Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002708.844ON1039103953300.0
TDEL0B005408.844ON1115108417000.0
NCAS0B002808.844ON1081103015980.0
KAFR0A028508.844ON1042100515580.0
KLTH0C03784g8.844ON997100415190.0
Suva_13.268.844ON1122105715190.0
CAGL0B02365g8.844ON1050103415090.0
YML117W (NAB6)8.844ON1134108515110.0
Smik_13.178.844ON1131107815030.0
ZYRO0G14256g8.844ON125972514930.0
KNAG0G034408.844ON1053106314650.0
Skud_13.248.844ON1128108314680.0
SAKL0D01364g8.844ON1082108313981e-175
Kpol_1068.58.844ON103247013561e-170
Kwal_27.102398.844ON91499813451e-169
Ecym_46158.844ON106782811911e-145
NDAI0E002708.844ON119849710691e-126
KLLA0D01485g8.844ON115182010391e-122
TBLA0B032808.844ON13622889631e-110
ABL122C8.844ON10435218991e-104
SAKL0A05280g6.183ON5821994724e-49
AFL061C6.183ON5231994632e-48
Ecym_22336.183ON5761994626e-48
KAFR0B066906.183ON5331994598e-48
TBLA0B052106.183ON7102204633e-47
KNAG0M004306.183ON4431994483e-47
NCAS0H010406.183ON6291994584e-47
NDAI0F022606.183ON6801994597e-47
Kwal_27.111586.183ON5671994521e-46
TDEL0G016206.183ON5841994493e-46
Kpol_1002.696.183ON5901994494e-46
KLTH0H04906g6.183ON5691994459e-46
KLLA0E19031g6.183ON6521994462e-45
CAGL0C01419g6.183ON6391994452e-45
ZYRO0G08140g6.183ON6321994417e-45
Suva_16.1236.183ON5961994381e-44
TPHA0J022106.183ON5932844371e-44
Skud_16.946.183ON6141994335e-44
Smik_6.3906.183ON6252024329e-44
YPL184C (MRN1)6.183ON6122024311e-43
ACR135C8.670ON3761951048e-04
Ecym_24038.670ON3751921020.002
KAFR0A038308.670ON374651000.003
NDAI0E011908.670ON358205960.007
ZYRO0F07238g8.670ON38994970.007
KLTH0D11088g8.670ON42269940.015
TBLA0D028108.466ON30684840.20
KAFR0H016208.466ON33084830.28
Kpol_1069.88.822ON44951830.37
KLLA0F11275g8.670ON38569810.49
TDEL0C052003.379ON26346790.72
ZYRO0F16214g1.102ON330160800.75
TDEL0C059901.102ON33786781.0
TDEL0A061608.670ON37868781.4
TPHA0D012108.670ON36469771.4
Kwal_27.117308.466ON36998771.7
YOR242C (SSP2)8.670ON37169761.9
Suva_8.2928.670ON37069762.0
Kwal_26.87638.670ON426234762.2
KLTH0E10868g8.466ON34182752.8
SAKL0H12012g8.466ON34440743.2
Suva_4.398.466ON34856743.7
Skud_15.4098.670ON37169744.1
SAKL0H21472g4.94ON297157734.3
Smik_15.4268.670ON37169734.5
ZYRO0C08382g7.250ON30465734.7
Skud_4.478.466ON34340717.7
TDEL0G036706.104ON61763719.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00270
         (1039 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...  2057   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   659   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     620   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   604   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   589   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   589   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   585   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   586   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   583   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   579   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   568   0.0  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   570   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   543   e-175
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   526   e-170
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   522   e-169
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   463   e-145
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     416   e-126
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   404   e-122
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   375   e-110
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   350   e-104
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   186   4e-49
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   182   2e-48
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   182   6e-48
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   181   8e-48
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   182   3e-47
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   177   3e-47
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   181   4e-47
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    181   7e-47
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   178   1e-46
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   177   3e-46
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   177   4e-46
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   176   9e-46
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   176   2e-45
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   176   2e-45
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   174   7e-45
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   173   1e-44
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   172   1e-44
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   171   5e-44
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   171   9e-44
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   170   1e-43
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    45   8e-04
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    44   0.002
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    43   0.003
NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.6...    42   0.007
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    42   0.007
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    41   0.015
TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON...    37   0.20 
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    37   0.28 
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    37   0.37 
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    36   0.49 
TDEL0C05200 Chr3 (928021..928812) [792 bp, 263 aa] {ON} Anc_3.37...    35   0.72 
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    35   0.75 
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    35   1.0  
TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa] ...    35   1.4  
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    34   1.4  
Kwal_27.11730 s27 (922606..923715) [1110 bp, 369 aa] {ON} YDL209...    34   1.7  
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    34   1.9  
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    34   2.0  
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    34   2.2  
KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} simila...    33   2.8  
SAKL0H12012g Chr8 complement(1027110..1028144) [1035 bp, 344 aa]...    33   3.2  
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    33   3.7  
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    33   4.1  
SAKL0H21472g Chr8 complement(1879578..1880471) [894 bp, 297 aa] ...    33   4.3  
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    33   4.5  
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    33   4.7  
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    32   7.7  
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    32   9.0  

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score = 2057 bits (5330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1002/1039 (96%), Positives = 1002/1039 (96%)

Query: 1    MKSPHKKMGXXXXXXXXXXXXXXXHPFQQQGGKVPFQQTIQPVMFSHRNMNPPPYNFQNR 60
            MKSPHKKMG               HPFQQQGGKVPFQQTIQPVMFSHRNMNPPPYNFQNR
Sbjct: 1    MKSPHKKMGNNNDQAHNNNENNAAHPFQQQGGKVPFQQTIQPVMFSHRNMNPPPYNFQNR 60

Query: 61   GYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPYHSQQXXXXXXXXXXFDYAYGTTL 120
            GYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPYHSQQ          FDYAYGTTL
Sbjct: 61   GYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPYHSQQTPLPNPPPTPFDYAYGTTL 120

Query: 121  LPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLVGDKSER 180
            LPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLVGDKSER
Sbjct: 121  LPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLVGDKSER 180

Query: 181  AKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDL 240
            AKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDL
Sbjct: 181  AKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDL 240

Query: 241  HTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQL 300
            HTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQL
Sbjct: 241  HTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQL 300

Query: 301  NSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF 360
            NSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF
Sbjct: 301  NSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF 360

Query: 361  DKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIE 420
            DKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIE
Sbjct: 361  DKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIE 420

Query: 421  VLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTE 480
            VLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTE
Sbjct: 421  VLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTE 480

Query: 481  VDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPM 540
            VDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPM
Sbjct: 481  VDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPM 540

Query: 541  IYANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQ 600
            IYANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQ
Sbjct: 541  IYANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQ 600

Query: 601  SQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVI 660
            SQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVI
Sbjct: 601  SQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVI 660

Query: 661  FIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEF 720
            FIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEF
Sbjct: 661  FIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEF 720

Query: 721  AFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAI 780
            AFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAI
Sbjct: 721  AFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAI 780

Query: 781  KLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNI 840
            KLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCG            RYFRKVKKPSYNI
Sbjct: 781  KLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNI 840

Query: 841  RLQQLEEERKRNDEIKQIDNKRINLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGFKNS 900
            RLQQLEEERKRNDEIKQIDNKRINLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGFKNS
Sbjct: 841  RLQQLEEERKRNDEIKQIDNKRINLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGFKNS 900

Query: 901  ENESDIDDSASNSSTDVELIINSPGNGFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPM 960
            ENESDIDDSASNSSTDVELIINSPGNGFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPM
Sbjct: 901  ENESDIDDSASNSSTDVELIINSPGNGFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPM 960

Query: 961  APNKLSHDYHRTHNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLN 1020
            APNKLSHDYHRTHNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLN
Sbjct: 961  APNKLSHDYHRTHNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLN 1020

Query: 1021 ASIEEPEFYDENDIDFAKQ 1039
            ASIEEPEFYDENDIDFAKQ
Sbjct: 1021 ASIEEPEFYDENDIDFAKQ 1039

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1084 (38%), Positives = 584/1084 (53%), Gaps = 216/1084 (19%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPN---------------KSYLSFQASPSRGISYNRRN 156
            FD AYG TLLPSH+LM SPFVS+PN               + Y   Q+  S G S+ +  
Sbjct: 61   FDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQRLQQYSHNQSKSSSGRSFGKLA 120

Query: 157  SNQMVFPNPPIITSP----HLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKI 212
            +    +P PP + SP    + + ++  R +  +Y+ + + D  KR ++ F         +
Sbjct: 121  T---AYPVPPSLNSPPASRNALHNRGPR-RGSHYKSIQSSDASKRFKDPF--------IL 168

Query: 213  SYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSI 272
            +Y++LPKG+D + TRSLLFEN++ SIDLH+F+  F NYG +ESVY+  S   H     SI
Sbjct: 169  TYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDH----VSI 224

Query: 273  LLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQK 332
            LLSF S++ICLDFYNSVLQ+LSEYK+ L+S+ L LSFVSL Y  ++ ++ +     +S+ 
Sbjct: 225  LLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKP 284

Query: 333  NETDFELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLY 392
            +  +      ++Y V N GATRS+ I F     K D+ I+  L FL    N RY++ES+ 
Sbjct: 285  DAFNITAAGSLRYDVINRGATRSIMITFKTPCSK-DELIDKKLEFLKKENNTRYVLESID 343

Query: 393  IVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSF-----DRTKH 447
            +V  +     FP +Y +L+FLNI M +E+L YIR  +    I  C ++S      D  + 
Sbjct: 344  LVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRL 403

Query: 448  AVSNSNR----QSLSKKGTSDTLNTYTLESP---INHNTEVDMNDIPSIYDENEIEIANK 500
            +VS+++     +S+S    S   +  +LES    I+ + E+D             E+  K
Sbjct: 404  SVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEID-------------EMTYK 450

Query: 501  LSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISR----------------------- 537
            L  +  + +   +  +NY +P  E   +HL NV++S                        
Sbjct: 451  LQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVL 510

Query: 538  --------DPMIYANPIYQS----PPSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKH 585
                    + M YA P  Q     PPS    +    TP+      +    N R + NM  
Sbjct: 511  PNQDMPLPNDMNYA-PSVQDVDAVPPSMVPMSTMPNTPYG----CYMPPPNVRQNGNMTK 565

Query: 586  YNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGII 645
                    P+ Q+LQ Q+ATSAE+AS MGGG+GNRT++IGNI+PRS+TEDICNV RGGI+
Sbjct: 566  --------PITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGIL 617

Query: 646  QQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAV 705
            Q VK++ EK ICFV F++  AA QFY N+FIDPI+LH N LK+GWG H GPLPK+I LAV
Sbjct: 618  QNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAV 677

Query: 706  TAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKD 765
            T GASRNVYVSLPEFAFKDKYI DP Y+EY+ K+ LP E+QLR+DFS +G++EQIN+L D
Sbjct: 678  TVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLND 737

Query: 766  KHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXX 825
             HCCW+NFTNI +AIKLVE VK E   NF++    RY GL+IGYGKDRCG          
Sbjct: 738  GHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGK 797

Query: 826  XXRYFRKVKKPSYNIRLQQLEEERKRNDEI--KQIDN---KRINLDSLGITT-------- 872
              R+++KVKKPS+NIRL ++EEER++++E   +Q +N   K +   SLGIT         
Sbjct: 798  NSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDP 857

Query: 873  -----------------SPNQNI----------QEDETLSLA-------KLKLTSDTGFK 898
                             SP + +          +E E L L+        L +    G  
Sbjct: 858  EKVDDVDFEDEVKFDSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQS 917

Query: 899  NSENES----------DIDDSASNSSTDVELIINSP---GNGFKSHRNRKPKPN------ 939
              E E+          D   + S++S+DVELIINSP    + FKS  NR  + N      
Sbjct: 918  TREKEATKLTRNHSENDETSAKSDASSDVELIINSPEEEESNFKSKSNRGFRKNDRRKLA 977

Query: 940  NLDLGERPK-------------VDAIVFKADGPMAPNKLSHDY----------------- 969
            N   G   K             + +   +A+ PMAP  +S +Y                 
Sbjct: 978  NCAEGASSKERFKSTTNDVSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDFE 1037

Query: 970  ------HRTHNTRVDNPRSERT-----RKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANV 1018
                       +  D   +++T       R H K IPGSDVM+QYLAQ+QHSTF+YAAN+
Sbjct: 1038 GESFDDESQQESNFDFESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANI 1097

Query: 1019 LNAS 1022
            L AS
Sbjct: 1098 LGAS 1101

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1030 (38%), Positives = 580/1030 (56%), Gaps = 140/1030 (13%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLS-------FQASPSRGISYNRRNSNQMVFPN 164
            FD AYG TLLPSH+LM SPFV+TP   +         +  +P+R  S+++  S  +   N
Sbjct: 83   FDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRA-SFSQIPS-MLNVGN 140

Query: 165  PPIITSPHLVGDKSE--RAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDD 222
            PP   S    G++++  R +S    KV   D     + +F +     +++SY+ILP GDD
Sbjct: 141  PP---SARRQGNQNDPNRRRSSYRSKVPETDP----KTLFLQ----PFRMSYKILPSGDD 189

Query: 223  TYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQ----NSVKSILLSFTS 278
             Y TRSLLFEN+  SI+LHTF+ +FV +  IESVY++  +++ +       +SILLSF +
Sbjct: 190  AYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLT 249

Query: 279  RSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFE 338
            R +CL FYN+VLQ+L E+K +L SENL+LSFVS+ Y   N  +    +      +E  F 
Sbjct: 250  REVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEEETNIV------DEPSFY 303

Query: 339  LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNG 398
                + ++++N  ATRS+ I+F     +  +  +  L FL+   N RYI+ES+ +VN   
Sbjct: 304  TKESVYFELSNPQATRSILIQFKNPCSE-QELFDKKLKFLNQENNSRYILESIDLVNVTQ 362

Query: 399  KDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLS 458
             +NEFP HY IL+F+NI M +E+  Y++       I++C++V       +  +S R S+ 
Sbjct: 363  TENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASII 422

Query: 459  KK---GTSDTLNTYTLESPINHNTEVDMNDIPS-----IYDENEIE-IANKLSELEIQTH 509
             K      +TL++   ++ I  N+ +    +PS     + DE +++ ++ KL    I+  
Sbjct: 423  SKDNDNNDETLSSQQKKNDILKNSSII--SLPSAENDQVSDEEKLDKLSEKLKSTNIEEL 480

Query: 510  TFNLDISNYSNPHIEIRAEHLPNVSIS--------------------------RDPMIYA 543
               +D + Y  P      EHLPN ++S                          R   + A
Sbjct: 481  ILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPA 540

Query: 544  NPIYQSPPS---GYME---NMWTTTPFLSSHIVHEEYAND-RVDYNMKHYNNQLYNVPLP 596
            NP + + P+   GY+    NM   TP +  +     + ND     N  + NN  Y  P+ 
Sbjct: 541  NPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGY---FVNDPAFSMNNNYNNNTNYRNPIS 597

Query: 597  QTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNI 656
            +TL+    T++++ + +G   GNRTI+IGNIN RSK EDICNV RGGI+Q VKYI  K+I
Sbjct: 598  KTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHI 657

Query: 657  CFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVS 716
            CF+ FI+  AA  FYANSFIDPI+LHN+TLKIGWG++  PLPKA+ LAVT GASRNVYVS
Sbjct: 658  CFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVS 717

Query: 717  LPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNI 776
            LPEFAFKDK+INDP Y+EYH KY LP   QLR DFSK+G +EQIN+LKD HCCW+NF NI
Sbjct: 718  LPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNI 777

Query: 777  RSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKP 836
             +AI+LVE   N   + F E++ NRY GLII YGKDRCG            R+++KVK  
Sbjct: 778  SAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSI 837

Query: 837  SYNIRLQQLEEERKRNDE-------IKQIDNKRINLDSLGI---TTSPNQ---NIQEDET 883
            S N++L++LEE+RK + E           D +   LD+ GI   T S N+   NI++  T
Sbjct: 838  SNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNT 897

Query: 884  LSLAKLKLTSDT------GFK--------------NSENESDIDDSASNSSTDVELIINS 923
            LS    K+ +D       GFK              N+E  + +++ +S+ S+++EL+I+S
Sbjct: 898  LS----KIDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTLENISSDESSNIELMISS 953

Query: 924  PGNGFKSH---RNRKPKPNNLDLGER---------PKVDA-----IVFKADGPMAPNKLS 966
            P    +      N+KP  NN    +R          + D          ++   APNK  
Sbjct: 954  PKESVQKGDVITNQKPHSNNHHNFKRNSSSNRQRYKETDTQNTHRNNNNSNATFAPNK-- 1011

Query: 967  HDYHRTHNTRVDNPRSERTRKRTHKK---IIPGSDVMSQYLAQVQHSTFMYAANVLNASI 1023
             ++    +  VD  +    +  T+ K   +IPGSDVM+QYLAQ+QHSTFMYAAN+L AS 
Sbjct: 1012 -EFGFGISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASA 1070

