Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002808.846ON30130115990.0
TDEL0B005208.846ON2682985716e-72
Kpol_1068.48.846ON2913015606e-70
ZYRO0G14300g8.846ON2803055465e-68
YMR281W (GPI12)8.846ON3043045424e-67
Suva_13.4708.846ON3033065232e-64
Smik_13.4948.846ON3043115121e-62
NDAI0K003308.846ON3133145095e-62
Skud_13.4538.846ON3003104981e-60
KNAG0J002408.846ON2863014953e-60
TBLA0B033008.846ON3193184931e-59
CAGL0M03047g8.846ON3043004921e-59
NCAS0C003808.846ON2762664786e-58
SAKL0D01320g8.846ON2602964751e-57
Kwal_27.102278.846ON2542974751e-57
KAFR0B039608.846ON2782994501e-53
KLTH0C03740g8.846ON2542974472e-53
Ecym_46178.846ON2492954392e-52
KLLA0D01430g8.846ON2632874169e-49
ABL120W8.846ON2492944131e-48
Ecym_46717.459ON40473850.041
CAGL0E01595g3.34ON46896800.15
TPHA0H011405.76ON83459731.2
NCAS0A007301.106ON38548711.9
TPHA0J017606.110ON494154712.1
SAKL0H05720g8.710ON45255684.3
KLTH0H12672gna 1ON1211112694.5
CAGL0L10956g8.726ON691152685.2
Skud_9.1597.123aON1407106676.5
TPHA0K002505.580ON32157667.2
Skud_11.2901.216ON409676668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00280
         (301 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   620   0.0  
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   224   6e-72
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   220   6e-70
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   214   5e-68
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   213   4e-67
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   206   2e-64
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   201   1e-62
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   200   5e-62
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   196   1e-60
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   195   3e-60
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   194   1e-59
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   194   1e-59
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   188   6e-58
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   187   1e-57
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   187   1e-57
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   177   1e-53
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   176   2e-53
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   173   2e-52
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   164   9e-49
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   163   1e-48
Ecym_4671 Chr4 (1301893..1303107) [1215 bp, 404 aa] {ON} similar...    37   0.041
CAGL0E01595g Chr5 (152413..153819) [1407 bp, 468 aa] {ON} simila...    35   0.15 
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    33   1.2  
NCAS0A00730 Chr1 complement(142217..143374) [1158 bp, 385 aa] {O...    32   1.9  
TPHA0J01760 Chr10 complement(405424..406908) [1485 bp, 494 aa] {...    32   2.1  
SAKL0H05720g Chr8 (511687..513045) [1359 bp, 452 aa] {ON} simila...    31   4.3  
KLTH0H12672g Chr8 complement(1074950..1078585) [3636 bp, 1211 aa...    31   4.5  
CAGL0L10956g Chr12 complement(1171649..1173724) [2076 bp, 691 aa...    31   5.2  
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    30   6.5  
TPHA0K00250 Chr11 complement(40051..41015,41092..41092) [966 bp,...    30   7.2  
Skud_11.290 Chr11 complement(517168..529458) [12291 bp, 4096 aa]...    30   8.5  

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60
           MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV
Sbjct: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60

Query: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120
           MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN
Sbjct: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120

Query: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180
           REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA
Sbjct: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180

Query: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240
           CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ
Sbjct: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240

Query: 241 VPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHIID 300
           VPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHIID
Sbjct: 241 VPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHIID 300

Query: 301 L 301
           L
Sbjct: 301 L 301

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  224 bits (571), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 124/298 (41%), Positives = 178/298 (59%), Gaps = 35/298 (11%)

Query: 2   GILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVM 61
           G   K+FK    LSILY+ LT  I   N   +  +     + +SL    L+IAHPDDEVM
Sbjct: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESL---TLLIAHPDDEVM 61

Query: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121
           FF+P+LLQLD +LP  V FN +CLSKG   D   +G+ R  E+  SL +L  + +    R
Sbjct: 62  FFSPSLLQLDRLLPQSVRFNFVCLSKG---DADHLGETRELELQRSLNLLTSNSQ----R 114

Query: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181
           + +L+QF+Y DG D++W+I  VV+ +++ + + S  +     LLTFDA GVS HPNH+AC
Sbjct: 115 KTQLYQFDYPDGFDEKWEIESVVSIVESKVFIGSGFN----LLLTFDAHGVSNHPNHVAC 170

Query: 182 YDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQV 241
           ++A+  L +K         + LNS+  N+ LKYS F+  + ++L + +            
Sbjct: 171 HNAVARLIEKGHKA-----LYLNSHSRNLPLKYSGFIWELIRMLSDSV------------ 213

Query: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHII 299
               M  E   + F+N+FP YI+A ++M N+H SQ+VWFRYGWWS SRFVFVNDL I+
Sbjct: 214 ----MKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  220 bits (560), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 175/301 (58%), Gaps = 23/301 (7%)

