y+D  G+ LS      G    ++++ +   I  P +GV +   +  K++ D
Sbjct: 208 TQ--TSRNFYQDLIGS-LS------GSNASSIRIPSH--IAYPTIGVPQFQLLLRKLVED 256

Query: 296 DKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKP 355
            ++    + ++D+ ++ +L +  ++  +  YI+  + +D +++   +  G +      K 
Sbjct: 257 PEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIK------KL 310

Query: 356 LP-SEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKL 414
            P S+++++++S+Y +++ +I   + +I   M  YP + L++ FWR  + WS+  W+   
Sbjct: 311 TPDSQLLKSVISAYGHNN-NITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYK 369

Query: 415 DRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFF 474
           D KGS     +  +  ++      + FD+ ++    + +   K+   A   V +   + F
Sbjct: 370 DSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIF 429

Query: 475 YKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSI 534
            K        ER +L+ +Q+  I  ++ + +     +FI +W +D +N   L +Y+K+  
Sbjct: 430 IKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKE-- 487

Query: 535 AKKLQKVRRNSLQQKIKEKLEDHSDE 560
              L   +  S +QK   KL D  D+
Sbjct: 488 ---LTHPKNESDEQK---KLNDEDDD 507

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  114 bits (284), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 139/547 (25%), Positives = 252/547 (46%), Gaps = 103/547 (18%)

Query: 90  LFQKSN---LKTILEQLLQHNDNSYMFLRELLESKQ-----LTFNEFSIFLNRLIDRKGF 141
           L QK N   L TIL+  L ++ N     R+L++        L+  E SIF+ R       
Sbjct: 114 LAQKDNGKVLTTILDHCL-YSPNEQATTRQLVKENNHLTTLLSHEEMSIFICR------- 165

Query: 142 IYDSIVLKEFPN-------------GKH----SEMVFKLFQL----YGNAIGSDKLSLLS 180
                VLK FP              G++     E++F LF +    Y N   +++L+ L 
Sbjct: 166 -----VLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCN--NTNQLNPLM 218

Query: 181 LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY---DVDTVTHYLQLRCGALPRY 237
           + D+N FI++F+ EG L +A++VL +++++   I  L    D+ T+ ++L+L+ GA+ + 
Sbjct: 219 VYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKN 278

Query: 238 WMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDK 297
           W            D   N   +Y+  L  K+   K    YK LD   +LKI + ++TD  
Sbjct: 279 WK--------PLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD-- 328

Query: 298 WKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLP 357
            K++    L+ +++YSL    Q+  +  +I   W  D+   D   +   Q+      P  
Sbjct: 329 -KTHCLNILNESILYSLGTLRQIEFMEHFIKQIW--DVHPDDAVEERNHQLDKYNLPPDT 385

Query: 358 SEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNL---ELN-QQFWRRLMQWSVLCWDHK 413
           +E++ AIL+SY    KS++RA  ++DK++  YP      LN  +FW +++QW +   D  
Sbjct: 386 NELI-AILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADKN 444

Query: 414 LDR-KGSLVYGCFKTL-------KKYHEMRSIRINFDEG--LLQELYTLVYYTKNSRIAA 463
            +   G+ +  C + +       KK   +   +I+ D G  L+  L+ ++   KN  I  
Sbjct: 445 GNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGL 504

Query: 464 EVVSEFMPQF-------FYKRS-DEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEK 515
           + +  F+ +        +Y+R+   + +G +K +  F+K +  G      Y      I+ 
Sbjct: 505 KAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCI--FRKIAESG-----SYNKGLALIDN 557

Query: 516 WS-MDNQNKEELFKYYKDSIAKKL--QKVRRNSLQQKIK-------EKLE---DHSDEDD 562
            +   N   E + + Y  +  K++  ++ RRN  Q  I+       EKL+   D  +E+ 
Sbjct: 558 GAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIEEEG 617