Query: 1024 EEPEFYDEND 1033
            E+  +YDE++
Sbjct: 1071 EDGSYYDESN 1080

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1005 (39%), Positives = 562/1005 (55%), Gaps = 128/1005 (12%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPN--------KSYLSFQASPSRGISYNRRNSNQMVFP 163
            FD AYG TLLPSH+LM SPF+S+PN             F  + + G S  R++  ++   
Sbjct: 78   FDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNNNNGSSTPRKSFFKV--S 135

Query: 164  NPPIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDT 223
            N PI +      +K  ++   N    +  ++   N+E+ E+       ISY ILPKGDD 
Sbjct: 136  NRPISSRSSRFSEK-RKSFIINNPTTNNSNNNNNNKEILEKLFTEPINISYVILPKGDDA 194

Query: 224  YHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICL 283
            Y TRSLLFEN++ +I+LH+FI  FV    IES+Y+VP+   + ++   I+LSF SR ICL
Sbjct: 195  YRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPN--KNDSNTCDIILSFLSRHICL 252

Query: 284  DFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLI 343
            DFYN+VLQ+L E+K  LNSE+L L+FVSL Y  N   + N   S+E              
Sbjct: 253  DFYNNVLQRLKEFKKHLNSESLNLNFVSLKY--NKTTRDNQGPSLE-------------- 296

Query: 344  QYQVANFGATRSLCIEF-----DKRVDKIDDFIETYL-PFLSSNANKRYIIESLYIVNNN 397
             + +    ATRSL IE      D  + + +   E  L   L ++ NKRY++ES+ +V+ +
Sbjct: 297  -FNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTD 355

Query: 398  GKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFD--------RTKHAV 449
              + EF  +Y ILSFLNI+M IE++ YI+  +    I  C +V+              A+
Sbjct: 356  KSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSSAL 415

Query: 450  SNSN--RQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELEIQ 507
            S++   + S+S +G ++  N  +     N    +  ++     DE  I IA+KL  ++++
Sbjct: 416  SSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKGIKLK 475

Query: 508  THTFNLDISNYSNPHIEIRAEHLPNVSIS------------RDPMIYANPIYQSPPSGYM 555
              + ++   +Y  P      +HLPNV+IS            R   IY N +  SP    +
Sbjct: 476  DISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDM--SPSFEGI 533

Query: 556  ENMWTTTPFLSSHIV-----------HEEYANDRVDYNMKHYNNQLYNVPLPQTLQSQFA 604
            + M +++  LS +                Y +         + +  +  P+  +L++Q +
Sbjct: 534  DMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLS 593

Query: 605  TSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDP 664
            TSA++AS MG   GNRTI+IGNINPRSK EDICNV RGGI+Q +K+I  K+ICFV FI+ 
Sbjct: 594  TSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEA 653

Query: 665  QAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKD 724
             AA QFYAN+FIDPI+LH NTLK+GWG++ GPLPK+I LAVT GASRNVYVSLPEFAFKD
Sbjct: 654  AAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKD 713

Query: 725  KYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVE 784
            KYINDP +KEYH K+ LP  +QLR DFS +G  EQIN+L D HCCW+NF NI SAIKLVE
Sbjct: 714  KYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVE 773

Query: 785  LVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQ 844
               N D + F+E++  RY GL+I YGKDRCG            R++ K+++ ++N +L +
Sbjct: 774  EATN-DFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFY-KIRQ-NHNFKLSK 830

Query: 845  LEEERK-----------------------------RNDEIKQIDNKRINLDSLGITTSPN 875
            LEE+R+                              N+E K+ D K + LDSLGI+    
Sbjct: 831  LEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLESK 890

Query: 876  QNIQED--ETLSLAKLK----LTSDTGFKNSENESDIDDSASNSSTDVELIINSPGNGFK 929
              I +D  + L++ + +    +T + GF+N+   SD       SS+D+ELIINSP N  +
Sbjct: 891  NEIADDINDALTVDQFENEKSITKNNGFENTSFHSD-------SSSDIELIINSP-NSLR 942

Query: 930  SHRNRKPKPNNLDLGERPKVDAIVFKADGPMAPNKLSHDYHRTHNTRVDNPRSERTRKRT 989
            +  N        D+ +  K+       +     N   +DY +  N  +    +    +  
Sbjct: 943  TKDN--------DVLDSEKIINSANTTNRTGNANGYKNDYTKNRNDGMR--NNRSRNRSR 992

Query: 990  HKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDENDI 1034
            + + IPGSDVM+QYLAQ+QHSTFMYAAN+L AS EE E+YDE ++
Sbjct: 993  YSRTIPGSDVMAQYLAQLQHSTFMYAANILGASGEE-EYYDEAEL 1036

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1004 (38%), Positives = 561/1004 (55%), Gaps = 150/1004 (14%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSP 171
            FD +YG +LLPSH+LM+SPF++TP        ASP R    +R +  Q  +  P   ++ 
Sbjct: 53   FDTSYGVSLLPSHLLMSSPFLATPGMG----SASPHRA-GGSRSSHAQSSYHTPNFGSTQ 107

Query: 172  HLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPK----GDDTYHTR 227
              +   +E+    N++   +    + N  V +     AY++ + ILP+    G D Y TR
Sbjct: 108  LRMPPPTEK---RNFKHGSSY---RHNSSVQQR----AYEVVFHILPRSADGGGDEYMTR 157

Query: 228  SLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYN 287
            SLLF N+N    LH F+ KF  +  +ESVY+V S +      +S+L+SF ++  CLDFYN
Sbjct: 158  SLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQQ------QSVLVSFLTKETCLDFYN 211

Query: 288  SVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQV 347
             VLQKLSE+K +L S+ L L+F SL     ++  G                    I+ +V
Sbjct: 212  GVLQKLSEFKKELKSKELTLNFASL----RDVKTG---------------PTLQEIKIEV 252

Query: 348  ANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHY 407
               GATRSL +EF  +VD     +   L F+  N   RY++E++ IVN       F  HY
Sbjct: 253  LRAGATRSLILEFQDKVDLA--LLSKSLGFIV-NEGPRYVVEAIEIVNAGRSSKHFGPHY 309

Query: 408  VILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLN 467
             I+ F++I+M +E + Y++S+  S  +   +   +  T  A   S  Q+LS    S  LN
Sbjct: 310  AIIHFISIAMALETVEYLKSQ--SNKLAGLIKFRYVNTTSASGKSEFQTLS----SSQLN 363

Query: 468  TYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRA 527
                E  +++ ++ D++       E+   + +KL +  +   T  +D + Y  P +E R+
Sbjct: 364  ----ERALSNTSDSDISG-----GESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERS 414

Query: 528  EHLPNVSISRDPMIYANPIYQSPPSGYMENMWTTTPFLSSHIV--HEEYANDRVDYNMKH 585
            EHLP+V+IS+           S  S       TT+P     +V  HE+ ++     ++K 
Sbjct: 415  EHLPHVTISK--------ALNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLKQ 466

Query: 586  YNNQL--------------YNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRS 631
             N+                 + PL QTLQ Q+ T+A++A+ MGGG+GNRT++IGNI+PRS
Sbjct: 467  ANSHGPAYPPIPGYPFYMNMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRS 526

Query: 632  KTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWG 691
            KTEDICNV RGGI+Q VKYI  K+ICFV FI+  +A QF+ANS I+PI+LH N LK+GWG
Sbjct: 527  KTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWG 586

Query: 692  DHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDF 751
             H G LP++I LAVT GASRNVYVSLPE AFKDK+I DP Y+E+  K+ LPS++QL EDF
Sbjct: 587  HHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDF 646

Query: 752  SKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGK 811
            S FG++E +NFL+D HCCWINF NI +AIKLVE   N +N++FHE++ NRYKGL IGYGK
Sbjct: 647  SVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGK 706

Query: 812  DRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQLEE-----ERKRNDEIKQIDNKRINLD 866
            DRCG            +YF+KVKK SYNIRL++ ++       +  DE K++D K I  D
Sbjct: 707  DRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQKGASDAPTEVKDEAKELD-KPIKAD 765

Query: 867  SLGITTSPNQN----------IQEDETLSLAKL---------KLTSDTGFKN---SENES 904
            + GI+    QN          ++EDE L L+ L          L S TG +      +ES
Sbjct: 766  AFGISVGDTQNLVRDSDEEQKLEEDELLRLSDLNNTGGGLGISLASSTGEETNTPVSDES 825

Query: 905  DIDDSASNSSTDVELIINSPGNGFKSHRNRKPKPNN-------LDLGER--------PKV 949
              ++S S+ S+DV++++++PG+   S    K  P +        ++ E+        P+V
Sbjct: 826  SKEESVSSESSDVDILVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAIIPRV 885

Query: 950  DAIVFKADGPMAPNKLSHDYHRT--HNT--------------RVDNPRSERTRKRTH--- 990
             +    A  P+AP+ LS  Y  T  HN+              R ++ RS+ ++K  H   
Sbjct: 886  SSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRR 945

Query: 991  --KKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDEN 1032
               K IPGSDVM+QYLAQ+QHSTFMYAAN+L     E  FYDEN
Sbjct: 946  RKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDEN 989

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1057 (37%), Positives = 575/1057 (54%), Gaps = 139/1057 (13%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPN--KSYLSFQASPSRGISYNRRNSNQ---------- 159
            FD AYG +LLPSH+LM SPFVS+PN    Y   ++S     +Y+R  S+Q          
Sbjct: 68   FDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSYNANHNNN 127

Query: 160  ---------MVFPNPPIITSPHLVGDKSERAKS------DNYEKVDTLDDEKRNR-EVFE 203
                     M+ P+        L   K   A +        YE  ++      +R  +F+
Sbjct: 128  NNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYETRNSSGRRTSSRINIFD 187

Query: 204  E---ESAI--AYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYV 258
            E   E+ +   ++I+Y+ILP GDD Y TRSLL EN+++S DLH+ ++ FV    +ES Y+
Sbjct: 188  EIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYI 247

Query: 259  VPSYET-----HQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLC 313
            V S ET      +    SIL+SF +R  CL+FYN++LQ+LSE+KT L S++L L FV L 
Sbjct: 248  VGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLN 307

Query: 314  YLQNNINKG--NGKISVESQKNETDFELTSL---IQYQVANFGATRSLCIEFDKRVDKID 368
            Y   ++     + ++S   ++  TD   T +   + + V N  ATRS+ IEF   ++K +
Sbjct: 308  YDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAE 367

Query: 369  DFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSK 428
             F E  L FL  + NKRYI+ES+ IV+ +   N+FP +YV+L+FLNI M IEVL Y++  
Sbjct: 368  LFKEK-LQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKY 426

Query: 429  NLSKTIKNCLYVSFDRTKHAVSNSNRQSL-SKKGTSDTLNTYTLESPI------------ 475
            +    I  C YVS      + + S+  S+   K +S  L+T ++ +              
Sbjct: 427  SKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNNDINNINNNNN 486

Query: 476  ---------NHNTEVDMNDIPSIYDENEIEI-ANKLSELEIQTHTFNLDISNYSNPHIEI 525
                      ++     +   S+    EIE+   KL  +++      +   +Y  P I  
Sbjct: 487  NGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGIDLDGTILEVTCHDYPTPVINE 546

Query: 526  RAEHLPNVSISRDPMIYANPIYQSPPSGYM--ENMWTTTPFLS-SHIVHEEYANDRVDYN 582
             + HL N+ IS+  +  +    Q  PS     E+M+ T    S   IV ++        +
Sbjct: 547  HSAHLSNIKISKT-VDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGTIVSQQLITAPSPQS 605

Query: 583  MK-HYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTR 641
                 N ++   P+ Q+L+  F  SA++AS MG  +GNRTI+IGNINPRS+ EDICNV R
Sbjct: 606  PNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVR 665

Query: 642  GGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAI 701
            GGI+Q +KYI EK ICFV FI+  +A QFYANSFIDPI+LH N L++GWG + GPLPK+I
Sbjct: 666  GGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSI 725

Query: 702  ELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQIN 761
             LAVT GASRNVYVSLPEFAFK+K+I+DP YK+ H    LP  +QLREDFS +G++EQIN
Sbjct: 726  SLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQIN 785

Query: 762  FLKDKHCCWINFTNIRSAIKLVELVKNEDNNN-----------FHERYKNRYKGLIIGYG 810
            +L D HCCWINF NI SAI LVE +  E   +             E++  RYKGL+I YG
Sbjct: 786  YLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYG 845

Query: 811  KDRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQLEEERKRND-EIKQIDNKRINLDSLG 869
            KDRCG            R+++KVK+PSYNIRL +LEE R++N+ + K+  +K +NL+SLG
Sbjct: 846  KDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLG 905

Query: 870  ITTSPNQNIQEDETLS-----------------------LAKLKLTSDTGFKNS-ENESD 905
            I+  P++    DE  +                               ++  K +  +E+D
Sbjct: 906  ISLDPHKGTDIDEAEAEGTTGAEVENEVEAENGNETVGLGGLGLGVVNSDVKRALSDETD 965

Query: 906  IDD------SASNSSTDVELIINSPGN---GFKSHRNRKPKPNNLDLGERPKV---DAIV 953
             D+       +S+SS+D+E+I++SP +     KS   R      L+     KV   D +V
Sbjct: 966  YDEFFNKSSRSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVENEDGLV 1025

Query: 954  ----------FKADGPMAPNKLSHDYHRTHNTRVDNP--RSERTRKRTHK-------KII 994
                       K   P AP+ LSH++ + +   + +    +E T  +T K       + I
Sbjct: 1026 GLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVTDNKTKKRGSFPRHRTI 1085

Query: 995  PGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDE 1031
            PGSDVM+QYLAQVQHSTFMYAAN+L AS E+  + DE
Sbjct: 1086 PGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/1034 (37%), Positives = 557/1034 (53%), Gaps = 160/1034 (15%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYN------RRNSNQMVFPNP 165
            FD AYG +LLPSH+LM SP +ST N    +     + G + N      RRNS  ++  N 
Sbjct: 54   FDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGFVLQSNG 113

Query: 166  PIITSPHLVGDKSERAKSDNYEK------VDT---------LDDEKRNREVFEEESAIAY 210
                +P++   +S  +++   +K       D+         L  +KR      ++     
Sbjct: 114  ---NTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPI 170

Query: 211  KISYQILPKGDDTYHTRSLLFENINESID-LHTFIEKFVNYGLIESVYVVPSYETHQNSV 269
             I+Y++LP GDDTY TRSLLFEN+ ++ + L  F+   +NY  +ESVYV    +T     
Sbjct: 171  SINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDK 230

Query: 270  KS------ILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQN------ 317
            +S      + LSF SR   LDFYN+ LQ+L ++K +L+S  L +SFVS  Y+ +      
Sbjct: 231  ESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDEDKDKD 290

Query: 318  -------NINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEFDKRVDKIDDF 370
                   N  K N K S E  K     E       ++ +  ATRS+ IEF  +V++  D 
Sbjct: 291  KDKDKDINTEKRNIKRSQELLKEPALGE-------EIFSHDATRSIAIEFYSQVEQ--DA 341

Query: 371  IETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNL 430
            +   LPFL    NKRYI+E++ I++     ++FPA+YVIL+F+NI M IEVL Y+++  +
Sbjct: 342  LFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLM 401

Query: 431  SKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIY 490
            + ++  C +VS    K    +S    L    T  + +   +      NT +   ++ S+ 
Sbjct: 402  TYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRELESLS 461

Query: 491  DENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSP 550
            DE        L+ L+++     +  S+Y  P I    +H+P  S +    I+ + +    
Sbjct: 462  DE--------LASLKLEEKCLKIIRSDYPKPEIRSHDDHIPG-STNFSMYIFDDGMNPEG 512

Query: 551  PSG-YMENMWTTTPFLSSHIVHEEYANDRVDYNMKHY---NNQL----YNVP-------- 594
             SG Y+ +  T      S I+   ++N  +D ++ H    NN L    ++ P        
Sbjct: 513  NSGMYLHDNLTD----HSSIIGSPFSN-YIDPSISHVMLPNNGLPVGGFDAPGKFPIEPI 567

Query: 595  -----------LPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGG 643
                       + Q+++ +  TSA +A+ MGG   NRT++IGNINPRSK EDICNV RGG
Sbjct: 568  SGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGG 627

Query: 644  IIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIEL 703
            I+Q VK+I +K ICFV FI+  AAAQF ANSFIDPI+LH NTL++GWG+  GPLPK+I L
Sbjct: 628  ILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIAL 687

Query: 704  AVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFL 763
            AVT GA+RNVYVSLPE+AFKDK+INDP YKEYH +Y LPS++QLR+DF+ +GE+EQIN+L
Sbjct: 688  AVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYL 747

Query: 764  KDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXX 823
            KD HCCW+NF NI SAI+LVE + + +   FH+++ NRY+GLII YGKDRCG        
Sbjct: 748  KDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIA 807