Query: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60
           M  +FK  K Y +L   Y+W    I   N +        + S     SVNL+IAHPDDEV
Sbjct: 4   MSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSS----SVNLVIAHPDDEV 59

Query: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120
           MFF+PTL+QLD+ LP  V  NVIC SKGV+VDG   G+ R+ E+  S++ML+ H     +
Sbjct: 60  MFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEH-----D 114

Query: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180
           R V +HQ +Y+DG D+ WD+  +V D++  I+   +    K  L+TFD  GVS+HPNHIA
Sbjct: 115 RPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYK-RKDLLITFDEHGVSDHPNHIA 173

Query: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240
           C++A+  L ++      ++   L S+ +N+ILKYS F   + K   N  + + +      
Sbjct: 174 CHNAVHRLIEEEPL---FMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIK------ 224

Query: 241 VPFLSMHKEHD---QIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLH 297
               S++K  D   +    NT   YIMA ++MLN+H SQ+VWFRYGWW FSR  + N+L 
Sbjct: 225 -GQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELK 283

Query: 298 I 298
           +
Sbjct: 284 L 284

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  214 bits (546), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 186/305 (60%), Gaps = 31/305 (10%)

Query: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60
           M +  K  K Y +L +L+I  +  I+  N   F  N++       + S++L++AHPDDEV
Sbjct: 1   MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKF---LDEIDSLSLVVAHPDDEV 57

Query: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120
           MFF PT+L+LD  LP +V FNV+CLSKG       +GD R  E+ +S+ +LL + +    
Sbjct: 58  MFFAPTILELDSRLPPNVEFNVVCLSKG---GADELGDTRVQELKESVNLLLANSK---- 110

Query: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTI--SMESNVDGLKHWLLTFDAQGVSEHPNH 178
           R+ +L Q +Y DG ++ WD   V + I++++     S+V      LLTFD +GVS+H NH
Sbjct: 111 RQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQGRRSSV------LLTFDDKGVSKHVNH 164

Query: 179 IACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFEL 238
           IAC++A+  L Q  SN    L   L+SYG NI+LKYS+F   ++KL         R + L
Sbjct: 165 IACHEAVSNLVQDESNVKAALY--LDSYGDNIVLKYSAFFWEIWKLT--------RDWFL 214

Query: 239 KQVPFLSMHKEHD---QIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVND 295
            +V   S + E+    +I  ++ +  YI++ +SML+SH SQMVWFRYGWW+FSRFVFVND
Sbjct: 215 HRVLPTSSYNENKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVND 274

Query: 296 LHIID 300
           L +++
Sbjct: 275 LKVVN 279

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  213 bits (542), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 182/304 (59%), Gaps = 24/304 (7%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62
           +L+K+ K   +L+ILYI+ TP I   N  S      +   +     +NL+IAHPDDEVMF
Sbjct: 14  LLYKITKLAIVLTILYIYFTPKIVSRNNASLQ---HIFPHKYGDYEINLVIAHPDDEVMF 70

Query: 63  FTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNRE 122
           F+P + QL+   P  VPFN+ICLSKG   +   +G+ R  E+ +S  +LL + RA     
Sbjct: 71  FSPIISQLNSYFPRTVPFNIICLSKG---NAEGLGETRVRELNESAALLLHNERA----- 122

Query: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182
           V +   +++DGMD+ WDI  + + +   I ++++   L   ++TFD+ GVS H NH +CY
Sbjct: 123 VSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNH--NLNQIIVTFDSYGVSNHINHKSCY 180

Query: 183 DAMMTL--------KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFR 234
            A+  L         +++  P     + L SY +NI+LKY+SF+  + K+L ++I+   R
Sbjct: 181 AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR 240

Query: 235 IFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVN 294
           I  ++ +P  +   E D++  +NT   Y++A ++MLN+H SQ+VWFRYGWW FSRFVFVN
Sbjct: 241 I--IQALP-PNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVN 297

Query: 295 DLHI 298
           +  +
Sbjct: 298 EFDV 301

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  206 bits (523), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/306 (38%), Positives = 175/306 (57%), Gaps = 27/306 (8%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKS-VNLIIAHPDDEVM 61
           +LFK+ K   +L++LYI+ TP I   N  S    +Q     +   S +NL+IAHPDDEVM
Sbjct: 12  LLFKITKLAIVLTVLYIYFTPKILSRNTDS----LQHVFPHRDRNSQINLVIAHPDDEVM 67

Query: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121
           FF+P + QL    P  VPFN++CLSKG   D   +G+ R+ E+ DS  +LL + R     
Sbjct: 68  FFSPVISQLHAYFPDTVPFNILCLSKG---DAEGLGETRAKELNDSAVLLLRNERP---- 120