Query: 563 TLLGRLW 569
            ++G+LW
Sbjct: 618 MIIGKLW 624

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 126/483 (26%), Positives = 206/483 (42%), Gaps = 72/483 (14%)

Query: 116 ELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGK-HSEMVFKLFQLY---GNAI 171
           +LL+   ++  EFS  +  +++R   +           GK H   + KL Q+Y       
Sbjct: 109 QLLQDSNVSIQEFSSMIQPVLNRTNLV-----------GKYHMGYLSKLMQIYISLTRTH 157

Query: 172 GSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLN----KTRSILDLY-DVDTVTHY 226
               +  L+  DMN FI+ FI    L RA+  L F+L+    +   +L  Y D  T+ H+
Sbjct: 158 NGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHF 217

Query: 227 LQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVL 286
           L LR GAL   W       ++   +    + + YK     +N  VK T  Y +LD + + 
Sbjct: 218 LMLRSGALQDLW-------KIDVSNGNNKKQAFYKINGSHRN--VKST--YNVLDSVKLF 266

Query: 287 KIANKIITDDKWKSNHSAK------LDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDG 340
           +I   I+  +  K NHS        +   V+  L Y GQ + I   IN  W +D      
Sbjct: 267 EIVRYILRYND-KDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELD------ 319

Query: 341 NSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWR 400
                  +  + +  + S+++ AI+S+YS   KSI+  + I DK     PN+ +   FW 
Sbjct: 320 ----SVSVPPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWI 375

Query: 401 RLMQWSVLC---WDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLL----QELYTLV 453
            L +W+++    W   +D           + + +  M+S R + + G       E   LV
Sbjct: 376 NLQKWNIILPNKWRSTIDL----------SKRTWELMKSWRNSTNNGGFITANVEFLNLV 425

Query: 454 YYTKNSRIAAEVVSEFMPQFFYK------RSDEITFGERKLLFYFQKRSIDGMLGKKDYF 507
           Y   +S        E++   F          + +T  E KLL  FQ  +I  M+    Y 
Sbjct: 426 YKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYS 485

Query: 508 TASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIK-EKLEDHSDEDDTLLG 566
               FI++WS D  NK++L   +     + LQK   N  ++  K +K  D  +++D LLG
Sbjct: 486 KCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLG 545

Query: 567 RLW 569
            LW
Sbjct: 546 GLW 548

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/438 (17%), Positives = 178/438 (40%), Gaps = 53/438 (12%)

Query: 97  KTILEQLLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKH 156
           KT L +LL   +   +F+  LL +   + +     L  L+ + G I              
Sbjct: 120 KTTLSELLSQEEGFSVFIHRLLPTYTPSSD-----LKHLVSKDGTI-------------- 160

Query: 157 SEMVFKLFQLYGNAIGSDKLSLLS---LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRS 213
             ++ KL+  Y        +   S   L D N F  +F+ E  L  A  V   ++     
Sbjct: 161 -ALLQKLYGFYREQFADAPIGRPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTE 219

Query: 214 ILDLY-DVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVK 272
           +  L  D +T+   LQL  GA   +W           +D  GN + +        + AV 
Sbjct: 220 LAKLPRDTETIITLLQLHLGAKHIFW-----------RDP-GNSVGRGGQLFTPAHMAV- 266

Query: 273 LTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWN 332
               Y  L    +L++   + +D +WKS  S  LD  ++ +L +  +L  + +       
Sbjct: 267 -VTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDLDRNIILALAFHNRLDLVHAQAAR--- 322

Query: 333 VDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNL 392
                + G+    T +  + +      ++ A+++++++  + + + + I  + ++ + +L
Sbjct: 323 YYAPAAPGHGLPSTPLLPDGA------LVGAVVTAFAFKHQ-LAQGLAIAYQFLDRFTHL 375