Query: 824  XXXXRYFRKVKKPSYNIRLQQLEEERK-RNDEIKQIDNKRINLDSLGI------------ 870
                ++++KVKKPSY+IR++++EE+RK + D +       I LDSLGI            
Sbjct: 808  GKGSKFYKKVKKPSYDIRIKKMEEKRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKL 867

Query: 871  -----TTSPNQNIQEDE--------------------TLSLAKLKLTSDTGFKNSENESD 905
                 TT  N  +++D                      LS  K  +  D    +    SD
Sbjct: 868  SGGHTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGSDESVISD 927

Query: 906  IDDSAS--NSSTDVEL-IINSPGNGFKSHRN------RKPKPNNL---DLGERPKVDAIV 953
             ++SAS   SS+D +    NS G+ F    N      R P   N+    +   P ++   
Sbjct: 928  FENSASKETSSSDRKYQTTNSRGDTFVPKTNLSHAPPRAPSTINMTYKKISYVPPLNGQA 987

Query: 954  FKADGPMAPNKLSHDYHRTHNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFM 1013
             K D P         Y RTHN   + P  + TR       IPGSDVM+QYLAQ+QHSTFM
Sbjct: 988  PKMDYP-------KKYKRTHN---NFPNQQPTRP------IPGSDVMAQYLAQLQHSTFM 1031

Query: 1014 YAANVLNASIEEPE 1027
            YAAN+L AS+E  E
Sbjct: 1032 YAANILGASVETEE 1045

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1085 (37%), Positives = 580/1085 (53%), Gaps = 183/1085 (16%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPN--KSYLSFQASPSRGISYNRRNSNQ---------- 159
            FD AYG +L PSH+LM SPFVS+PN    Y S ++S  +  +Y+R  SN           
Sbjct: 68   FDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNGYNGNSNSN 127

Query: 160  -------MVFPNPPIITSPHLVG--------DKSERAKSDNYEKVDTLDDEKRN----RE 200
                   MV P     ++ + +G        + +     +N +  DT ++  R       
Sbjct: 128  QNNTNNGMVTP-----SNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTFARNN 182

Query: 201  VFEE---ESAIA--YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIES 255
            +F++   E  +   + I+Y++LP GDD Y TRSLL EN++ SIDLH+ ++ FV    +ES
Sbjct: 183  IFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLES 242

Query: 256  VYVVPSYETH-----QNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFV 310
             Y++   ++      +    SIL+SF ++  CL+FYN++LQ+LSE+KT L SE L L FV
Sbjct: 243  AYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFV 302

Query: 311  SLCYLQNNINKGNGKISVESQKNETDFE-----LTSLIQYQVANFGATRSLCIEFDKRVD 365
             L Y    +       ++     E D       +++ + + +AN  ATRS+ IEF   V+
Sbjct: 303  CLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPVE 362

Query: 366  KIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYI 425
            K D F +  L FL  + NKRYI+ES+ +VN +   N+FP +Y +L+FLNISM IEVL Y+
Sbjct: 363  KSDLF-KKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYL 421

Query: 426  R--SKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESP--------- 474
            +  SKNL   I  C YVS       V +S R S++      T +T+ L  P         
Sbjct: 422  KKYSKNLG--ISKCFYVSL---APLVVSSARSSVANIYEGKT-STHRLSVPSVTAGNNND 475

Query: 475  -----------------INHNTEVDMNDIPSIYDE---------------NEIE-IANKL 501
                             +N+N+ + +    S+Y                  EI+ +A KL
Sbjct: 476  SNNNGNNNKSNMSGITTLNNNSSIGV----SVYGHSNMSLTSLSSSVSLNEEIDMLATKL 531

Query: 502  SELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISR---DPMIYANPIYQSPPSGYMENM 558
              +E+      ++  +Y  P IE  + HL NV IS+   +   ++  I    P      M
Sbjct: 532  QGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFM 591

Query: 559  WTTTPFLSSHIVHEEYANDR-VDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGV 617
              +     + I  +  A    V  N++  N ++   P+ Q+L+  F  SA++AS MG  +
Sbjct: 592  NDSNQSNGAIIPQQLIATPSPVSPNLQ-MNQRVLPNPITQSLEQNFNVSAKVASSMGSDI 650

Query: 618  GNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFID 677
            GNRTI+IGNINPRSK EDICNV RGGI+Q +KYI EK ICFV FI+  +A QFYANSFID
Sbjct: 651  GNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFID 710

Query: 678  PIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHN 737
            PI+LH N L++GWG + GPLPK I LAVT GASRNVYVSLPEFAFK+K+I+DP YK+ H 
Sbjct: 711  PIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHE 770

Query: 738  KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVE------LVKNEDN 791
               LP  +QLREDFS +G++EQIN+L D HCCWINF NI SAI LVE       V+NE  
Sbjct: 771  TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESG 830

Query: 792  -----NNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQLE 846
                     E++  RYKGL+I YGKDRCG            R+++KVK+PSYNIRL +LE
Sbjct: 831  EVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLE 890

Query: 847  EERKRN--DEIKQIDNKRINLDSLGITT--------------------------SPNQNI 878
            E+R++N  DE ++  +K +NL+SLGI+                           + N+N 
Sbjct: 891  EKRRQNEIDEKEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENENG 950

Query: 879  QEDETLSLAKLKLTSDTGFKNSENESDIDD------SASNSSTDVELIINSPGN---GFK 929
             E  +     L + S    + + +E+D +D       +S+SS+DVE+I++SP +     K
Sbjct: 951  NETGSFGGLGLAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYALK 1010

Query: 930  SHRNRKPKPNNLDLGERP-----KVDAI---------VFKADGPMAPNKLSHDYHRTH-- 973
            S   R      ++  +RP     + +A+           +   P AP+ LS+++ + +  
Sbjct: 1011 SQTLRSSSQTVIN-SKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNET 1069

Query: 974  -------NTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEP 1026
                   N    N R ++       + IPGSDVM+QYLAQVQHSTFMYAAN+L AS E+ 
Sbjct: 1070 PMQDIFTNGETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1129

Query: 1027 EFYDE 1031
               DE
Sbjct: 1130 THPDE 1134

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1078 (37%), Positives = 575/1078 (53%), Gaps = 184/1078 (17%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQ------------ 159
            FD AYG +LLPSH+LM SPFVS+PN   +    SP+R  ++ R+  ++            
Sbjct: 68   FDTAYGASLLPSHLLMGSPFVSSPN---MQGGYSPARSSNFKRKAYSRPVSNHNNYNGNN 124

Query: 160  ----------MVFPNP--PIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNRE----VFE 203
                      MV P+    I  +     + S R  + N +  D  +   R       +F+
Sbjct: 125  NSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHNNKGCDNRNSSGRRTSTRNNIFD 184

Query: 204  EESA-----IAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYV 258
            + S+       ++I+Y+ILP GDD Y TRSLL EN++ S DLH+ ++ FV    +ES Y+
Sbjct: 185  DISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYI 244

Query: 259  VPSYET-----HQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLC 313
            + + ++      Q S  SIL+SF +RS CL+FYN++LQ+LSE+KT L SE+L L FV L 
Sbjct: 245  IGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLN 304

Query: 314  Y----LQNNINKGNGKISVESQKNETDFELTSL-IQYQVANFGATRSLCIEFDKRVDKID 368
            Y    L   I       +VE      D  + S  + + + N  ATRS+ +EF K   K  
Sbjct: 305  YDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEF-KSPLKST 363

Query: 369  DFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSK 428
            +     L FL  + NKRYI+ES+ IVN +   N+FP +Y +L+FLNI M IEVL Y++  
Sbjct: 364  ELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKY 423

Query: 429  NLSKTIKNCLYVSF-----DRTKHAVSN-------SNRQSL---------------SKKG 461
            +    I  C YVS        T+ +V+N       ++R S+               + K 
Sbjct: 424  SKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSNNHKS 483

Query: 462  TSDTLNTY----TLESPINHNTEVDMNDIPSIYDENE-IEI-ANKLSELEIQTHTFNLDI 515
                 NT+    +  + +  N+ V +  +PS    NE I+I   KL  +++      ++ 
Sbjct: 484  NISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGTDLEINY 543

Query: 516  SNYSNPHIEIRAEHLPNVSISR-------------DPM-----IYANPIYQSPPSGYMEN 557
             +Y  P +   + HL NV IS+              P+     ++ N    S  S   + 
Sbjct: 544  HDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIVPQQ 603

Query: 558  MWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGV 617
            +  T   +SS I      N RV  N           P+ Q+L+  F  SA++AS MG  V
Sbjct: 604  LMATPSPVSSTI----QMNQRVLPN-----------PITQSLEQNFNVSAKVASSMGSDV 648

Query: 618  GNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFID 677
            GNRTI+IGNINPRS+ EDICNV RGGI+Q +KY+ EK ICFV FI+  +A QFYANSFID
Sbjct: 649  GNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFID 708

Query: 678  PIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHN 737
            PI+LH N L++GWG + GPLPK+I LAVT GASRNVYVSLPEFAFK+K+I+DP YK+ H 
Sbjct: 709  PIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHE 768

Query: 738  KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVE------LVKNEDN 791
               LP  +QLREDFS +G++EQIN+L D HCCWINF NI SAI LVE         NED 
Sbjct: 769  TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDG 828

Query: 792  NNFH-----ERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQLE 846
               H     +++  RY+GL+I YGKDRCG            R+++KVK+PSYNIRL +LE
Sbjct: 829  EMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLE 888

Query: 847  EERKR--NDEIKQIDNKRINLDSLGITTSPNQN--IQEDETLSLAKLKLTSDTGFKNSEN 902
            E R++  ND+ ++  +K +NL+SLGI+   +++  I E E  +    ++ ++    N  N
Sbjct: 889  ERRRQNENDKKERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSN 948

Query: 903  E-------------SDIDDSASNSS----------------TDVELIINSPGN---GFKS 930
            E             S+++ +AS+ +                +D+E+I++SP +     KS
Sbjct: 949  ETVGIGGLGLGVASSEVNRAASDETDYEDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKS 1008

Query: 931  HRNRKPKPNNLDLGERP-----KVDAI---------VFKADGPMAPNKLSHDYHRTHNTR 976
               R      ++  +RP     + DA+           +   P AP+ LS++  + + T 
Sbjct: 1009 QTLRSSSQTVIN-SKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETP 1067

Query: 977  VDN--PRSERTRKRT-------HKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEE 1025
            + +  P  E T  R          + IPGSDVM+QYLAQVQHSTFMYAAN+L AS E+
Sbjct: 1068 IRDIVPNGETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1125

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/725 (43%), Positives = 440/725 (60%), Gaps = 65/725 (8%)

Query: 210 YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSV 269
           + ++Y++LPKGDD Y TRSLLFEN+N S+DL++F+ K+  YG +ES+Y+    + +  + 
Sbjct: 215 FVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFK--DRNDKTK 272

Query: 270 KSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYL----QNNINKGNGK 325
            S+LLSF SR ICLD YNSVLQ+L+E+KT L S++L +SFVSL Y     +N +++ +  
Sbjct: 273 HSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDN- 331

Query: 326 ISVESQKNETD--------------------FELTSLIQYQVANFGATRSLCIEFDKRVD 365
            S  +  NETD                      + + +QY + N GATRS+ +E D   D
Sbjct: 332 -SSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390

Query: 366 KIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYI 425
           K    ++  L FLS   N+RY++ES+Y++N       FP +Y IL+FLNISM +EVL Y+
Sbjct: 391 KTK-LLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYV 449

Query: 426 RSKNLSKT-IKNCLYVSFDRTKHA------VSNSNRQS-LSKKGTSDTLNTYTLESPINH 477
           R+   +++  + C +VS             V+ SN  + ++  G++       L    + 
Sbjct: 450 RNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSK 509

Query: 478 NTEVD-MNDIPS-IYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSI 535
           N  +  +N + S I  + EI+    LS     +HT  + +  Y  P     ++HL N S+
Sbjct: 510 NASLSSLNSVGSYISLDQEIDF---LSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASV 566

Query: 536 -----------SRDPMIYANPIYQSPPSGYMENM----WTTTPFLSSHIVHEE---YAND 577
                      S  P     P   SP  G    +       TP LSS ++  +     N 
Sbjct: 567 LEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNS 626

Query: 578 RVDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDIC 637
            +        N+    P+ Q+LQ QFATSAE+A+ MGGG+GNRT++IGNI+PRSK EDIC
Sbjct: 627 GIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDIC 686

Query: 638 NVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPL 697
           NV RGGI+Q ++++++K+ICFV FI+   A QFY N+FIDPI+LH N LK+GWG H GPL
Sbjct: 687 NVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPL 746

Query: 698 PKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEM 757
           PK++ LAVT GASRNVYVSLP+FAFKDKYINDP Y+ Y ++Y LP+E+QLR DF++FG++
Sbjct: 747 PKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDI 806

Query: 758 EQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXX 817
           EQINFL D HCCW+NF NI SAIKLVE +K  D   FH+ + NRY+GLIIGYGKDRCG  
Sbjct: 807 EQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNV 866

Query: 818 XXXXXXXXXXRYFRKVKKPSYNIRLQQLEEERKRNDEI-----KQIDNKRINLDSLGITT 872
                     R+++KVKKPSYNIRL ++EEERK+++E      +  D K +   SLGI  
Sbjct: 867 NKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHL 926

Query: 873 SPNQN 877
             N N
Sbjct: 927 EGNDN 931

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 4/71 (5%)

Query: 966  SHDYHRTHNTRVDNPRSERTR---KRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNAS 1022
            SH+     ++ V N R ++ +   KR + K IPGSDVM+QYLAQ+QHSTFMYAAN+L A+
Sbjct: 1186 SHNSGDRMSSHVGNSRGQQGKGRNKRRNAKAIPGSDVMAQYLAQLQHSTFMYAANILGAT 1245

Query: 1023 IE-EPEFYDEN 1032
             E + ++Y++N
Sbjct: 1246 AEGDVDYYEDN 1256

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1063 (36%), Positives = 549/1063 (51%), Gaps = 143/1063 (13%)

Query: 55   YNFQNRGYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPYHSQQXXXXXXXXXXFDY 114
            +N    GY  GT      S    LSQ   P   +++Q  + P +S            FD 
Sbjct: 47   FNQNTHGYPQGT-----VSKQAPLSQQSHPFPQNFAQ--NFPPNSPMTNGMPTP---FDT 96

Query: 115  AYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLV 174
            AYG TLLPSH+LM SPFVSTPN    ++ A         R+ S+  +             
Sbjct: 97   AYGATLLPSHLLMGSPFVSTPNLPQTNYTA--------QRKGSHTGM------------- 135

Query: 175  GDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLFENI 234
               +    S NY + D         ++      I ++ISY+ILPKGDD Y TRSLL  NI
Sbjct: 136  ---ANGTGSMNYYRTDP--------QIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNI 184

Query: 235  NESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLS 294
            ++ +DLHTF+ KFV    +ESVY+  + E  Q      LLSF S  ICL+FYN+VLQ+L 
Sbjct: 185  DDMVDLHTFVSKFVQNNSVESVYI--TKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLK 242

Query: 295  EYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATR 354
            E+K QL + +L+LSFVS+   +    K  GKI      ++ D  + +L     A  GATR
Sbjct: 243  EFKEQLKASSLELSFVSM---RQRPTKVEGKIYRRFAADDGD-GMANLHFDMAAQTGATR 298

Query: 355  SLCIEF-DKRVDKI-DDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSF 412
            S+ IEF DK V    D+ +   L FLS   N RYI+E + +         F  +Y I++F
Sbjct: 299  SIAIEFVDKDVILTRDELLNKKLKFLSE-GNNRYILEHIAVFKTQHGTKVFGKNYAIITF 357

Query: 413  LNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLE 472
            L+I M +E++ Y++       +    YV   +  H    S   S  K   +DT +     
Sbjct: 358  LSIPMAMEIMDYLKLNIKQLHLTKFFYV---QVTHPPQQSPAASQKKPHANDTESNRDTS 414

Query: 473  SPINHNTEVDMNDIPS------------IYDENEIE-IANKLSELEIQTHTFNLDISNYS 519
             P   N++ D    P+                ++++ + NKL  +E+Q  T  L + +Y 
Sbjct: 415  PP---NSKKDQEFFPNNSMLSLVSSESSTSLADDVDGLVNKLKSIELQESTLKLRVEDYP 471

Query: 520  NPHIEIRAEH-------LP------------NVSISRDPMIYANPIYQSPPSGYME---N 557
             P  E  +EH       LP            ++S  R    + N I  SPP+ ++    N
Sbjct: 472  EPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDI-GSPPASFLPLDLN 530

Query: 558  MWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQL----------YNVPLPQTLQSQFATSA 607
               + P L    +    +        + + N            +  P+  +L+SQ  TS 
Sbjct: 531  HSNSVPNLPPGFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGKFAHPITDSLESQMKTST 590

Query: 608  EMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAA 667
            ++A+ MG    NRTI+IGNINPRS+ EDICNV RGGI+Q +K+I  K+ICF+ FI+  AA
Sbjct: 591  QVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAA 650