Query: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181
            V +   ++EDGMD+ WDI  + + +  TI +  N + +   ++TFD+ GVS H NH +C
Sbjct: 121 -VSVQVMDFEDGMDEVWDIDSITSTLSQTIDV--NNEKVSQIIVTFDSYGVSNHINHKSC 177

Query: 182 YDAMMTL---------KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDK 232
           + A+            K+K+ N      + L SY +NI LKY+SF+  + K+L   ++  
Sbjct: 178 HIAVEKFIDDYVGSKTKEKAEN-AHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPF 236

Query: 233 FRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVF 292
            R  +    P  S   E + +  +NT   YI+A ++MLN+H SQ+VWFRYGWW  SRFVF
Sbjct: 237 GRSIQPLAAP--STTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVF 294

Query: 293 VNDLHI 298
           VN+  I
Sbjct: 295 VNEFDI 300

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  201 bits (512), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 176/311 (56%), Gaps = 38/311 (12%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSF-------YSNVQLNISQQSLKSVNLIIAH 55
           +L+K+ K   +L+ILYI+ TP I   N +S        YS+ Q          +NLIIAH
Sbjct: 14  LLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQ----------INLIIAH 63

Query: 56  PDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHR 115
           PDDEVMFF+P + QL    P  VPFN+ICLSKG   +   +G  R  E+ DS  +LL + 
Sbjct: 64  PDDEVMFFSPMISQLHSYFPNTVPFNIICLSKG---NAEGLGQTRVRELNDSAALLLHNE 120

Query: 116 RAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEH 175
           RA     V +   +++DGM++ WDI  + + +  TI + +N   L   ++TFD+ GVS H
Sbjct: 121 RA-----VSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNN--ELNQIIVTFDSYGVSGH 173

Query: 176 PNHIACYDAMMTL--------KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLIN 227
            NH +C+ A+  L         +K         + L SY +NI+LKY+SF+  + ++L  
Sbjct: 174 INHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYG 233

Query: 228 IINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSF 287
           +I+  FR  +  Q     +  E + +  +NT   YI+A ++MLN+H SQ+VWFRYGWW  
Sbjct: 234 LIS-PFR--KTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWIL 290

Query: 288 SRFVFVNDLHI 298
           SRFVFVN+  +
Sbjct: 291 SRFVFVNEFDV 301

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  200 bits (509), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 122/314 (38%), Positives = 179/314 (57%), Gaps = 35/314 (11%)

Query: 5   FKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQS---------LKSVNLIIAH 55
           +K FK + +L + Y+  T  I   N KSF ++V   I +Q          +  ++L+IAH
Sbjct: 10  YKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAH 69

Query: 56  PDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHR 115
           PDDE+MFF PTLLQL+  LPT +PFN+IC S G   D   +G LR  E+ DS+ +LL   
Sbjct: 70  PDDELMFFAPTLLQLNRFLPTSIPFNIICFSDG---DAEGLGYLRRKELHDSINLLLSSS 126

Query: 116 RAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEH 175
               NR++ +   ++ DGMD+ WD  ++++ +QN + +        + LLTFDA G+S H
Sbjct: 127 N---NRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNH 183

Query: 176 PNHIACYDAMMTL------KQKSSNPGDYLLMTLNSYGSNIIL----KYSSFLPVVFKLL 225
           PNHIAC  A+  L      K K  N    L+++  S   NI++    KY+ F+  + K+ 
Sbjct: 184 PNHIACNKAVHDLISYDGGKDKEMNIIG-LMLSSKSDEYNIVMNLLSKYTFFVIDLVKVY 242

Query: 226 INIINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWW 285
            N+    F       +P    +    ++ FINT+  YI++ +SMLN+H SQMVWFRYGWW
Sbjct: 243 WNLATGTFN-----TIP----NSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWW 293

Query: 286 SFSRFVFVNDLHII 299
            FSRFVF NDL ++
Sbjct: 294 WFSRFVFSNDLLVV 307

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  196 bits (498), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 117/310 (37%), Positives = 183/310 (59%), Gaps = 38/310 (12%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62
           +++K+ K   +L+ILYI+ TP I   N      +V  + ++ S   +NL+IAHPDDEVMF
Sbjct: 12  LVYKITKLAIVLTILYIFFTPKIISRN-DELLQHVFPHKNRDS--QINLVIAHPDDEVMF 68

Query: 63  FTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNRE 122
           F+P + QL    P  VPFN+ICLSKG + DG  +G+ R  E+  S  +LL + R      
Sbjct: 69  FSPVISQLHSYFPITVPFNIICLSKG-NADG--LGESRVKELNGSAALLLQNERP----- 120

Query: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182
           V +   ++EDGMD+ WDI+ +V+ I  TI + +  + L   ++TFD+ GVS+H NH +C+
Sbjct: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSN--EQLNQIIVTFDSYGVSDHINHKSCH 178

Query: 183 DAMMTL-------KQKSSNPGDYL-LMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFR 234
            A+  L       K +++    ++  + L SY +NI+LKY+SF+  + K+L ++I     
Sbjct: 179 TAVKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVI----- 233