Query: 393 ELNQQFWRRLMQWSVLCWDHKLDRKGSLVYG-CFKTLKKYHEMRSIRINFDEGLLQELYT 451
               + W+ +  W  L   H    +G+ +Y   +  ++  +        +D  + +  Y 
Sbjct: 376 PNEHELWKIIFTW--LARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDYSIARASYR 433

Query: 452 LVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASN 511
           +V    + R    +++++M   + + +  +   +R LL   Q   +  ++  +    A++
Sbjct: 434 IVRRDSSLRRVRALLNDYMSPLYQQPA--VAPRDRLLLLKCQAHIVGRLVRARRNSAAAD 491

Query: 512 FIEKWSMDNQNKEELFKY 529
           F+++W++D++ +  L ++
Sbjct: 492 FVDQWALDSEARSHLLEH 509

>KNAG0F01620 Chr6 complement(291302..293128) [1827 bp, 608 aa] {ON}
           Anc_6.281 YMR192W
          Length = 608

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 352 ASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWD 411
           A+KP+ S+  E++L S   D+ +    ++ + +++ SY NL+ N +F   L+Q  V+C  
Sbjct: 204 ATKPMGSDSDESMLKSLKDDENADAGDVDPLHRVLKSYLNLDSNLKFSTELLQL-VICIY 262

Query: 412 HKLDRKGSLVYGCFKTLKKYHEMRS 436
              DR   L +G   T+ +Y+ +RS
Sbjct: 263 KGCDRDELLTFGVLTTVLRYYNIRS 287

>NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5.500
          Length = 1520

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 64/157 (40%), Gaps = 13/157 (8%)

Query: 98   TILEQLLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHS 157
             I   +LQ    S++  R+L E+++     FS         K FI+  IV++   N    
Sbjct: 1247 CIFNPILQQYLPSFVQQRDLYEARERPSRTFSW--------KAFIFSQIVVEVPWNLLAG 1298

Query: 158  EMVFKLF----QLYGNAIGSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRS 213
             + F ++      Y NA  + +L             F++  G +G A I    +     +
Sbjct: 1299 TLAFFIYYYPIGFYANASAAGQLHERGALFWLFSCAFYVYVGSMGLAAISFNQLAENAAN 1358

Query: 214  ILDLYDVDTVTHY-LQLRCGALPRYWMFQNKSAELAY 249
            +  L    +++   +    GA+PR+W+F  + + L Y
Sbjct: 1359 LASLLFTMSLSFCGVMTTPGAMPRFWIFMYRVSPLTY 1395

>Kwal_47.19110 s47 (1098928..1099488) [561 bp, 186 aa] {ON} YER034W
           - Hypothetical ORF [contig 188] FULL
          Length = 186

 Score = 33.5 bits (75), Expect = 0.88,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 330 RWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSY 389
           R++ DISM+ G  D  +  +NE       ++ EA+    + DD+S++    +  K ++S 
Sbjct: 54  RYHEDISMTYGQDDFNSPEANE-------KIKEALRRRVNIDDQSLKTPSRMTRKDLDSM 106

Query: 390 PNLELNQQFWRRL 402
              ELN    RRL
Sbjct: 107 SAAELNALLTRRL 119

>NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8.140
          Length = 1186

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 214 ILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKL 273
           +L+   V  + H L     + P   +  N S   A  + F N+ +    +LGR +  VK 
Sbjct: 93  LLEKQRVRQLNHPLHQEHISSPASTLIYNNSNRTAPFNTFNNKFATLDEKLGRTSTKVKE 152

Query: 274 TNRYKIL-DPLGVLKIAN 290
           TNR  +  DP+   K+ N
Sbjct: 153 TNRISLTYDPISKRKVLN 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,626,330
Number of extensions: 2923661
Number of successful extensions: 11610
Number of sequences better than 10.0: 58
Number of HSP's gapped: 11990
Number of HSP's successfully gapped: 60
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)