Query: 668  AQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYI 727
             QFYAN+FIDPI+LH NTLK+GWG + GPLPK I LAVT GASRNVY+SLPE AFKDKYI
Sbjct: 651  VQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYI 710

Query: 728  NDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVK 787
             DP +K YH  + LP+++ LR+DF  +G +EQIN L D HCCW+NF NI SAI+LVE   
Sbjct: 711  KDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAS 770

Query: 788  NEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQLEE 847
             +  ++F++ + +RY+GL+I YGKDRCG            +Y +KVKK + ++RL QLEE
Sbjct: 771  TK-QDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEE 829

Query: 848  ERKRND-EIKQIDNKRI----NLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGFKNSEN 902
            +R+  D E +++ N  I      D+  I T   +   E    SL    +  ++    S  
Sbjct: 830  KRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASPISPV 889

Query: 903  ESDIDDSA-----------------SNSSTDVELIINSPGNGFKSHRNRKPKPNNLD-LG 944
              D++D                   S SS+D+ELIIN P +  +S    +  P+ L    
Sbjct: 890  MGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPS 949

Query: 945  ERPKVDAI--VFKADGPMAPNKLSHDYHRT--HNTRV---DNP-----RSERTRKRTH-- 990
            ++ K+ A+  V     P+AP+ +S  Y     HN  V   D+P     ++E  R R    
Sbjct: 950  DKRKLVALHEVSSPPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRHRQQLP 1009

Query: 991  --KKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDE 1031
               + IPGSDVM+QYLAQ+QHSTFMYAANVL AS E  E YD+
Sbjct: 1010 RNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1083 (36%), Positives = 576/1083 (53%), Gaps = 185/1083 (17%)

Query: 112  FDYAYGTTLLPSHILMNSPFVST--------PNKSYLSFQASPSRGIS----YNRRNSNQ 159
            FD AYG +LLPSH+LM SPFVS+        P +S    + + SR +S    YN  +SN 
Sbjct: 68   FDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVSNQNGYNGNSSNH 127

Query: 160  ------MVFPN---PPIITSPHLVGDKSERAKSDNYEKVDTLDD------------EKRN 198
                  M+ P+        S     + +     +N +  DT +             ++ N
Sbjct: 128  NHSGNGMMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSRSNIFDEIN 187

Query: 199  REVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYV 258
             E+  +     ++I+Y+ILP GDD Y TRSLL EN++ S DLH+ ++ FV +  +ES Y 
Sbjct: 188  PEILLQR---PFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYF 244

Query: 259  VPS-----YETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLC 313
            V +      E  +    S+L+SF +RS CL+FYN++LQ+LSE+K  L S++L L FV L 
Sbjct: 245  VDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLN 304

Query: 314  YLQNNIN---KGNGKISVESQKNETD--FELTSLIQYQVANFGATRSLCIEFDKRVDKID 368
            Y    ++   +G     V+ Q +  +    +++ + + V N  ATRS+ IEF   ++K +
Sbjct: 305  YESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTE 364

Query: 369  DFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSK 428
             F    L FL  + NKRYI+ES+ +VN +   N+FP +Y +L+FLNI M +EVL Y++  
Sbjct: 365  LF-RKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKF 423

Query: 429  NLSKTIKNCLYVSFDRTKHAVSNSNRQSLS----KKGTSDTL------------------ 466
            + S  I  C YVS   T   VS S R S++     K T+  L                  
Sbjct: 424  SKSLEISKCFYVSL--TPLMVS-STRSSVANIYESKTTTRRLSVPSVPAGIKNDNNNNSN 480

Query: 467  -----------NTYTLESPINHNTEVDMNDIPSIYDENE-IEI-ANKLSELEIQTHTFNL 513
                       N  ++ S I  N+ + +  + S    NE I++   KL  +E+   +  +
Sbjct: 481  KGNISSINAQNNNSSIGSSIYGNSNISLTSLSSSVSLNEEIDLLTTKLQGIELDGTSLEI 540

Query: 514  DISNYSNPHIEIRAEHLPNVSISR-------------DPM-----IYANPIYQSPPSGYM 555
               +YS P I   + HL N+ IS+              P+     ++ N   QS  +   
Sbjct: 541  TSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVIP 600

Query: 556  ENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGG 615
            + +      LSS++      N RV  N            + Q+L+  F  SA++AS MG 
Sbjct: 601  QQLIAAPSPLSSNL----QINQRVLPNA-----------ITQSLEQNFNVSAKVASSMGS 645

Query: 616  GVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSF 675
             VGNRTI+IGNINPRS+ EDICNV RGGI+Q +KYI EK I FV FI+  +A QFYANSF
Sbjct: 646  DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705

Query: 676  IDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEY 735
            IDPI+LH N L++GWG + GPLPK+I LAVT GASRNVYVSLPEFAFK+K+I+DP YK+ 
Sbjct: 706  IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765

Query: 736  HNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNED----- 790
            H    LP  +QLREDFS +G++EQIN+L D HCCWINF NI SAI LVE +  E      
Sbjct: 766  HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825

Query: 791  ------NNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNIRLQQ 844
                       E++  RYKGL+I YGKDRCG            R+++KVK+PSYNIRL +
Sbjct: 826  GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSK 885

Query: 845  LEEERKRND-EIKQIDNKRINLDSLGITTSPNQN--IQEDETLSLAKLKLTSDTGFKN-S 900
            LEE R++N+ + K+  +K +NL+SLGI+  P+++  I   ET ++   ++ S+   +N +
Sbjct: 886  LEERRRQNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVN 945

Query: 901  ENES-------------DIDDSASNSS----------------TDVELIINSPGN---GF 928
            +NE+             D+  + S+ +                +D+E+I++SP +     
Sbjct: 946  DNETTGLGGLGLGVANCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYAL 1005

Query: 929  KSHRNRKPKPNNLDLGERPKVD------------AIVFKADGPMAPNKLSHDYHRTHNTR 976
            KS   R      ++     KV+                +   P AP+ LS+D+ +   T 
Sbjct: 1006 KSQTLRSSSQTVINSKRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETS 1065

Query: 977  VDNPRSE-----RTRKRT---HKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEF 1028
              + R+      R RKR      + IPGSDVM+QYLAQVQHSTFMYAAN+L AS E+  +
Sbjct: 1066 FQDSRNAETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAY 1125

Query: 1029 YDE 1031
             +E
Sbjct: 1126 SEE 1128

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  543 bits (1398), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 383/1083 (35%), Positives = 536/1083 (49%), Gaps = 240/1083 (22%)

Query: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSP 171
            FD +YG TLLPSH+LM SPF+STP  +  +   + SRG++ +++      + N       
Sbjct: 71   FDTSYGATLLPSHLLMGSPFISTPQNA--AMMHAGSRGLNSSQQQFYHYTYSNN------ 122

Query: 172  HLVGDKSERAKSDNYEKVDTLDDE---------------------KRN----REVFEEES 206
               G     +K +N +K    +                       KR      E   + S
Sbjct: 123  ---GKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPS 179

Query: 207  AIAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQ 266
            +  Y I+++ILPKGDD Y TRSLL  N+N SI LH FI KFV +G IESVYVVP  E  +
Sbjct: 180  SEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEE 239

Query: 267  NSV-------------------KSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKL 307
                                  +SILLSF +++ CLDFYN+VLQKLS++K  LNS++L L
Sbjct: 240  EEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTL 299

Query: 308  SFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEFD-----K 362
            +FVSL                           +  I+  V   GATRS+ +EF      K
Sbjct: 300  NFVSLT--------------------------SEDIRDDVLRKGATRSIALEFKNSFTTK 333

Query: 363  RVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVL 422
            +++ I+         LS+ +N R+++E + IVN    +  F  HY I+ F++ISM +E  
Sbjct: 334  QLESIE--------ILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEAS 385

Query: 423  HYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTEVD 482
             Y+ + +    I    +V    T   ++ S+               Y   +P + +    
Sbjct: 386  SYLLNWDEKLGISRLFFV----TDSIINKSD---------------YFRSAPASQDASRS 426

Query: 483  MNDIPSIYDENEIEIANK-LSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPMI 541
                 S+  +  +E A K L  L ++  T ++    Y    IE    HL ++SIS+  + 
Sbjct: 427  -----SVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLS 481

Query: 542  YANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMK---------------HY 586
              N        G  +N+ T++P      +H+   + R D  ++               HY
Sbjct: 482  SNNNSSSVSLQG-NQNL-TSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHY 539

Query: 587  NNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQ 646
               +   P+ QTLQ Q  T+A++AS MGGG+GNRT+++GNINPRSK EDICNV RGGI+Q
Sbjct: 540  YMDVTK-PIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQ 598

Query: 647  QVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVT 706
             +K+   K++CFV FI+  AA QF+AN+ I+PI+LH N LK+GWG HPG L ++I LAVT
Sbjct: 599  HIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVT 658

Query: 707  AGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDK 766
             GASRNVYVSLPE+AFKDK+I DP ++E+  KY LPS++QLR+DFS FGE+EQIN+L D 
Sbjct: 659  IGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDG 718

Query: 767  HCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXX 826
            HCCW+NF NI SAIKLVE     DN  FH  Y++RYKGLIIGYGKDRCG           
Sbjct: 719  HCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKK 778

Query: 827  XRYFRKVKKPSYNIRL-------------------------------------------- 842
             R+F+KVKK SY IR+                                            
Sbjct: 779  SRFFKKVKKASYKIRMHKQNKAGGSNGQEPISSFQDNAFGICISPRGIESEEVEALPDVP 838

Query: 843  QQLEEERK-RNDEIKQIDNKRINLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGF---- 897
            Q +EEE+  +N+ + ++ N     + LGI  SP  N +  E        +  + GF    
Sbjct: 839  QNIEEEKNPQNNGLLKLANGNGIGEGLGIEFSPGLNKEGHEGDDKFDC-IQQENGFDGKD 897

Query: 898  -------------------KNSENESDIDDSASNSSTDVELIINSPGNGFKSHRN----- 933
                               + S  E D D  +  S T+       P N FK  ++     
Sbjct: 898  EDESYSSDSSDIDIIVSAPEQSSAEEDDDKRSVTSYTN-----GHPTNKFKKEKSRTKLK 952

Query: 934  RKPKPNNLDL----GERPKVDAIVFKADGPMAPNKLSHDY----HRTHNTRVDNPRSERT 985
            R+P     DL    G    V +    A  P+AP+ +S  Y      ++N+  +N R + +
Sbjct: 953  RRPTSGLTDLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDAS 1012

Query: 986  RKR-------TH------KKIIPGSDVMSQYLAQVQHSTFMYAANVL---NASIEEPEFY 1029
            +KR       TH       K IPGS VM+QYLAQ+QHSTFMYAAN+L   N   E+   Y
Sbjct: 1013 KKRHGGGKGNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLY 1072

Query: 1030 DEN 1032
            DEN
Sbjct: 1073 DEN 1075

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  526 bits (1356), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 337/470 (71%), Gaps = 40/470 (8%)

Query: 602  QFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIF 661
            QFATSAE+A+ MGGG GNRT++IGNINPRSK EDICNV RGG +QQ+K+ +EK ICFV F
Sbjct: 563  QFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTF 622

Query: 662  IDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFA 721
            I+  +AAQFYANSFIDPIILHNNTL++GWGDH GPLPK+I LAVT GASRNVYVSLPE+A
Sbjct: 623  IEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYA 682

Query: 722  FKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIK 781
            FKDK+INDP YKEYHNKY+LP+E++LR+DFS FGEMEQ+NFL D HCCWINF NIRSAIK
Sbjct: 683  FKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIK 742

Query: 782  LVELVKNEDNN-NFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSYNI 840
            LVE V + +    FHERY NRYKGLIIGYGKDRCG            +++RKVKKPSYNI
Sbjct: 743  LVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802

Query: 841  RLQQLEEERKRNDEIKQIDNKRINLDSLGI---TTSPNQNIQEDETLSLAKLKLTSDTGF 897
            RLQQLEEERK+ +E  +I NK INL+S GI   T S N++ QE+  +SL  L ++     
Sbjct: 803  RLQQLEEERKQ-EEKNKISNKSINLNSFGIQVETPSQNESEQEEPKISLDGLGMSLSK-- 859

Query: 898  KNSENE--SDIDDSASNSSTDVELIINSP------GNGFKSHRNRK-PKPNNLDLGERPK 948
             NSEN    + DDS S+ STD+ELII+ P      GN  K   +RK    NNL+ G  P 
Sbjct: 860  PNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNHRKNDMNNNLNFGNPPP 919

Query: 949  VDAIVFKADGPMAPNKLSHDYHRT-----------------------HNTRVDNPRSERT 985
            V   + ++  P+AP  LS D+ ++                        NT   N   +R+
Sbjct: 920  VSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRS 979

Query: 986  RKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDENDID 1035
             K+ +KK++PGSDVMSQYLAQ+QHSTFMYAAN+L AS +EPEFYDEN I+
Sbjct: 980  SKK-NKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDENVIN 1028

 Score =  246 bits (628), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 170/444 (38%), Positives = 228/444 (51%), Gaps = 76/444 (17%)

Query: 75  HQGLSQLDS--PINSSYSQYESHP--YHSQQXXXXXXXXXXFDYAYGTTLLPSHILMNSP 130
           HQGL+  D+   IN   SQ  + P  Y++ Q          FD AYG +LLPSH+LM SP
Sbjct: 86  HQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPNAPPTP-FDSAYGASLLPSHLLMGSP 144

Query: 131 FVSTP--NKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSP----------------- 171
           FVSTP   +SY    A PS     N        +P PP I  P                 
Sbjct: 145 FVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNN 204

Query: 172 ------------HLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPK 219
                             S R  ++N  +    +  KR    F+E S   + ISY++LPK
Sbjct: 205 SSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKR----FQENSLNRFTISYKVLPK 260

Query: 220 GDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPS------------------ 261
           G+D Y TRSLLFEN+++S+DLH FI+KFVN+G IESVY++ S                  
Sbjct: 261 GNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDND 320

Query: 262 ------YETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYL 315
                    + +  +SILLSF SR ICLDFYNSVLQ+LSE+KTQLNS +L LSFV L Y 
Sbjct: 321 NNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKY- 379

Query: 316 QNNINKGNGKISVESQKNETDFE--LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIET 373
                    K        E+DF   L   ++Y +   GATRS+ +EF++ +   + F+ +
Sbjct: 380 ---------KNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNS 430

Query: 374 YLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKT 433
            L FL S  NKRYIIES+ I+N   +D   P + VIL+FLNISM ++V+  IR +     
Sbjct: 431 KLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSG 490

Query: 434 IKNCLYVSFDRTKHAVSNSNRQSL 457
           I  C++V+F++    V N  R SL
Sbjct: 491 ISKCVFVTFNKENPTVPNMKRLSL 514

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  522 bits (1345), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 358/998 (35%), Positives = 527/998 (52%), Gaps = 182/998 (18%)

Query: 127  MNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLVGDKSERAKSDNY 186
            M+SPF++TP   +    +SP R ++    N +   + +  +   P    D    ++  N 
Sbjct: 1    MSSPFLATPGVGH----SSPHRHVT----NKSSQAYKSTQLRMPP---SDAIRGSRRHNK 49

Query: 187  EKVDTLDDEKRNREVFEEESAIAYKISYQILPK---GD-DTYHTRSLLFENINESIDLHT 242
            EK   L DE   +        I YK+++ ILP+   GD D + TRSL F N+N  + LH 
Sbjct: 50   EK--HLYDEGTRQ--------IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHE 99

Query: 243  FIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNS 302
            F+  F  +  IESVYVV   +      +S+L+SF ++  CLDFYN +LQKLSE+K +L S
Sbjct: 100  FLATFHKFDRIESVYVVDREQ------QSVLVSFLTKETCLDFYNGILQKLSEFKKELRS 153

Query: 303  ENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEFDK 362
            + L LSF S                   QK E+   L   I+++V   GATRSL +EF  
Sbjct: 154  KELSLSFAS------------------PQKVESGPTLQE-IKFEVLRAGATRSLGLEFKD 194

Query: 363  RVD-----KIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISM 417
             +D     K  DF +        N+  RY+IES+  VN +     F ++Y I+ F++I+M
Sbjct: 195  EIDFASLLKKFDFFD--------NSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAM 246

Query: 418  VIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINH 477
             +E + Y++ +            SF  TK +  NS   S    G S+   T++       
Sbjct: 247  AVETMEYLKVQTPE---------SFGLTKVSYVNSTFTS----GKSE-FQTFS------- 285

Query: 478  NTEVDMNDIPSIYDENEIEIANKLSELEIQT-----------HTFNLDISNYSNPHIEIR 526
            N+E+         D+N++E+ + +S  E  T             F +  S Y  P +E  
Sbjct: 286  NSELS--------DQNDVEVQDSISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEH 337

Query: 527  AEHLPNVSISR--DPMIYANPIYQSPPSGYMENMWTT---TPFLSSHIVHEEYANDRV-D 580
             +H  +++IS+     +  N    S  S   + +  +    P   + IV    A  +   
Sbjct: 338  NQHCSHITISKALSSKVSRNGSSSSIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPT 397