Query: 235 IFELKQVPF------LSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFS 288
                 VPF       +   +  ++  +NT   Y++A ++MLN+H SQ+VWFRYGWW  S
Sbjct: 234 ------VPFPKTIQPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILS 287

Query: 289 RFVFVNDLHI 298
           RFVFVN+  +
Sbjct: 288 RFVFVNEFDV 297

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  195 bits (495), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 178/301 (59%), Gaps = 29/301 (9%)

Query: 4   LFKLFKCYCILSILYIWL-TPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62
           ++K+ K   +L ILYI+  T  I   N    Y+N++  + +  + SVNL+IAHPDDEVMF
Sbjct: 10  IYKVTKLSLLLGILYIYASTSKIGSFN----YTNLE-TLGEHDINSVNLVIAHPDDEVMF 64

Query: 63  FTPTLLQLDDIL--PTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120
           F P+L+ L++ +  P+ V FN+IC S G   DG  +G++R  E+ DS+ MLL        
Sbjct: 65  FAPSLINLNEQIRDPSTV-FNIICFSNG-GADG--LGNVREQELSDSIAMLLP------T 114

Query: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTI-SMESNVDGLKHWLLTFDAQGVSEHPNHI 179
           R   +   +++DGM ++WD+ +++  ++N +  +  NV      LLTFD +GVS H NHI
Sbjct: 115 RNTSIVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNV------LLTFDGKGVSGHLNHI 168

Query: 180 ACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELK 239
           ACY A +    +  +     +++L SY  NI+ KYSS++  + KLL +     +    L 
Sbjct: 169 ACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYS----SWVPSRLG 224

Query: 240 QVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHII 299
            V          +I   +T+P Y+++L++MLN+H +Q+VWFRYGWW FSR VFVNDL +I
Sbjct: 225 NVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVI 284

Query: 300 D 300
            
Sbjct: 285 S 285

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  194 bits (493), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 181/318 (56%), Gaps = 36/318 (11%)

Query: 9   KCYCILSILYIWLTPHIEDLNLKSF-YSN--VQLNISQQSLK--SVNLIIAHPDDEVMFF 63
           K   I  ++YI+ +  I+ LN +SF Y N  +QL  ++Q +K  S++LIIAHPDDE+MFF
Sbjct: 12  KLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMFF 71

Query: 64  TPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGL-NRE 122
           +PTLLQL++ L   + FNV+CLS+G+D  G      R +E+ DSL +L         NR 
Sbjct: 72  SPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRN 131

Query: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182
            KL Q +Y DGM + W++  +V D+   ++   N   L   LLTFD  GVS H NH+AC 
Sbjct: 132 FKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINL---LLTFDKSGVSNHKNHLACN 188

Query: 183 DAMMTLKQKSSNPGDYLL-MTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFE---- 237
           +A+  L  K SNP   L+ + LNS+  N  LKYS F+  +F ++      K + F     
Sbjct: 189 EAVTKL-LKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTII------KLKFFRSISL 241

Query: 238 -----------LKQVPFLSMH----KEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRY 282
                      L+    +S +    K +    F N F  Y+++ S+MLN+H SQMVWFRY
Sbjct: 242 FYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRY 301

Query: 283 GWWSFSRFVFVNDLHIID 300
            WW FSRF F+NDL I++
Sbjct: 302 LWWIFSRFAFINDLTIVN 319

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  194 bits (492), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 176/300 (58%), Gaps = 21/300 (7%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62
           +LFKL K   I  +LYI+ TP +EDLN ++     +L  +  +   +NL+IAHPDDE+MF
Sbjct: 21  LLFKLTKLTIIFQVLYIYFTPKVEDLNKENL---TKLLPTHDNFGVLNLVIAHPDDEIMF 77

Query: 63  FTPTLLQLDDILPTHV-PFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121
           F+PT+LQL D    HV   NV+CLS G D DG  +G+LR+ E+ D++  L  +R     R
Sbjct: 78  FSPTILQLID----HVQELNVVCLSNG-DADG--LGELRAKELKDAIGYLTVNRNL---R 127

Query: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181
            V L+  +Y DG ++ W  S V TD++  I         K  +LTFD +G+S H NHIAC
Sbjct: 128 NVSLNILDYTDGQNEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIAC 185

Query: 182 YDAMMT-LKQKSSNPGDYLLMTLNSYGS-NIILKYSSFLPVVFKLLINIINDKFRIFELK 239
            + +++ LK   SN   ++ + L S  +  II KYS  +P + +++ N I    + F + 
Sbjct: 186 NEGVISYLKTIKSN--SFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTF-VS 242

Query: 240 QVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHII 299
            +P          + FI+TF  Y ++ ++M  +H SQMVWFRY WWSFSR+VFVNDL  I
Sbjct: 243 YLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRI 302

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  188 bits (478), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 157/266 (59%), Gaps = 36/266 (13%)

Query: 39  LNISQQSLK------SVNLIIAHPDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVD 92
           LN SQ + K      ++NL+IAHPDDEVMFF PTLLQLD+++P  +P NVIC S G   D
Sbjct: 39  LNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNG---D 95

Query: 93  GRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTIS 152
            + +G+ R +E+  S+  L+ ++R     +  +    ++DG D+ WDI ++   +     
Sbjct: 96  AQGLGEKRQHELQSSIHALIQNQR-----QTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH 150

Query: 153 MESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIIL 212
                       LTFD+ GVS H NHIAC++A+  LK  ++N     ++TL+S   +++ 
Sbjct: 151 QA---------FLTFDSHGVSGHKNHIACHNAVWNLKNTNNN---VTILTLDSIHHSLLA 198

Query: 213 KYSSFLPVVFKLLINIINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNS 272
           KY+ F+  + KL  N+  D+       Q P     + HD+I F N +  YI+A S+MLN+
Sbjct: 199 KYTFFIIDLVKLYWNLWKDQ-------QQP---QWESHDKITFFNAYSQYILAYSTMLNA 248

Query: 273 HTSQMVWFRYGWWSFSRFVFVNDLHI 298
           H SQ+VWFRYGWW+FSRFVF N L I
Sbjct: 249 HKSQVVWFRYGWWAFSRFVFSNHLKI 274

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  187 bits (475), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 120/296 (40%), Positives = 161/296 (54%), Gaps = 43/296 (14%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62
           ++ KL K Y +LS+LYI ++  I   N +  + NV      ++  SVNLI+AHPDDE MF
Sbjct: 6   VVAKLLKAYALLSVLYICVSQRIAAHN-RQVFRNV---FPSRTPTSVNLIVAHPDDETMF 61

Query: 63  FTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNRE 122
           F+PTLLQL    P  VP  VICL+ G D DG  +G +R  E+  S+ +LL  R    N  
Sbjct: 62  FSPTLLQLHVNYPPSVPLRVICLTNG-DADG--LGAVREQELRLSMQLLLPAR----NTS 114

Query: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182
           V +  FE  DGM  +WD  +VV  I   +S  S +      LLTFD  GVS H NH++C 
Sbjct: 115 VIVEGFE--DGMGVEWDTRQVVATINRHVSDASPL------LLTFDEHGVSGHVNHVSCN 166

Query: 183 DAMMTL-KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQV 241
            A+  L +Q+      +  + LNS       KY SF             D  RI   +Q 
Sbjct: 167 TAVSALVEQREQREQRFTALYLNS-KRYFPPKYGSF-----------AVDLARIITGRQP 214

Query: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLH 297
           P            F++TFP Y+++L++M N+H SQMVWFR+GWW  SRFVFVN+LH
Sbjct: 215 PV-----------FMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELH 259

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  187 bits (475), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 162/297 (54%), Gaps = 45/297 (15%)

Query: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60
           MG    +FK   IL ++YI  +  IE  N ++  S  +      +  S+NL+IAHPDDEV
Sbjct: 1   MGAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFR----GSAPTSINLVIAHPDDEV 56

Query: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120
           MFF PTLLQ+D+ LP  +  NVI L+ G   DG  +GDLR+ E+ D + +LL  R+A + 
Sbjct: 57  MFFAPTLLQIDEWLPGSIEVNVISLTDG-GADG--LGDLRTKELQDCVRLLLRKRKASV- 112

Query: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180
            EV     ++ DGMD +WD+ + V  +Q  I  ES +       LTFD  G+S H NHI+
Sbjct: 113 -EV----LDFLDGMDVEWDLERAVKALQERILDESPL------FLTFDENGISGHVNHIS 161

Query: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240
           CY A+  +++  S    + L++       +  KYS F+P +F   I+             
Sbjct: 162 CYKAVQKVRKHYSKSSCFKLVS----KRYLFEKYSGFIPALFHSFIS------------- 204

Query: 241 VPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLH 297
                          IN+F  Y++ALSSM+N+H SQMVWFRYGWW FS +V+ N+L 
Sbjct: 205 ---------SSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQ 252

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  177 bits (450), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 168/299 (56%), Gaps = 33/299 (11%)

Query: 3   ILFKLFKCYCILSILYIWLTPHIE---DLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDE 59
           ++FK+ K   I   LYI L+P I+   D  L +F  ++  + S     S+ L++AHPDDE
Sbjct: 7   LIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSND--PSLTLVVAHPDDE 64

Query: 60  VMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGL 119
           VMFF+PTLLQLD  LP +  FN+I  S G   D   +G LRSNE+  S+ ML+  R    
Sbjct: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDG---DAEGLGSLRSNELAHSIDMLIPRR---- 117