Query: 581  YNMKHYNNQL-YNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNV 639
            Y +  Y+  +  + PL QTLQ Q+  +A++A+ MGGG GNRT++IGNI+PRSKTEDICNV
Sbjct: 398  YPVPGYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNV 457

Query: 640  TRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPK 699
             RGGI+Q VKYI  K+ICFV FI+  +A QF+ANS I+PI+LH + LK+GWG H G LP+
Sbjct: 458  VRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQ 517

Query: 700  AIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQ 759
            +I LAVT GASRNVYVSLPE+AFKDK+I DP Y+ +  K+ LPS+QQL +DFS FG++E 
Sbjct: 518  SISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIEL 577

Query: 760  INFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXX 819
            INFL+D HCCWINF NI +AIKLVE   N +N +FHE+++NRY+GL IGYGKDRCG    
Sbjct: 578  INFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNK 637

Query: 820  XXXXXXXXRYFRKVKKPSYNIRLQQLE----EERKRNDEIKQIDNKRINLDSLGITTSPN 875
                    +YF+KVKK SYNIRL++ +    E + ++ +  +   K++ +D+ GI+    
Sbjct: 638  NLVSNKNSKYFKKVKKASYNIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQ 697

Query: 876  ---------QNIQEDETLSLAK---------LKLTSDT---------GFKN-------SE 901
                     Q I+E+E L L+K         + ++ D          G KN         
Sbjct: 698  PDARYSDEEQKIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGS 757

Query: 902  NESDIDDSASNSSTDVELIINSPGNGFKSHRNRKPKPNNLDLGE-------RPKVDAIVF 954
            +E DI  SA  S+   +L    P     +  N K K  +  + +        P+V     
Sbjct: 758  SEVDILVSAPGSANTSQLEGGGPTQRTTAASNGK-KERSSGVSKLHCFSEIAPRVSKASL 816

Query: 955  KADGPMAPNKLS-----------------HDYHRTHNTRVD------NPRSERTRKRTHK 991
             A  P+AP  L+                 HD +    ++ D        +S ++R+R + 
Sbjct: 817  DAVPPLAPAALNCHYNSAPRRSARKNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQR-NA 875

Query: 992  KIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFY 1029
            + IPGS+VM+QYLAQ+QHSTFMYAA++L   +++P  +
Sbjct: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILG--VDDPNLH 911

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  463 bits (1191), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 292/828 (35%), Positives = 427/828 (51%), Gaps = 130/828 (15%)

Query: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSP 171
           FD  YG +LLPSH+LM SPFVSTP +    F  S S   S++  + + + +P PPI+   
Sbjct: 87  FDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSAS---SHSNHSRSFLYYPQPPILKP- 142

Query: 172 HLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLF 231
                                    R R+ F    +  Y+++++ILPKG D Y TRSLLF
Sbjct: 143 ----------------------IPPRRRKSFSLNHSEPYQVNFKILPKGKDEYMTRSLLF 180

Query: 232 ENI--NESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSV 289
            N+   E+ D+H F+  F+ +G IES+Y++       +   SILLSF +++ CLDFYN++
Sbjct: 181 SNLERQENFDIHNFLTNFIKFGPIESIYLL-------DDSHSILLSFLTKATCLDFYNNL 233

Query: 290 LQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVAN 349
           LQ+ SE+K++L+S  L +SFV                     ++ET++    L+Q  V  
Sbjct: 234 LQRFSEFKSKLHSTKLSVSFVC--------------------QDETNW--FRLLQMNVVT 271

Query: 350 FGATRSLCIEF-DKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNE-FPAHY 407
            G TRSLCIEF D+ ++   D I   +P+L    + R++IE + +VN     N+ F   Y
Sbjct: 272 RGVTRSLCIEFEDQSMELTSDLIHEKIPWLF--FSHRFVIERIDLVNAAAPKNQNFNNRY 329

Query: 408 VILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLN 467
           +++ F+ ISM +EV  Y++  +  K +         + +    N +   LS +      N
Sbjct: 330 LLIHFICISMALEVEEYLQQASQKKQL------GISKIQFVNVNGHSSDLSDEDAVAAAN 383

Query: 468 TYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRA 527
               ES     + V    +P     + +E+ + L +L +   +  +  S Y  P IE   
Sbjct: 384 GLQRES---RTSSVSSISLPISNSSDLVELFHSL-DLALGIISLQVIPSEYPVPLIESHD 439

Query: 528 EHLPNVSISR------------------------------------DPMIYANPIYQSP- 550
           +HL +V+ISR                                    DP    N     P 
Sbjct: 440 DHLHSVTISRPSKTLTSSTSLVEMDGGPNGGTPNGSNAMQGVLLLSDPSSDGNTPSMLPN 499

Query: 551 ---------PSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQS 601
                    P      +  T+  LS H       ND       ++ + +   P+ Q LQ 
Sbjct: 500 ELNINTSLMPGPMGGQVLGTSQSLSLH-----NPNDNGGAGPSYFMDPMSGAPINQALQR 554

Query: 602 QFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIF 661
           Q+ T         GG  NRT++IGNI+PRSK EDICNV RGGI+Q +K+I  K ICFV F
Sbjct: 555 QYLTGTGQV----GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTF 610

Query: 662 IDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFA 721
           I+  AA QFYAN+ ++PI+LH N L++GWG   G LPK I LAVT GASRNVYVSLPE++
Sbjct: 611 IEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYS 670

Query: 722 FKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIK 781
           FK+KYIN+P +KEYH KY LPSE+QLR+DF+K+G++EQIN+L D HCCW+NF NI  AI+
Sbjct: 671 FKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIR 730

Query: 782 LVELVKNEDNNN---FHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVKKPSY 838
           LVE   +    N   FH ++  RYK LIIGYGKDRCG            R+F+K+KK + 
Sbjct: 731 LVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNC 790

Query: 839 NIRLQQLEEERKRNDEIKQIDNKRINLDSLGITTSPNQNIQEDETLSL 886
             +  + ++ ++        D ++ +  +  +  S  + +  DE L L
Sbjct: 791 TTKPNKRQQSKRGTSSASSDDARKDDASTEKVPVSSKEPVC-DEILGL 837

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 992  KIIPGSDVMSQYLAQVQHSTFMYAANVLNA-SIEEP-EFYDEN 1032
            K I G DVMSQYL Q+ HSTF+Y+ N+L A ++ +P  FYD N
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVN 1063

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  416 bits (1069), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/497 (47%), Positives = 306/497 (61%), Gaps = 59/497 (11%)

Query: 594  PLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIRE 653
            P+ +TL+ +F TSA++AS MG  +GNRTI+IGN+NPRSK ED+CNV RGGI+Q +K I  
Sbjct: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761

Query: 654  KNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNV 713
            K ICFV FI+  AA QFYANSFIDP+ILH NTLKIGWG++  PL K+I LAVT GASRNV
Sbjct: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821

Query: 714  YVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINF 773
            YVSLPEFAFKDK++NDP YKE+H KY LPSEQQLR DF+K+G +EQIN+L D HCCW+NF
Sbjct: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881

Query: 774  TNIRSAIKLVELVKNE-DNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRK 832
             NI SAIKLVE V N   +N F +++ +RY GLII YGKDRCG            R++RK
Sbjct: 882  MNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRK 941

Query: 833  VKKPSYNIRLQQLEEERKRNDEI-KQI-----DNKRINLDSLGI----TTSPNQN----- 877
            VKK S N +L+QL+E+R+   E  K++     DNK  +LD+LGI    T  P +      
Sbjct: 942  VKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPES 1001

Query: 878  ----------IQEDETLSLAKL--KLTSDTGFKNSEN---------ESDI----DDSASN 912
                      + E +T +   L  ++ S+T   + E          E D+    DD +S 
Sbjct: 1002 NEDDANYDSAVTESDTNTFNALGFRIQSNTDSHDDEQNDEKGEEQEEVDVIAHADDISSV 1061

Query: 913  SSTDVELIINSPGN----GFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPMAP---NKL 965
            +S+DVE+II+ P N         + +  + N   +    K    +F       P   NKL
Sbjct: 1062 NSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKIDRLAKARNAMFPEHRETIPDINNKL 1121

Query: 966  SHDYHRTHNTRV---------DNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAA 1016
             HD       R           +P    T K+  +++IPG+DVM+QYL Q+QHSTFMYAA
Sbjct: 1122 FHDRKNKDKNRRKQVQGGIQDQDPHLSSTGKQ--QRVIPGADVMAQYLTQLQHSTFMYAA 1179

Query: 1017 NVLNASIEEPEFYDEND 1033
            N+L  S E+  +YDE D
Sbjct: 1180 NILGVSAEDNTYYDEED 1196

 Score =  192 bits (488), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 160/524 (30%), Positives = 246/524 (46%), Gaps = 120/524 (22%)

Query: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLS-------FQASPSRGISYNRRNSNQM-VFP 163
           FD AYG TLLPSH+LM SP+VSTPN    S       F  S S   + NR++ +Q+    
Sbjct: 87  FDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSML 146

Query: 164 NPPIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDT 223
           N P   S       + R +++   ++  +D      E+F++     + ISY++LP GDD 
Sbjct: 147 NQPSSRSNFFTDSYNNRYQNNPQTRIPEVDP----NELFQK----PFVISYKLLPTGDDA 198

Query: 224 YHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQN-------SVKSILLSF 276
           Y TRSLLF N+  SIDLH+FI  FV Y  IES+Y++ + +  ++       + +SILLSF
Sbjct: 199 YRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTDDEKDQDNENDKNKRSILLSF 258

Query: 277 TSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISV----ESQK 332
            SR ICL FYN+VLQ+L+E+KT L S++L L+FV L YL+   +     IS     + Q+
Sbjct: 259 LSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQE 318

Query: 333 NETD-----------FELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSN 381
           NE D               + +++ + N  ATR + IE   + DK +  +  +L FL  N
Sbjct: 319 NENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTKCDK-ETLLNKHLSFLIDN 377

Query: 382 A-NKRYIIESL----YIVNNNGKDNE---------------------------------F 403
             N RYI+ES+     I N N  +N+                                 F
Sbjct: 378 KKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTF 437

Query: 404 PAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDR------------------- 444
           P HY +LSF+NI M +E+  Y++   L   I N  YV                       
Sbjct: 438 PNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHVKKSLNSSSKRSSVTSTTD 497

Query: 445 --------TKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIYD----E 492
                   T  +V   +++S   K  ++ L++ T+ SP             + Y+     
Sbjct: 498 NKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSP------------DTTYEGEDDI 545

Query: 493 NEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSIS 536
           +   I +KL +L+++     LDI+ Y+ P  +    H+ N+++S
Sbjct: 546 DIDIIISKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLS 589

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  404 bits (1039), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 277/820 (33%), Positives = 409/820 (49%), Gaps = 167/820 (20%)

Query: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGIS------YNRRNSNQMVFPNP 165
           FD  YG TLLPSH+L+ SPFV+TP         + + G+        N RNS+   F  P
Sbjct: 73  FDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSFYPP 132

Query: 166 PIITSPHLVG-----------DKSERAKSDNYEKVDTLDDEKRN---------------- 198
                P   G            + +R  S +  KV+   D +R                 
Sbjct: 133 APKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVERGYSSRSASRSQSFSAST 192

Query: 199 -------------REVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIE 245
                        R+  + E  I ++  Y ILPKG+DTY +RSLLF N+N  +D+  F++
Sbjct: 193 SGSMSGSSGPKSIRKTIDSELKIQFQ--YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQ 250

Query: 246 KFVNYGLIESVYVVPSYETHQN-------------------------------------- 267
           K      IES+Y++   +T  +                                      
Sbjct: 251 KVAKNYPIESIYLIKDEDTGDDIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPA 310

Query: 268 ------------SVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYL 315
                       S +S LLSF ++  CLDFYN++LQ+ +E K  + S+ L ++FV +   
Sbjct: 311 LTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKI--- 367

Query: 316 QNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF-DKRVDKIDDFIETY 374
                             + D E  + ++  V + GATRSL +EF D  V    D I   
Sbjct: 368 ------------------QDDEEWMANLKMNVISLGATRSLYVEFADDSV--TSDTIWDT 407

Query: 375 LPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTI 434
           LPFL ++   +Y++  + +V  + +   F  HY +L FL+++M +EV   + + + + + 
Sbjct: 408 LPFLKNSG--KYVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKELLETGDEAVS- 464

Query: 435 KNCLYVSFDRTKHAVSNSNRQ------SLSKKGTSDTLNT--------YTLESPINHNTE 480
                VSF    ++     R+      SL ++ +    +T          +  P++    
Sbjct: 465 ----RVSFVTPANSADKEMRRRRSSAISLKQEASPQMFSTDSRSRSRSSNVSLPLSEQVS 520

Query: 481 VDMNDIPS-IYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDP 539
               DI + IY+E          +  +   T  +D+S Y  P +     HL + SIS+  
Sbjct: 521 TASTDISTPIYEE---------FDGNLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISKPT 571

Query: 540 MIYANPIYQSPPSGYMENMWT--TTPF-LSSH-IVHEEYANDRVDYNMKHYNNQLYNVPL 595
            +Y   +++S  + +  +  +    P  +SSH  V ++   +   Y M+     L    +
Sbjct: 572 TLY---MHESGTTNFSSSNLSDDIDPLSISSHDPVPQQMLLNEYPYIME----PLMPPQI 624

Query: 596 PQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKN 655
            QT+Q+Q++ S +    +  G+ +RT++IGNINPRSK EDICNV RGGI+Q +K++  K 
Sbjct: 625 TQTIQNQYSKSIQA---VNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKR 681

Query: 656 ICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYV 715
           ICFV FI+  AA QFYAN+ ++PIILH N LK+GWG +PGPLPK I LAVT GASRNVYV
Sbjct: 682 ICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYV 741

Query: 716 SLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTN 775
           SLP+ AFKDK+INDP +KEY N+Y +P+  QL+ DF  +G MEQ+NF  D HCCWINF N
Sbjct: 742 SLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMN 801

Query: 776 IRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCG 815
           I SAIKLVE   +  +N FH++ + RY GLIIGYGKDRCG
Sbjct: 802 ISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCG 841

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 14/80 (17%)

Query: 959  PMAPNKLSHDY-----HRTHNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFM 1013
            P  P++ S+ +     H   N    NPR      ++  K I GSDVM++YL Q+ H+TF+
Sbjct: 1080 PQTPHRFSNSFVPVAQHEGANN--GNPR------KSSMKPIAGSDVMTRYLEQLHHNTFV 1131

Query: 1014 YAANVLNASIEEPEFYDEND 1033
            YAAN+L A+ ++P FYDE++
Sbjct: 1132 YAANILGAT-QDPVFYDEDN 1150

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  375 bits (963), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 219/288 (76%), Gaps = 11/288 (3%)

Query: 595  LPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREK 654
            L QTL++ F TS E+++ +GGG GNRT++IGNINPRSK ED+CNV RGGI+Q++ ++R+K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 655  NICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVY 714
            +ICFV FI+   AAQF+AN++IDPI+LH N LK+GWG+H GPLPK+I LAVT GA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 715  VSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFT 774
            VSLPEFAFKDK+IN+P+Y++YH  Y LP+E QLR+DFS++GE+EQIN+L D HCCWINF 
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 775  NIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGXXXXXXXXXXXXRYFRKVK 834
            NI SAI LVE V  +D   FH ++  RY GLIIGYGKDRCG            ++F+KVK
Sbjct: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVK 1040

Query: 835  KPSYNIRLQQLEEERKRNDE-----------IKQIDNKRINLDSLGIT 871
            KP+Y I+L+++EEER+  +E             QI    +NL+SLGIT
Sbjct: 1041 KPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGIT 1088

 Score =  170 bits (430), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 151/445 (33%), Positives = 208/445 (46%), Gaps = 118/445 (26%)

Query: 112 FDYAYGTTLLPSHILMNSPFVSTPN-----KSYLSFQASPSRGISYNRRNSNQM------ 160
           FD +YG TLLPSH+LM SPFVSTPN      S  S  ++P+R  S++R+NSN        
Sbjct: 109 FDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK-SFSRKNSNSNSISNSN 167

Query: 161 ----------------------VFPNPP--------------------IITSPHLVGDKS 178
                                 +  NPP                    II    L  D S
Sbjct: 168 SSSMSNLNLNSKYDNYPIPPVPILKNPPLNNQNIRNSRNNSNRIRNNHIINRKLLKDDNS 227

Query: 179 ERAKSDNYEKVDTLDDEKRNREVFE--EESAIAYKISYQILPKGDDTYHTRSLLFENINE 236
            R     +++   + ++ +   V +  +   I   +SY+ILPKG D + TRSLL ENIN+
Sbjct: 228 YRISQQTFKENPMIIEKPKYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQ 287

Query: 237 SIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEY 296
           SID  T ++ F+N+G IESVY++      +    SILLSF SR ICLDFYN+VLQ+L E+
Sbjct: 288 SIDTRTLVKNFINFGPIESVYLIKLNPGSK--YNSILLSFVSREICLDFYNNVLQRLMEF 345