Query: 120 NREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHI 179
           N+E+ +  F + DGM++ WD   ++  +++ +S     D   + LLTFD  GVS H NH 
Sbjct: 118 NKEIFI--FNHTDGMNEVWDNKLMLHQLESILS-----DSQTNILLTFDQFGVSNHINHK 170

Query: 180 ACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELK 239
           AC+  + +  Q  S+  +   + L+SY SN++ KY+ F   +  L  N           K
Sbjct: 171 ACHQVVTSYIQ--SHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKN------YWIHGK 222

Query: 240 QVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHI 298
            +P L      D +   N +  YI A ++ML +H SQMVWFRYGWW FSRFV+VNDL +
Sbjct: 223 TLPNL------DHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKL 275

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  176 bits (447), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 157/297 (52%), Gaps = 45/297 (15%)

Query: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60
           M IL  + K   +L ILY   +  I+  N ++F +      S  +  S+NL+IAHPDDEV
Sbjct: 1   MRILKVVCKLLAVLCILYFASSARIKASNEQAFTTL----FSVLNPTSINLVIAHPDDEV 56

Query: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120
           MFF PTLLQLD    T +P +V  L+ G   DG  +G LR  E+ DS+ +L   R+A   
Sbjct: 57  MFFAPTLLQLDHYFDTDIPVSVFSLTDG-GADG--LGKLREEELRDSVHLLFRRRKA--- 110

Query: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180
            EV +  FE  DGM  +WD+ K       + ++   V G +   LTFD  GVS H NHI+
Sbjct: 111 -EVTVLNFE--DGMKVEWDLQK------TSEALRKQVVGDQPLFLTFDDHGVSSHINHIS 161

Query: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240
           CY+ +  L+        + L +  S    I  KY++F+P +  +L               
Sbjct: 162 CYETVRNLRAAHPESRSFSLTSKRS----IFQKYTAFVPSLITVL--------------- 202

Query: 241 VPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLH 297
                  +   Q  F++TF  Y++ALS M+N+HTSQMVWFRYGWW FS +VF N++ 
Sbjct: 203 -------RGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVR 252

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  173 bits (439), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 158/295 (53%), Gaps = 48/295 (16%)

Query: 2   GILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVM 61
           G  F + K Y +L  +Y     H+E  N K +   V    S  +  SV LIIAHPDDEVM
Sbjct: 3   GSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVG---SHGNYTSVTLIIAHPDDEVM 59

Query: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121
           FF PTLLQLD  +   VPF V+CL+ G D DG  +G++R  E+  +L +L+      L R
Sbjct: 60  FFAPTLLQLDARMAQSVPFRVVCLTDG-DADG--LGEVRRRELHKALRLLV------LER 110

Query: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181
           +V++    ++DGMD++W +  V  ++   ++    +      +LTFD +GVS H NHIAC
Sbjct: 111 DVEIQMGGFKDGMDEEWKMEVVREELAQVVTDRRPL------VLTFDERGVSGHRNHIAC 164

Query: 182 YDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQV 241
             A   L   +        + L+S G N+I KYS F   +F+LL          + +  V
Sbjct: 165 AHAAAKLGHHT--------LHLDS-GHNLIRKYSFFFVDLFRLLFG--------YPMPTV 207

Query: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDL 296
                        F++TF  Y+ +L +ML +H SQMVWFR+GWW+ SR+V+ N+ 
Sbjct: 208 -------------FLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  164 bits (416), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 163/287 (56%), Gaps = 42/287 (14%)

Query: 11  YCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMFFTPTLLQL 70
           Y +  ++Y  LT  I++ N   F+  V  ++  + L SV L++AHPDDEVMFF+PTL Q 
Sbjct: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSK-LTSVTLVVAHPDDEVMFFSPTLTQF 72

Query: 71  DDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEY 130
           +++LP  +P NV+C++ G D DG  +G +R  E++DSL ++   R+ G +        ++
Sbjct: 73  NELLPISIPINVVCMTAG-DADG--LGHIRKQELVDSLRIMFHGRQFGCD------VLDF 123

Query: 131 EDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQ 190
           EDGMD  WD  +V+ + Q    + S++      +LTFD  GVS H NHI+C   +  L  
Sbjct: 124 EDGMDAVWD--QVLLEKQ----LRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPY 177

Query: 191 KSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQVPFLSMHKEH 250
                     + L S    I +KYS+F+  +F+L I+                 +++ ++
Sbjct: 178 SHK-------LHLRS-DQPIYVKYSAFIAGIFQLGIS-----------------TVYPDY 212

Query: 251 DQIQ-FINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDL 296
            + + FI+T P Y++A S+M  +HTSQMVWFR GWW FSRF F+N+L
Sbjct: 213 GKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  163 bits (413), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 151/294 (51%), Gaps = 48/294 (16%)

Query: 2   GILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVM 61
           G  F + K Y +L  +Y W    +E  N + F   V  + SQ +  S+ L+IAHPDDEVM
Sbjct: 3   GSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGD-SQHT--SLTLVIAHPDDEVM 59