Query: 297 KTQLNSENLKLSFVSLCYLQNNIN-------KGNGKISVESQK----------------- 332
           KT+L+S++L LSFV L Y   + N         NG  S  S K                 
Sbjct: 346 KTELSSKSLTLSFVILKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEET 405

Query: 333 --------------NETDFELT--SLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLP 376
                         N+ +F LT  S +Q  +   GATRSL ++F+  V K     E    
Sbjct: 406 DGEEIVIEDIRNDLNKENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNL 465

Query: 377 FLSSNANKRYIIESLYIV----------NNNGKDNE----------FPAHYVILSFLNIS 416
           F+++N N RYI+ES+ +V          N  G DNE          F  +Y +L+F NI 
Sbjct: 466 FINNNLNNRYILESISLVNIENNTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNIL 525

Query: 417 MVIEVLHYIRSKNLSKTIKNCLYVS 441
           M IE   Y ++K     I +C +VS
Sbjct: 526 MAIEAFDYFKAKLNELNIFDCFFVS 550

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)

Query: 980  PRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEE 1025
            PR+ + + R  +K IPGSDVMSQYL Q+QHSTFMYAAN+L  S E+
Sbjct: 1305 PRN-KNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  350 bits (899), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/521 (38%), Positives = 294/521 (56%), Gaps = 80/521 (15%)

Query: 585  HYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGI 644
            ++ + +   P+ QTLQ Q+   A  A+    G+ NRT++IGNI+PRSK EDICNV RGGI
Sbjct: 525  YFMDPMVGAPIGQTLQRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGI 580

Query: 645  IQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELA 704
            +Q +K+I  K ICFV FI+  AA QFYAN+ ++PI+LH N L++GWG   G LPK I LA
Sbjct: 581  LQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALA 640

Query: 705  VTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLK 764
            VT GASRNVYVSLPE++FK+KYIN+P +K YH KY LP+E+QLR+DF+K+G++EQIN+L+
Sbjct: 641  VTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLE 700

Query: 765  DKHCCWINFTNIRSAIKLVELVKNEDNNN---FHERYKNRYKGLIIGYGKDRCGXXXXXX 821
            D HCCW+NF NI  AI+LVE   +    N   FH ++  RYK LIIGYGKDRCG      
Sbjct: 701  DGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNL 760

Query: 822  XXXXXXRYFRKVKKPSYNIRLQQLEEERKRNDEIKQIDNKRIN--LDSLGITTSPNQNIQ 879
                  R+++K+KK SY+++  Q ++ RK +  +   D  + N  L  + + +S N  + 
Sbjct: 761  AANKNSRFYKKIKKQSYSMK--QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNGGVG 818

Query: 880  EDETL------------SLAKLKLTSDTGFKNSENES---------DIDDSASNSSTDVE 918
            E ++L            SL   +++ DTG  +  ++          D    +++ S+D++
Sbjct: 819  ESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSDGVEEGDECDDDDAGYSTSGSSDID 878

Query: 919  LIINSPGNGFK-----------------SHRNRKPKP-------NNLDLGERPKV-DAIV 953
            +I+ +P + FK                 + RN+               LG       A  
Sbjct: 879  IIV-APPDEFKRRESGTSSGKHKKKSKSTRRNQHSNAASSASYNQQYSLGSLDHTSSAGS 937

Query: 954  FKADGPMAPNKLS---------HDYHRTHNTRVD----------NPRSERTRKRTHKKII 994
              A  P+AP+ +          H   R+ ++             N +S R R+    K I
Sbjct: 938  LDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYNSQTPTNANYKSRRRRQAKFSKPI 997

Query: 995  PGSDVMSQYLAQVQHSTFMYAANVLNA-SIEEP--EFYDEN 1032
             G DVMSQYL Q+ HSTF+YA N+L A +++EP   +YD N
Sbjct: 998  AGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038

 Score =  166 bits (419), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 125/436 (28%), Positives = 216/436 (49%), Gaps = 76/436 (17%)

Query: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQ-----MVFPNPP 166
           FD  YG +LLPSH+LM SPF+STP +    F  S     S++  ++       + +P PP
Sbjct: 64  FDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHSSHSLHHAQSARSSFLYYPQPP 123

Query: 167 IITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHT 226
           ++     +  + +++ + N+ +                     Y I+++ILPKG D Y T
Sbjct: 124 MLKP---IPPRRKKSVTLNHSE--------------------PYHINFKILPKGKDEYMT 160

Query: 227 RSLLFENIN--ESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLD 284
           RSLL  N+     +D+H F+  FV +G +ES+Y++       +   SILLSF +++ CLD
Sbjct: 161 RSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM-------DDNHSILLSFLTKATCLD 213

Query: 285 FYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQ 344
           FYN++LQ+ SE+KT+L+S  L +SFV  C                 Q   + F+    +Q
Sbjct: 214 FYNNLLQRFSEFKTKLHSPKLSVSFV--C-----------------QDESSWFKY---LQ 251

Query: 345 YQVANFGATRSLCIEFDKRVDKI-DDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEF 403
             V   GATRSL +EF+  V ++ +DF+    P+L    ++R+++E + ++N    +  F
Sbjct: 252 MNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLF--CSQRFVLERIDLINATTVNQHF 309

Query: 404 PAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTS 463
              Y+IL F++ISM +EV  +++  +  + +      +  R +    N +   LS +  +
Sbjct: 310 GTRYMILHFISISMALEVDDFLQQPSQKRQL------NISRIQFVNVNGHHSKLSDEEAA 363

Query: 464 DTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDI--SNYSNP 521
              N       +  ++        S+   N  ++A     L++   T +L +  S Y  P
Sbjct: 364 AAANG------LQQDSRTSSVSSISLSISNTADLAALFHSLDLSLDTLSLQVVPSEYPTP 417

Query: 522 HIEIRAEHLPNVSISR 537
            IE  +EHL +++ISR
Sbjct: 418 LIEQHSEHLTSITISR 433

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  186 bits (472), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICN  RGG++Q VK + ++++CFV FIDP AAAQFYA S +
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +HN   KIGWG H G LP A+ LAV+ GASRN+YV   +F   D+           
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE----------- 506

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
               + +EQ LRE F +FGE+EQINFL +K+CC+INFTNI +AI  ++ +K         
Sbjct: 507 TGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCNP------ 560

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L + +GKDRCG
Sbjct: 561 ----YFKNLKVNFGKDRCG 575

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 114/202 (56%), Gaps = 24/202 (11%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GNI P    + + +  R G+I+++K + ++   F+ F+D  +A  F++++ +  
Sbjct: 160 SRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKR 219

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVTA-GASRNVYVSL----PEFAFKDKYINDPNYK 733
           + +    +K+GWG  P P+   +   + + GA+RNVY+      P+ A   ++  DPN +
Sbjct: 220 LNIEGRDIKVGWG-KPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNEE 276

Query: 734 EYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNN 793
                  + SE++LR+D + FGE+E I  ++DK   +++F++I SAIK+V  +      +
Sbjct: 277 -------IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLA-----S 324

Query: 794 FHERYKNRYKGLIIGYGKDRCG 815
            +  Y N+     I YGKDRC 
Sbjct: 325 VNPYYTNKK----IFYGKDRCA 342

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  182 bits (463), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN+    K E+ICN  RGG++Q +K + ++++CFV FIDP AAAQFYA S +
Sbjct: 339 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSL 398

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +HN   KIGWG H GPLP  + LAV+ GASRN+Y+   +FA  DK    P +    
Sbjct: 399 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIF---- 453

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +E  LR  F +FGE+EQINFL +++CC+INF NI SAI  ++ +K+        
Sbjct: 454 ------TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT----- 502

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 503 -----FKDLKINFGKDRCG 516

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 114/201 (56%), Gaps = 22/201 (10%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GN+ P   T+++ +  R G++++VK + EK   F+ F++  +A  F++++ +  
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVT-AGASRNVYVSLPEFAFKD---KYINDPNYKE 734
           + + +  +KIGWG  P  +   +   +T  GA+RNVY+       KD   ++  DPN + 
Sbjct: 162 LNIDDRDIKIGWG-KPTQIDPIVAAGITNDGATRNVYIGKLN-TNKDICAQWGVDPNEE- 218

Query: 735 YHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNF 794
                 + +E++LR D S FGE+E +  + +K   +++F++I +AIK+V  + N   N +
Sbjct: 219 ------VITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANI--NPY 270

Query: 795 HERYKNRYKGLIIGYGKDRCG 815
           + + K       I YGKDRC 
Sbjct: 271 YAQKK-------IFYGKDRCA 284

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  182 bits (462), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN+    K E+ICN  RGG++Q +K + ++++CFV FIDP AAAQFYA S +
Sbjct: 392 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 451

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +HN   KIGWG H GPLP  + LAV+ GASRN+Y+   +F   D+ +  P +    
Sbjct: 452 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF---- 506

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +E  LR  F +FGE+EQINFL +++CC+INF NI SAI  ++ +K+        
Sbjct: 507 ------TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT----- 555

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 556 -----FKDLKINFGKDRCG 569

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 111/206 (53%), Gaps = 32/206 (15%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GN+ P   T ++ +  R G+++ VK + EK   F+ F+D  +A  F++++ +  
Sbjct: 155 SRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKR 214

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVTA-----GASRNVYVSL----PEFAFKDKYIND 729
           + + +  +KIGWG      P  I+  V A     GA+RNVY+      P+     ++  D
Sbjct: 215 LNIDDRDIKIGWGK-----PTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGAD 267

Query: 730 PNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNE 789
           PN +         +E++LR D + FGE+E +  + +K   +++F++I SAIK+V  + N 
Sbjct: 268 PNEETI-------TEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANV 320

Query: 790 DNNNFHERYKNRYKGLIIGYGKDRCG 815
             N ++ + K       I YGKDRC 
Sbjct: 321 --NPYYAQKK-------IFYGKDRCA 337

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  181 bits (459), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 125/199 (62%), Gaps = 25/199 (12%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN+    K E+ICNV RGG++Q +K + ++  CF+ FIDP AAAQFYA S +
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +  N  K+GWG H GPL  A+ LA++ GASRN+Y+   +F  K++Y N        
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN-------- 464

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                  E+ LRE F +FGE+EQINFL++K CC++NFTNI  AI  ++ +K+        
Sbjct: 465 -------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLP------ 511

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                ++ L I +GKDRCG
Sbjct: 512 ----EFEDLKINFGKDRCG 526

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 104/198 (52%), Gaps = 30/198 (15%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           RT+++GNI      +++ +  R G+++ VK +  K   F+ FID + A  F++++ +  +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 680 ILHNNTLKIGWG--DHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHN 737
            +    +KIGWG  +H   +  A       GA+RNVY+         +  +DP       
Sbjct: 188 NIRGKDIKIGWGKSNHIDSIVAA--RITNDGATRNVYIG--------QLNDDPT------ 231

Query: 738 KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER 797
              + +EQ+L +D  KFGE++ I FL +K   +++F +I  AI +V     ++ +  +E+
Sbjct: 232 ---ITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVV-----QNLSKLNEK 283

Query: 798 YKNRYKGLIIGYGKDRCG 815
           YKN+     I YGKDRC 
Sbjct: 284 YKNKR----IFYGKDRCA 297

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  182 bits (463), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 137/220 (62%), Gaps = 22/220 (10%)

Query: 598 TLQSQFATSAEMASKMGG--GVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKN 655
           TL  Q A +A +A+  GG   +GNRT+++GN+    K ++ICN  RGG++Q +K + +++
Sbjct: 504 TLLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRH 563

Query: 656 ICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYV 715
           +CFV FIDP AAAQFYA S +  + +     K+GWG H GPLP  I LAV+ GASRNVY+
Sbjct: 564 VCFVTFIDPTAAAQFYAMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYL 623

Query: 716 SLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTN 775
              +F          N  + HN  I  +E  LR  F ++G++EQINFL +K+CC+INFTN
Sbjct: 624 GNIDFE---------NDIKLHNPPIF-TELSLRNIFQQYGDVEQINFLPEKNCCFINFTN 673

Query: 776 IRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCG 815
           I +AI  +E +KN  +          +K L I +GKDRCG
Sbjct: 674 ISNAILAIEKIKNNPD----------FKDLKINFGKDRCG 703

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 111/221 (50%), Gaps = 34/221 (15%)

Query: 615 GGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANS 674
           G   +RT+++GNI      +D+ +  R G+++ +K + +K   F+ F+D  +A  F++++
Sbjct: 263 GNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDA 322

Query: 675 FIDPIILHNNTLKIGWGDHPGPL-PKAIELAVTAGASRNVYVS----------------L 717
            +  + +    +KIGWG  P P+ P      VT GA+RNVY+                  
Sbjct: 323 ILKRLNIGGRDIKIGWG-KPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSST 381

Query: 718 PEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIR 777
              +  +   +D   K+  +   L +E++LRED   +GE++ +  ++DK   +++ ++I 
Sbjct: 382 SPSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSIL 440

Query: 778 SAIKLVELVKNEDNNNFHER---YKNRYKGLIIGYGKDRCG 815
           SAIK+V        NN  +    Y+N+     I YGKDRC 
Sbjct: 441 SAIKVV--------NNLAQTNPYYQNKR----IFYGKDRCA 469

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  177 bits (448), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 122/199 (61%), Gaps = 23/199 (11%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN++ R + E++CNV RGG++Q VK++ ++++CFV F DP AAAQFYA + +
Sbjct: 262 LGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASL 321

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +     KIGWG H GPLP  +  A++ GASRNVY       F +    DP   E+ 
Sbjct: 322 HGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFF 374

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                  E+ LR+  S FGEMEQ+N + ++ C ++NFTN+ SAI  VE VK         
Sbjct: 375 E------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWP------ 422

Query: 797 RYKNRYKGLIIGYGKDRCG 815
               +++ L + YGKDRCG
Sbjct: 423 ----QFQQLKVNYGKDRCG 437

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 31/198 (15%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GNI P     ++ +  + G+++  +    K+  FV F+D  +A  F++++ ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVS-LPEFAFKDKYINDPNYKEYHN 737
           + + +  +KIGW       P       + GA+RNVY+  LP+                  
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV---------------- 141

Query: 738 KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER 797
                S  +L +D S +GE++ +  L  K   +++  +I  AI  V  ++  DN  + +R
Sbjct: 142 -----SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQ-RDNKIYSDR 195

Query: 798 YKNRYKGLIIGYGKDRCG 815
                    + +GKDRC 
Sbjct: 196 R--------VSFGKDRCA 205

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  181 bits (458), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 128/199 (64%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICNV RGG++Q VK + ++ +CFV FIDP AAAQFYA S +
Sbjct: 445 LGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSL 504

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +     K+GWG H GPLP A+ LAV+ GASRNVY+      F+   + DP      
Sbjct: 505 HGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR----- 557

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
               + +E  LR+ F ++GE+EQINFL +K+CC+INFTNI +AI  ++ +K    +N H 
Sbjct: 558 ----IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIK----SNPH- 608

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                ++ L I +GKDRCG
Sbjct: 609 -----FEDLKINFGKDRCG 622

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 102/197 (51%), Gaps = 20/197 (10%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GNI      +++ +  R G+++ VK I EK   F+ F+D  +A  F++++ +  
Sbjct: 213 SRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKR 272

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNK 738
           + +    +KIGWG      P      +   A+RNV++        +K  ND   KE    
Sbjct: 273 LNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKEPI-- 325

Query: 739 YILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERY 798
               +E +LRED   FGE+E +  + +K   +++F++I SAIK V  +++   N ++E  
Sbjct: 326 ----TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSM--NPYYENK 379

Query: 799 KNRYKGLIIGYGKDRCG 815
           K       I YGKDRC 
Sbjct: 380 K-------IAYGKDRCA 389

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  181 bits (459), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 128/199 (64%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN+    + E+ICNV RGG++Q VK + ++ +CFV FIDP AAAQF+A S +
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +     K+GWG H GPL  A+ LAV+ GASRN+Y+   +FA  DK  ++P +    
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF---- 610

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +E  LR+ FS +GEMEQINFL +K+CC+INFTNI +AI  ++ +K+        
Sbjct: 611 ------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNP------ 658

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 659 ----VFKDLKINFGKDRCG 673

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 106/228 (46%), Gaps = 41/228 (17%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           RT+++GNI      +++ +  R G+I+ VK I EK   F+ F+D  +A  F++++ +  +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 680 ILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVS-LPEFAF---KDKYINDPNYKEY 735
            ++   +KIGWG      P      +  GA+RNV++  L   +F   K K    P  + +
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 736 HNKYILP----------------------------SEQQLREDFSKFGEMEQINFLKDKH 767
                +                             S+ +LR+D + FG+++ I  ++DK 
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 768 CCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCG 815
             +I+F +I SAIK V  +     N+ ++ Y  +     I YGKDRC 
Sbjct: 402 IAFIHFASITSAIKCVHNL-----NSMNDYYSTKK----IFYGKDRCA 440