Query: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121
           FF PTLLQLD  LP  +PF V+CL+ G       +G LR  E+  +L +L+      L  
Sbjct: 60  FFAPTLLQLDARLPAWMPFRVVCLTDG---GAEGLGQLRRAELQKALRLLV------LEH 110

Query: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181
           +V L   ++ DGM + WD+++V T +   ++        K  +LTFD +GVS H NHI C
Sbjct: 111 DVTLEVADFTDGMKEDWDLAEVRTRLGELVT------DAKPLVLTFDERGVSGHRNHIGC 164

Query: 182 YDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQV 241
             A   L  K+        + L S   N++ KYS F           + D FR+      
Sbjct: 165 ALAAARLGHKT--------LFLRSE-RNLLRKYSFF-----------VLDVFRVVFGTPP 204

Query: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVND 295
           P +          F++T   Y+ AL +M+ +H SQMVWFR+GWW  SR+V+ N+
Sbjct: 205 PTV----------FVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>Ecym_4671 Chr4 (1301893..1303107) [1215 bp, 404 aa] {ON} similar to
           Ashbya gossypii AER400C
          Length = 404

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 155 SNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKY 214
           +N+D    W+L+  A G  E PN +  Y     L+Q       Y+L  +  +  +I+ + 
Sbjct: 243 TNLDAFGEWILSETADGKDEIPNDVEIYKKAAELEQLQEPKIAYVLAQV-LFDEDIVEQI 301

Query: 215 SSFLPVVFKLLIN 227
           S   P++ K+LIN
Sbjct: 302 SEHAPLLQKVLIN 314

>CAGL0E01595g Chr5 (152413..153819) [1407 bp, 468 aa] {ON} similar
           to uniprot|Q08271 Saccharomyces cerevisiae YOL132w
          Length = 468

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 7/96 (7%)

Query: 81  NVICLSK--GVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQW 138
           NV+CL K   +++ G+   D+ +  I   + +  GH    LN      QFE  D   ++W
Sbjct: 356 NVLCLDKYENLEISGKTENDIPAKAIKTGIQVKRGHILELLNSNTLQVQFEIFDVYGQRW 415

Query: 139 DISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSE 174
              K+VT I    S +      ++   T  A G SE
Sbjct: 416 QGPKIVTPITRKTSNKK-----ENEAKTNGANGTSE 446

>TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {ON}
           Anc_5.76 YGR250C
          Length = 834

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 40  NISQQSLKSVNLIIAHPDDEVMFFTPTLLQLDDILPTHVPFN-VICLSKGVDVDGRAVG 97
           NIS+ S+ S    ++HP +  +   P  + +DDILP  + F  VI L    D  G ++G
Sbjct: 159 NISKWSISSNEHALSHPGNLYIKGIPKEMTIDDILPVFLNFGKVISLKIKTDQSGNSLG 217

>NCAS0A00730 Chr1 complement(142217..143374) [1158 bp, 385 aa] {ON}
           Anc_1.106 YNL254C
          Length = 385

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 206 YGSNIILKYSSFLPVVFKLLINIINDKF-----RIFELKQVPFLSMHK 248
           YG+ II K    LPVV  +L   +N  F     +IF+    PFLS+ +
Sbjct: 202 YGAEIIEKIQPHLPVVTDILTGRLNSPFYYEAKQIFQKSSKPFLSVEE 249

>TPHA0J01760 Chr10 complement(405424..406908) [1485 bp, 494 aa] {ON}
           Anc_6.110 YGL059W
          Length = 494

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 70/154 (45%), Gaps = 6/154 (3%)

Query: 80  FNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWD 139
           F +   + G+D D +++     N+ M + ++   HR  GL + V ++ + Y+    K  +
Sbjct: 343 FRISDKAGGLDYDDQSIWSFGKNKEMTAKSLENFHRLPGL-QTVSIYDYIYQSKSSKNKN 401

Query: 140 ISKVVTDIQNTISMESNVD-GLKHWLLTFDA--QGVSEHPNHIACYDAMMTLKQKSSN-P 195
           I K   D+    S++S  D  L   +  F+   +G+ E P        + T K  +    
Sbjct: 402 I-KSAKDLYRHTSLQSMSDTNLSKGIFKFEKPLKGLLERPFRHKLGIGLATCKVYAEYWN 460

Query: 196 GDYLLMTLNSYGSNIILKYSSFLPVVFKLLINII 229
           GD  L ++  +G++ +LK  + +    KL ++ +
Sbjct: 461 GDITLHSIPGHGTDTVLKLGNLMKNTKKLQLDKV 494