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  178 bits (452), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 125/199 (62%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN+    K E+ICNV RGG++Q +K + ++++CFV FIDP AAAQ YA + +
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +HN   KIGWG H G L  A+ LAV+ GASRN+Y+   +F   D     P +    
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSETEHPIF---- 497

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +EQ LR  F +FGE+EQINFL +++CC++NFTNI +AI  ++ +KN        
Sbjct: 498 ------TEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNP------ 545

Query: 797 RYKNRYKGLIIGYGKDRCG 815
               ++  L I +GKDRCG
Sbjct: 546 ----QFSDLKINFGKDRCG 560

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 109/200 (54%), Gaps = 20/200 (10%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GNI P  +   + +  R G+++ ++ +REK   F+ F+D  +A  F++++ +  
Sbjct: 145 SRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKR 204

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVT-AGASRNVYVSL--PEFAFKDKYINDPNYKEY 735
           + +    +KIGWG  P P+   +  AV   GA+RNVY+     + +F  +   DP  +  
Sbjct: 205 LNIDGRDIKIGWG-KPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDE-- 261

Query: 736 HNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFH 795
                + +EQ+LR+D S +GE+E +  + +K   +++F +I SAIK+V  +        +
Sbjct: 262 -----VVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLA-----AVN 311

Query: 796 ERYKNRYKGLIIGYGKDRCG 815
             Y N+     I YGKDRC 
Sbjct: 312 PYYANKK----IFYGKDRCA 327

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  177 bits (449), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 128/199 (64%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICNV RGGI+Q +K + ++++CFV FIDP AAAQFYA S +
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             I +     ++GWG HPGPLP AI LAV+ GASRNVY+   +F ++D    +P +    
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF---- 514

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +   LR+ F ++GE+EQ+NFL +K+C ++N+TNI +AI  ++ +K+        
Sbjct: 515 ------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNP------ 562

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 563 ----LFKNLKINFGKDRCG 577

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 105/198 (53%), Gaps = 18/198 (9%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           +T+++GNI P     ++ +  R G++++VK + EK   F+ F+D  AA  F++++ +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 680 ILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSL--PEFAFKDKYINDPNYKEYHN 737
            +    +KIGWG      P       + GA+RNVY+ L   +     +   DPN ++   
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKI-- 280

Query: 738 KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER 797
                +E++LR D  +FGE++ +  +++K   +I+F +I SA+K+V  +     N ++E 
Sbjct: 281 -----TEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGI--NPYYEN 333

Query: 798 YKNRYKGLIIGYGKDRCG 815
            K       I YGKDRC 
Sbjct: 334 KK-------IYYGKDRCA 344

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  177 bits (449), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 124/199 (62%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICN  R G++Q VK + ++++CFV FIDP AAAQFYA S +
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             +IL     K+GWG H GPLP  I LAV+ GASRNVY+   +F    K           
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK----------R 515

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
           N+ +  +E  LR+ F ++GE+EQINFL  K+CC+IN+TNI +AI  ++ +K+        
Sbjct: 516 NERVF-TEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSNP------ 568

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 569 ----YFKDLKINFGKDRCG 583

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 102/197 (51%), Gaps = 16/197 (8%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           RT+++GNI      +++ +  R G+++ VK + EK   F+ F+D  +A  F++++ +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 680 ILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVS-LPEFAFKDKYINDPNYKEYHNK 738
            +    +KIGWG      P       T GA+RNVY+  L   A   + +N P   E    
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE---- 284

Query: 739 YILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERY 798
             + +E++L  D   +G+++ +  +K+K   +I+F +I SAIK+V      +N     RY
Sbjct: 285 --IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVV------NNLAASNRY 336

Query: 799 KNRYKGLIIGYGKDRCG 815
              Y+   I YGKDRC 
Sbjct: 337 ---YQNRKIFYGKDRCA 350

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  176 bits (445), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 127/199 (63%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRTI++GN+    K E+ICN  RGG++Q +K + ++++CFV FIDP AAAQ YA + +
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +HN   KIGWG H G L  A+ LAV+ GASRN+Y+   +F   D   + P +    
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSERDVPVF---- 499

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +EQ LR+ F ++GE+EQINFL ++ CC++NFTNI +AI  ++ +K+ +      
Sbjct: 500 ------TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSNE------ 547

Query: 797 RYKNRYKGLIIGYGKDRCG 815
               ++K L I +GKDRCG
Sbjct: 548 ----QFKDLKINFGKDRCG 562

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 110/200 (55%), Gaps = 20/200 (10%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GNI P  +  ++ +  R G+++ V+ +REK   F+ F+D  +A  F++++ +  
Sbjct: 147 SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVT-AGASRNVYVSL--PEFAFKDKYINDPNYKEY 735
           + +    +K+GWG  P P+   +  AV+  GA+RNVY+     +     ++  DP     
Sbjct: 207 LNIGGRDIKVGWG-KPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP----- 260

Query: 736 HNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFH 795
             + ++ +E++LR D   +GE+E +  + +K   +++F++I SAIK+V  +        +
Sbjct: 261 --RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLA-----TVN 313

Query: 796 ERYKNRYKGLIIGYGKDRCG 815
             Y N+     I YGKDRC 
Sbjct: 314 PYYSNKK----IFYGKDRCA 329

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  176 bits (446), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICN  RGG++Q +K + ++++CFV FIDP AAAQFYA S +
Sbjct: 469 LGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 528

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             + +HN   KIGWG H GPLP  I LAV+ GASRN+Y+    F        + + K+  
Sbjct: 529 HGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINF--------EEDAKQEE 580

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
           + +   +E  LR  F +FG +EQINFL +K+CC+INF NI +AI  ++ +K    +N H 
Sbjct: 581 SVF---AEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIK----SNPH- 632

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +  L I +GKDRCG
Sbjct: 633 -----FNNLKINFGKDRCG 646

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 109/201 (54%), Gaps = 22/201 (10%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GNI      + + +  R G++++VK + EK   FV F+D   A  F++++ +  
Sbjct: 232 SRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKR 291

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVT-AGASRNVYVSLPEFAFKD---KYINDPNYKE 734
           + +    +KIGWG  P P+   +   +   GA+RNVY+       KD   K+  DP    
Sbjct: 292 LNIDGRDIKIGWGK-PQPIDPIVRAGIANDGATRNVYIGKLN-TNKDSCEKWGADP---- 345

Query: 735 YHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNF 794
              K IL ++++L +D S+FGE+E I  ++D+   +++FT+I +AIK V  + + D    
Sbjct: 346 ---KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGSID---- 398

Query: 795 HERYKNRYKGLIIGYGKDRCG 815
              Y N+     + YGKDRC 
Sbjct: 399 -PYYSNKK----VFYGKDRCA 414

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  176 bits (445), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 124/199 (62%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICN  RGG++Q +K + ++++CFV FIDP AAAQFYA S +
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
               +     K+GWG H GPLP A+ LAV+ GASRNVY+   +F   D     P +    
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFE-ADSKKEQPIF---- 569

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +E  LR  F ++GE+EQINFL +K CC+INFTNI +AI  ++ +K    +N H 
Sbjct: 570 ------NETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIK----SNPH- 618

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 619 -----FKSLKINFGKDRCG 632

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  174 bits (441), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++GN+    K E+ICNV RGG++Q VK + ++++CFV FIDP AAAQFYA S +
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
             I +     ++GWG HPG L  A+ LAV+ GASRNVYV    F  +D    DP +    
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIF---- 562

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
                 +E  LR  F ++GE+EQIN+L +++CC++N+TNI +AI  ++ +K       H 
Sbjct: 563 ------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKG------HP 610

Query: 797 RYKNRYKGLIIGYGKDRCG 815
            +K+    L I +GKDRCG
Sbjct: 611 VFKD----LKINFGKDRCG 625

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 104/197 (52%), Gaps = 15/197 (7%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           ++T+++GN       +++ +  R G+++ V+ + +K   FV F+D  AA  F++++ +  
Sbjct: 209 SKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKR 268

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVT-AGASRNVYVSLPEFAFKDKYINDPNYKEYHN 737
           + +    +KIGWG  P P+   +  AV    A+RNVY+   +     K  +  +  +   
Sbjct: 269 LHIDGRDIKIGWG-KPTPIDPVVATAVANDNATRNVYIG--QLNTGPKLSSQVSPVDVTE 325

Query: 738 KYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER 797
             I  +E +LR D  +FGE++ I  +++K   +++F +I +AIK V  +      N +  
Sbjct: 326 PVI--TEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLA-----NINPY 378

Query: 798 YKNRYKGLIIGYGKDRC 814
           Y+N+     I YGKDRC
Sbjct: 379 YRNKK----IFYGKDRC 391

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  173 bits (438), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 124/199 (62%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++G++    K E+ICN  RGG++Q +K + ++ +CFV FIDP AAAQFYA S +
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
               +     K+GWG H GPLP A+ LAV+ GASRNVYV   +FA     +ND       
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDER----- 524

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
               + +E  LR  F ++GE+EQINFL +K+CC+IN+TNI +AI  ++ +K+        
Sbjct: 525 ----IFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 574

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 575 ----YFKDLKINFGKDRCG 589

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 102/199 (51%), Gaps = 30/199 (15%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           RT+++GN+ P    +++ +  R G+++ VK I EK   F+ F+D  AA  F++++ +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 680 ILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKY 739
            + +  +KIGWG      P       T GA+RNVY+       ++ ++            
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 740 ILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER-- 797
              SE+QLR D  ++GE++ I  +K+K   +I+F +I +AIK+V         N   R  
Sbjct: 293 ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVV--------TNLPIRNP 341

Query: 798 -YKNRYKGLIIGYGKDRCG 815
            Y+N+     I YGKDRC 
Sbjct: 342 YYQNKR----IFYGKDRCA 356

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  172 bits (437), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 149/284 (52%), Gaps = 50/284 (17%)

Query: 555 MENMWTTTPFLSSHIVHEEYANDRVDY---NMKHYNNQLYNVPLPQTLQSQFATSAEMAS 611
           + N+  + P+ S   ++  Y  DR  +     KH   Q   +P  +    +   S  +A+
Sbjct: 333 VNNLSNSNPYYSKKKIY--YGKDRCAFITKTQKHNAAQFLGIPTSKANSLEQTNSGLLAN 390

Query: 612 KM--------------GGG--VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKN 655
            +              GG   +GNRT+++GN+    + EDICN  R G++Q +K + +++
Sbjct: 391 ALLQQSAAAAAIATSAGGSNNLGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRH 450

Query: 656 ICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYV 715
           +CFV FIDP +AAQFYA S I   +L     K+GWG H GPL   + LAV+ GASRNVY+
Sbjct: 451 VCFVTFIDPVSAAQFYAMSSIYGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYI 510

Query: 716 SLPEFAF----KDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWI 771
              +F      +++Y  D N               LR  FS++GE+EQINFL  K+CC++
Sbjct: 511 GNIDFTADGTKRERYFTDSN---------------LRRIFSEYGEVEQINFLYSKNCCFV 555

Query: 772 NFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCG 815
           N+TNI +AI  ++ +KN             +K L I +GKDRCG
Sbjct: 556 NYTNINNAISAIDKIKNNPT----------FKNLKINFGKDRCG 589

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 111/200 (55%), Gaps = 15/200 (7%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           RT+++GNI P     D+ +  R G+I++VK + EK   F+ F+D  ++  F++++ +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 680 ILHNNTLKIGWGDHPGPLPKAIELAV-TAGASRNVYVSLPEFAFKDKYINDPNYKEYHNK 738
            +    +KIGWG  P PL   I  +V T GA+RN+++        +K   D +   YH  
Sbjct: 228 NIDGKDIKIGWG-KPSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQ-KDNDATIYHGS 285

Query: 739 ---YILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFH 795
                + +E++LR+D  ++G+++ I   K+K   +++FT+I SAIK+V  + N   N ++
Sbjct: 286 DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNS--NPYY 343

Query: 796 ERYKNRYKGLIIGYGKDRCG 815
            + K       I YGKDRC 
Sbjct: 344 SKKK-------IYYGKDRCA 356

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  171 bits (433), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 124/199 (62%), Gaps = 21/199 (10%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++G++    K E+ICN  RGG++Q +K + ++ +CFV FIDP AAAQFYA S +
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYH 736
               +     K+GWG H GPLP A+ LAV+ GASRNVYV          Y++D    E  
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSVRDER- 542

Query: 737 NKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHE 796
               + +E +LR  F ++GE+EQINFL +K+CC+IN+TNI +AI  ++ +K+        
Sbjct: 543 ----IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 592

Query: 797 RYKNRYKGLIIGYGKDRCG 815
                +K L I +GKDRCG
Sbjct: 593 ----YFKDLKINFGKDRCG 607

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 103/197 (52%), Gaps = 24/197 (12%)

Query: 619 NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678
           +RT+++GN+ P    +++ +  R G+++ VK I EK   F+ F+D  AA  F++++ +  
Sbjct: 202 SRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKR 261

Query: 679 IILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNK 738
           + + +  +KIGWG      P       T GA+RNVY+       ++ ++           
Sbjct: 262 LNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL----------- 310

Query: 739 YILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERY 798
               S +QLR D  ++GE++ I  +K+K   +I+F +I +AIK   +V N    N +  Y
Sbjct: 311 ----SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIK---VVTNLPIRNLY--Y 361

Query: 799 KNRYKGLIIGYGKDRCG 815
           +N+     I YGKDRC 
Sbjct: 362 QNKR----IFYGKDRCA 374

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  171 bits (432), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 124/202 (61%), Gaps = 27/202 (13%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++G++    K E+ICN  RGG++Q +K + ++ +CFV FIDP AAAQFYA S +
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEF---AFKDKYINDPNYK 733
               +     K+GWG H GPLP A+ LAV+ GASRNVYV   +F   + +D+ I      
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVSDSLRDERIF----- 555

Query: 734 EYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNN 793
                    +E  LR  F ++GE+EQINFL +K+CC++N+TNI +AI  ++ +K+     
Sbjct: 556 ---------TESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSNP--- 603

Query: 794 FHERYKNRYKGLIIGYGKDRCG 815
                   +K L I +GKDRCG
Sbjct: 604 -------YFKDLKINFGKDRCG 618

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 102/199 (51%), Gaps = 30/199 (15%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPI 679
           RT+++GN+ P    +++ +  R G+++ VK I EK   F+ F+D  AA  F++++ +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 680 ILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKY 739
            + +  +KIGWG      P       T GA+RNVY+       ++ ++            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 740 ILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER-- 797
              SE+QLR D  ++GE++ I  +K+K   +I+F +I +AIK+V         N   R  
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVV--------TNLPIRNP 370

Query: 798 -YKNRYKGLIIGYGKDRCG 815
            Y+N+     I YGKDRC 
Sbjct: 371 YYQNKR----IFYGKDRCA 385

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  170 bits (431), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 124/202 (61%), Gaps = 27/202 (13%)

Query: 617 VGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFI 676
           +GNRT+++G++    K E+ICN  RGG++Q +K + ++ +CFV FIDP AAAQFYA S +
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 677 DPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEF---AFKDKYINDPNYK 733
               +     K+GWG H GPLP A+ LAV+ GASRNVYV   +F   + +D+ +      
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVGDSLRDERVF----- 542

Query: 734 EYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNN 793
                    +E  LR  F ++GE+EQINFL +K+CC+IN+TNI +AI  ++ +K+     
Sbjct: 543 ---------TESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP--- 590

Query: 794 FHERYKNRYKGLIIGYGKDRCG 815
                   +K L I +GKDRCG
Sbjct: 591 -------YFKDLKINFGKDRCG 605

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 111/227 (48%), Gaps = 37/227 (16%)

Query: 592 NVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYI 651
           N PLP   Q+    +   A        +RT+++GN+ P    +++ +  R G+++ VK I
Sbjct: 180 NAPLPVNAQANNPLNFTSAP-------SRTVYLGNVPPNLSVKELLDHVRSGVVEDVKII 232

Query: 652 REKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASR 711
            EK   FV FID  AA  F++++ +  + + +  +KIGWG      P       T GA+R
Sbjct: 233 PEKMCAFVSFIDESAALLFHSDAILKRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATR 292

Query: 712 NVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWI 771
           NVY+       ++ ++               SE+QLR D  ++GE++ I  +K+K   +I
Sbjct: 293 NVYIGRMTIEGEESHL---------------SEEQLRVDLEEYGEIDCIKIIKEKGIAFI 337

Query: 772 NFTNIRSAIKLVELVKNEDNNNFHER---YKNRYKGLIIGYGKDRCG 815
           +F +I +AIK+V         N   R   Y+N+     I YGKDRC 
Sbjct: 338 HFASILNAIKVV--------TNLPIRNPYYQNKR----IFYGKDRCA 372

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 86/195 (44%), Gaps = 24/195 (12%)

Query: 634 EDICNVTRGGIIQQV--KYIREKNICFVI---FIDPQAAAQFYANSFIDPIILHNNTLKI 688
           + + N  +GG ++ +  +Y +E N    +   F+ P+ A  F          ++   L+ 
Sbjct: 181 KSVLNQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQHFMEYGRHAVFQINGVHLRP 240

Query: 689 GWGDHPGPLPKAIELAVTAGASRNVYVSLPE---FAFKDKYINDPNYKEYHNKYILPSE- 744
            WG     L +  E ++ A     + +  P       K +   +P +   H  Y  P   
Sbjct: 241 RWGIQS--LSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSKNPKHSTCH--YPSPRSH 296

Query: 745 ------QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHER 797
                 Q+L++DFS+FG +  I+  +  K C  INF +I+SA+  ++  KN  N+  + +
Sbjct: 297 ICDLNVQELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNA-NSPLNRK 355

Query: 798 YKNRYKGLIIGYGKD 812
           Y   +    IGYGKD
Sbjct: 356 YAESW---TIGYGKD 367

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 23/192 (11%)

Query: 636 ICNVTRGGIIQQV--KYIREKNICFVI---FIDPQAAAQFYANSFIDPIILHNNTLKIGW 690
           + N  +GG ++ +  +Y +E N    +   F+ P+ A  F          ++   L+  W
Sbjct: 183 VLNQVQGGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKW 242

Query: 691 GDHPGPLPKAIELAV-TAGASRNVYV-SLPEFAFKDKYINDPNYKEYHNKYILPSE---- 744
           G     L +  E ++ T   S NVY  S      K +   +P +   H  Y  P      
Sbjct: 243 GIQS--LSENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNPKHSTCH--YPSPRSHICD 298

Query: 745 ---QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKN 800
              Q L+ DF +FG++  I+  +  K C  INF +I++A+  ++  KN  N+  + +Y +
Sbjct: 299 LNIQDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQAYKNI-NSPLNRKYAD 357

Query: 801 RYKGLIIGYGKD 812
            +    IGYGKD
Sbjct: 358 TW---TIGYGKD 366

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 749 EDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLII 807
           EDF +FG ++++   +  K C  +N+ NI SA+K +E  + + N+  H +Y   YK   I
Sbjct: 305 EDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYE-DPNSELHRKY---YKSWAI 360

Query: 808 GYGKD 812
            +GKD
Sbjct: 361 WFGKD 365

>NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.670
           YOR242C
          Length = 358

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 86/205 (41%), Gaps = 29/205 (14%)

Query: 620 RTIFIGNINPRSKTEDICNVTRGGII------QQVKYIREKNICFVIFIDPQAAAQFYAN 673
           R I I NI   +    I     GG I      QQ K     N+  + FI  + A QF   
Sbjct: 162 RMIIIRNIPKETGIHSIVAQISGGPIENFNFYQQHKLSSPSNVLKIAFIASEGAQQFMKY 221

Query: 674 SFIDPIILHNNTLKIGW-GDHPGPLPKAIELAVTA----GASRNVYVSLPEFAFKDKYIN 728
              +   ++   LK  W  D    +P     + T     G  R ++  + +   KD  + 
Sbjct: 222 GNTNLFKVNGIHLKPEWFVDSNLCIPSKTVPSKTLLNYNGKCRCLF--MKQLPLKDHLVL 279

Query: 729 DPNYKEYHNKYILPSEQQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVK 787
           +  Y            +++R DF  FGE+  I+  +  + C +I F +I SA++++E  +
Sbjct: 280 NSLY-----------LKRIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRVLEAYE 328

Query: 788 NEDNNNFHERYKNRYKGLIIGYGKD 812
           +  ++  H++Y  ++    I YGKD
Sbjct: 329 DR-HSRIHQQYFEKWS---IYYGKD 349

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 10/94 (10%)

Query: 725 KYINDPNYKEYHNKYI-LPSE----QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRS 778
           KYIN     +Y   Y   P E     ++++DF  FGE+ +I   +  K C  INF N+ S
Sbjct: 291 KYINCTKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMES 350

Query: 779 AIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKD 812
           A+K ++  +N  N++ H+ Y N +    I YGKD
Sbjct: 351 AMKAMKEYENP-NSDLHKAYFNNWA---IWYGKD 380

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           + LR+DF +FGE+ +I+  +  K C  ++F ++RSAI  +E    E ++  H++Y   + 
Sbjct: 348 KDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALESF-GEPDSFMHKKYNRDW- 405

Query: 804 GLIIGYGKD 812
              + YG+D
Sbjct: 406 --TMAYGRD 412

>TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON}
           Anc_8.466 YDL209C
          Length = 306

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 9/84 (10%)

Query: 736 HNKYILPS--EQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNE---- 789
           +NK + PS  E +LR  FS+ G ++++ +L++K+C +I F N  +A    E++ N+    
Sbjct: 151 NNKELKPSQIESRLRYMFSRLGLLDRLRYLENKNCAFIKFKNQCNAEFAKEVMSNQTLLI 210

Query: 790 -DNNNFHERYKNRYKGLIIGYGKD 812
             +  + ER  N   GL++ +  D
Sbjct: 211 PSDKEWDER--NEGTGLLVKWAND 232

>KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON}
           Anc_8.466 YDL209C
          Length = 330

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 48/84 (57%), Gaps = 9/84 (10%)

Query: 736 HNKYILPS--EQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNE---- 789
           +NK + P+  E +LR  F+K G +++I ++ +K+C ++ F N R+A    E + N+    
Sbjct: 139 NNKTLKPTQIESRLRFMFNKLGPIDKIRYVANKNCAFVKFRNARNAEFAKEAMTNQTMLL 198

Query: 790 -DNNNFHERYKNRYKGLIIGYGKD 812
            +++ +  R ++   GL++ +  D
Sbjct: 199 PNDDEWENRTES--TGLLVKWAND 220

>Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON}
           (14170..15519) [1350 nt, 450 aa]
          Length = 449

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 6/51 (11%)

Query: 743 SEQQLREDFSKFGEMEQINFLKDKH------CCWINFTNIRSAIKLVELVK 787
           +EQ+L E FSKFG++E+I  +K+++        +I+FT+  SA K +EL K
Sbjct: 215 TEQKLSEWFSKFGDIERIKLVKNENEPGNTSYAFISFTSSDSATKALELHK 265

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 385

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           QQ+ +DF++FG++ +++  +  K C  I+F +IRSAI+ +   +   N+  + +Y   +K
Sbjct: 312 QQIIDDFNQFGQVLEVSPLISRKICLQISFHDIRSAIEAMRSYETS-NSYINGKY---FK 367

Query: 804 GLIIGYGKD 812
              I YGKD
Sbjct: 368 DWSIWYGKD 376

>TDEL0C05200 Chr3 (928021..928812) [792 bp, 263 aa] {ON} Anc_3.379
           YBR119W
          Length = 263

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 4/46 (8%)

Query: 629 PRSKTEDICNV----TRGGIIQQVKYIREKNICFVIFIDPQAAAQF 670
           PR++T    N+    T  GI++  + ++ +N CF+ FID Q AAQF
Sbjct: 43  PRNETIGNANLQLLDTHLGIVEVSRSVKLENQCFITFIDDQHAAQF 88

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 69/160 (43%), Gaps = 27/160 (16%)

Query: 566 SSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQSQFA--------------TSAEMAS 611
           S+ I+++ + + R  +     +  + ++ LPQTL  +F                S E+  
Sbjct: 172 STFIIYDPFLDGR-HFPTYEVSLPIQDIRLPQTLVDEFTDEDPEVRRDIKRKELSLEIIE 230

Query: 612 KM---GGGVGNRTIFIGNINPRSKTEDICNV-TRGGIIQQVKYIREKNI------CFVIF 661
            M   G     R +FI  +NP ++ +DI  +  R G I  V+ +R+K+        F+ F
Sbjct: 231 NMPIMGIKPSPRVLFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQF 290

Query: 662 IDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAI 701
            D ++  Q Y    ++ +I+ +  + + +        KAI
Sbjct: 291 TDRKSCEQAYKK--MEGVIIDDRRIHVDFSQSVKAATKAI 328

>TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON}
           Anc_1.102
          Length = 337

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 13/86 (15%)

Query: 616 GVG----NRTIFIGNINPRSKTEDICNVT-RGGIIQQVKYIREK----NIC--FVIFIDP 664
           GVG     R +FI  +NP +K +DI  +  R G +  V+ +R+K    ++C  F+ F D 
Sbjct: 244 GVGIKPSERVLFICRLNPSTKAKDIATIFHRFGEVHSVEIVRDKESGRSLCYGFIEFNDR 303

Query: 665 QAAAQFYANSFIDPIILHNNTLKIGW 690
           +A    Y N  ++ +++ +  +K+ +
Sbjct: 304 KACESAYKN--MNGVLIDDKRIKVDF 327

>TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa]
           {ON} Anc_8.670 YOR242C
          Length = 378

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 5/68 (7%)

Query: 746 QLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKG 804
           ++R DF  FG+++ I   +  K C  I+F ++ SAI+ ++    ED ++    YK  +K 
Sbjct: 306 EIRHDFGIFGKVQDIAPIVSRKLCISISFYSVHSAIRAMD--DYEDPSS--ALYKKYFKN 361

Query: 805 LIIGYGKD 812
             + YGKD
Sbjct: 362 WAVWYGKD 369

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           +++R+DF +FG +  I   +  K C  I++ NI++A+  ++   ++  + FH++Y   + 
Sbjct: 291 EEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMK-AYDDPYSEFHKKYSEEW- 348

Query: 804 GLIIGYGKD 812
             ++ YGKD
Sbjct: 349 --VVWYGKD 355

>Kwal_27.11730 s27 (922606..923715) [1110 bp, 369 aa] {ON} YDL209C
           (CWC2) - Protein required for cell viability [contig 27]
           FULL
          Length = 369

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 45/98 (45%), Gaps = 26/98 (26%)

Query: 615 GGVG-----NRTIFIGNI-----NPRSKTEDICNVTRG-----GIIQQVKYIREKNICFV 659
           GGVG     NRT++IG I     N + K   I N  R      G +++++Y+  KN  FV
Sbjct: 158 GGVGSFRKKNRTLYIGGIAGALNNQQLKASQIENRLRFTFGKLGPLERIRYVENKNCAFV 217

Query: 660 IFIDPQAAAQFYANSFIDPIILHNNTLKI----GWGDH 693
            +   Q +A+F   +      + N TL I     WGD 
Sbjct: 218 KY-KYQVSAEFAKET------MSNQTLLIPSDKDWGDR 248

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           Q+L +DF  FGE+ +I   +  K C  I F +I SA++ +E  + E   ++   Y   +K
Sbjct: 298 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAME--EYEQKGSYL--YNKYFK 353

Query: 804 GLIIGYGKD 812
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           Q+L +DF  FGE+ +I   +  K C  I F +I SA++ +E  + E   ++   Y   +K
Sbjct: 297 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAME--EYEQKGSYL--YNKYFK 352

Query: 804 GLIIGYGKD 812
              I YGKD
Sbjct: 353 TWTIWYGKD 361

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 96/234 (41%), Gaps = 28/234 (11%)

Query: 601 SQFATSA--EMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIRE----- 653
           S   T+A      K+ GG  +R + I +I   S  + +     GG +++++  R+     
Sbjct: 188 SNLGTTAVHAWGQKLAGGT-DRIVQINDIPRDSGIQSLIAQICGGPLEKIQVTRDPYNPT 246

Query: 654 --KNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGP------LPKAIELAV 705
             K++  + F+  QAA  F        + ++ + LK  W            + +  E+  
Sbjct: 247 AIKSV-LLYFMSQQAANSFIHYGRTTNLRVNGHVLKPEWDTKSSDNLSNLNVERIREVIE 305

Query: 706 TAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKY-----ILPSE-QQLREDFSKFGEMEQ 759
           + GA +    S        K      +      Y     + P + + LR+DF  FG + +
Sbjct: 306 SKGAQKGQDSSGARRCIIVKKTGGSGHSRSRQMYSSRQNLCPLDIKDLRQDFENFGNIVE 365

Query: 760 IN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKD 812
           I+  +  K C  + F ++ S+I  +E  + + N+  +++Y   +    I YG+D
Sbjct: 366 ISPMISRKLCLCVTFYDVSSSIGALESFE-KPNSYLNKKYGRDWS---IAYGRD 415

>KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} similar
           to uniprot|Q12046 Saccharomyces cerevisiae YDL209C
          Length = 341

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 16/82 (19%)

Query: 615 GGVG-----NRTIFIGNI-----NPRSKTEDICNVTRG-----GIIQQVKYIREKNICFV 659
           GGVG     NRT+++G I     N + K   I N  R      G +++++Y+  KN  F+
Sbjct: 128 GGVGSFQKKNRTLYVGGITGALNNQQLKASQIENRLRFSFGKLGPLERIRYVENKNCAFI 187

Query: 660 IFIDPQAAAQFYANSFIDPIIL 681
            +   QA+A+F   +  +  +L
Sbjct: 188 KY-KHQASAEFAKETMSNQTLL 208

>SAKL0H12012g Chr8 complement(1027110..1028144) [1035 bp, 344 aa]
           {ON} similar to uniprot|Q12046 Saccharomyces cerevisiae
           YDL209C
          Length = 344

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 736 HNKYILPS--EQQLREDFSKFGEMEQINFLKDKHCCWINF 773
           +NK + PS  E ++R  F KFG ++++ F++ K+C ++ F
Sbjct: 153 NNKQLKPSQIESRIRFTFGKFGSIDRVRFVESKNCGFVTF 192

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 736 HNKYILPS--EQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNE 789
           ++K++ P+  E ++R  FS+ G++++I +++DK C ++ F +  SA    E + N+
Sbjct: 147 NSKHLKPTQIESRVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASAEFAKEAMSNQ 202

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           Q+L +DF  FGE+ +I   +  K C  I F +I SA++ +E    +  +  + +Y   +K
Sbjct: 298 QELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEY-GQKGSYINTKY---FK 353

Query: 804 GLIIGYGKD 812
              I YGKD
Sbjct: 354 AWTIWYGKD 362

>SAKL0H21472g Chr8 complement(1879578..1880471) [894 bp, 297 aa]
           {ON} conserved hypothetical protein
          Length = 297

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 66/157 (42%), Gaps = 26/157 (16%)

Query: 183 SDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDLHT 242
           S N+E +  L   + +RE F +   + Y+      P  D   H    + E I      H 
Sbjct: 52  SGNHEGIQELQQSESSREEFWKTIMLKYEQD----PGSDLINHGLRKIREVIVSIFQSHL 107

Query: 243 FIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNS 302
             E+FVN+ L E      +Y   +  + +I L       CL+F    L+ + EYK QL+ 
Sbjct: 108 SDERFVNFTL-EVSTTSLNYYLDKGDISNIFL-------CLEFALYTLRPVMEYKHQLDE 159

Query: 303 ENLKLSFVSLCY------LQNNINKGNGKISVESQKN 333
                   S CY      ++NNI K + ++S E  KN
Sbjct: 160 -------FSACYALYVSHVENNIEK-SLRLSTEYLKN 188

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 745 QQLREDFSKFGEMEQIN-FLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYK 803
           ++L +DF  FGE+ +I   +  K C  I F +I SA++ +E  + +  +  + +Y   +K
Sbjct: 298 RELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYE-QKGSGLNNKY---FK 353

Query: 804 GLIIGYGKD 812
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar to
           uniprot|Q00916 Saccharomyces cerevisiae YIL061C SNP1
           U1snRNP 70K protein homolog
          Length = 304

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 14/65 (21%)

Query: 729 DPNYKE---YHNKYI--LP---SEQQLREDFSKFGEMEQINFLKDKHC------CWINFT 774
           DPN KE   +   ++  LP   +E +L+ +FSKFG++E+I  ++DK         ++ FT
Sbjct: 97  DPNIKETDPFKTIFVGRLPYDTTEMELQREFSKFGDIERIRVVRDKVTNKSKGYAFVLFT 156

Query: 775 NIRSA 779
           N +S+
Sbjct: 157 NPQSS 161

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 30/40 (75%), Gaps = 2/40 (5%)

Query: 736 HNKYILPS--EQQLREDFSKFGEMEQINFLKDKHCCWINF 773
           ++K++ P+  E ++R  FS+ G++++I +++DK+C ++ F
Sbjct: 147 NSKHLKPAQVESRIRFVFSRLGDIDRIRYVEDKNCAFVKF 186

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 32.0 bits (71), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 715 VSLPEFAFKDKYINDPNYKEYHNKYILP--SEQQLREDFSKFGEMEQINFLKDKHCCWIN 772
           +++P+F+    Y   PN        + P  +E QL+  FS FG +  +   + K+C ++ 
Sbjct: 368 MNIPDFSSSQAYTTPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVK 427

Query: 773 FTN 775
           + N
Sbjct: 428 YEN 430

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,528,885
Number of extensions: 6012517
Number of successful extensions: 27516
Number of sequences better than 10.0: 251
Number of HSP's gapped: 28606
Number of HSP's successfully gapped: 293
Length of query: 1039
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 919
Effective length of database: 39,721,479
Effective search space: 36504039201
Effective search space used: 36504039201
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 71 (32.0 bits)