>SAKL0H05720g Chr8 (511687..513045) [1359 bp, 452 aa] {ON} similar
           to uniprot|P21592 Saccharomyces cerevisiae YPL172C COX10
           Heme A:farnesyltransferase catalyzes the first step in
           the conversion of protoheme to the heme A prosthetic
           group required for cytochrome c oxidase activity human
           ortholog is associated with mitochondrial disorders
          Length = 452

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 10  CYCILSILYIWLTPHIEDL--NLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62
           C+C+  +LY W  PH   L  N++S Y N    ++      +N  +A     +MF
Sbjct: 292 CWCLAGLLYAWQFPHFNTLSHNIRSEYKNAGYVMTAWKNPKLNARVALRYSLLMF 346

>KLTH0H12672g Chr8 complement(1074950..1078585) [3636 bp, 1211 aa]
           {ON} conserved hypothetical protein
          Length = 1211

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 17/112 (15%)

Query: 190 QKSSNPGDYLLMTLNSYGSNII--------LKYSSFLPVVFKLLINIINDKFRIFELKQV 241
           QK  +P    L T+N YG+N I        LK + F+     ++INI+    +   LK +
Sbjct: 133 QKDRSP----LKTIN-YGANSIPKLLLRRVLKVNGFVTSAENMVINILTPGDKQDALKSI 187

Query: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFV 293
               + +   ++Q ++    + +A SSML++  +  V FR+     SR  F+
Sbjct: 188 ----LAQNVAELQSLSNVTGFKIATSSMLSNGNAPQVSFRFDILPMSRLDFL 235

>CAGL0L10956g Chr12 complement(1171649..1173724) [2076 bp, 691 aa]
           {ON} weakly similar to uniprot|Q12033 Saccharomyces
           cerevisiae YOR275c
          Length = 691

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 16  ILYIWLTPHIEDLNLKSFYSNVQ-LNISQQSLKSVNLIIAHPDDEVMFFTPTLLQLDD-- 72
           IL+  L P IE ++  + Y+  Q + + Q  ++ +NL+    D+E+  F     ++D   
Sbjct: 345 ILFRNLLP-IEIMDYGTSYNEKQDIYVLQHFVEPINLLNIQLDEELASF----FEIDPQH 399

Query: 73  ILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYED 132
           I+  H         K +DV G++ GDL SN I  ++   L +  + L+ E+K     YE+
Sbjct: 400 IVNAHNKTKSFVTRKELDVIGQSFGDLESNAI--NIETQLANITSYLDLEIKT----YEE 453

Query: 133 GMDKQWDISKVVTDIQNTISMESNVDGLKHWL 164
              +  D+  +V     T      V+ L+ +L
Sbjct: 454 DKQQYGDVWTIVDARDVTKEFYEKVEKLRQYL 485

>Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {ON}
           YIL013C (REAL)
          Length = 1407

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 47/106 (44%), Gaps = 2/106 (1%)

Query: 107 SLTMLLGHRRAGLNREVKLH--QFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWL 164
           SL + L    +GL+ E  L   QF  +  M  Q  +  +    ++ IS   N+  LK   
Sbjct: 889 SLLLFLDEPTSGLDAEAALTIVQFLKKLSMQGQAILCTIHQPSKSVISYFDNIYLLKRGG 948

Query: 165 LTFDAQGVSEHPNHIACYDAMMTLKQKSSNPGDYLLMTLNSYGSNI 210
                  +++  ++   +D  +T  ++  NP D+++  + S  SN+
Sbjct: 949 ECVYFGSITDACDYFVVHDKRLTFDKEMDNPADFVIDVVGSGSSNV 994

>TPHA0K00250 Chr11 complement(40051..41015,41092..41092) [966 bp,
           321 aa] {ON} Anc_5.580 YDR460W
          Length = 321

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 114 HRRAGLNREVKLH------QFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWL 164
            +R    +E+K+       Q + ED M+K+W   ++V  +  T S E  ++G+K+ +
Sbjct: 157 EQRQHFEKEMKMKKRMLEKQIDEEDKMNKEWARREIVNRLTTTASTEDVIEGVKNTV 213

>Skud_11.290 Chr11 complement(517168..529458) [12291 bp, 4096 aa] {ON}
            YKR054C (REAL)
          Length = 4096

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 16/76 (21%)

Query: 87   KGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTD 146
            + +DVD  A GDL S         LL H   G +    LH F+ E  +D +WDI+ VVT+
Sbjct: 3738 EKLDVD--ANGDLNS---------LLKHI-TGKSYTSALHWFKNELFVD-EWDIADVVTN 3784

Query: 147  IQN---TISMESNVDG 159
             +N   T++ E +VDG
Sbjct: 3785 SENSFFTMASERDVDG 3800

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,795,612
Number of extensions: 1413362
Number of successful extensions: 5497
Number of sequences better than 10.0: 44
Number of HSP's gapped: 5539
Number of HSP's successfully gapped: 44
Length of query: 301
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 192
Effective length of database: 40,982,805
Effective search space: 7868698560
Effective search space used: 7868698560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)