Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002608.841ON32332317200.0
Kpol_1068.78.841ON3233209781e-132
Kwal_27.102558.841ON3293229441e-127
Suva_16.17singletonON3243229231e-124
NCAS0D049408.841ON3273219221e-124
KAFR0B00210singletonON3263209111e-122
SAKL0D01452g8.841ON3273219111e-122
Smik_12.1na 1ON3243259101e-122
Ecym_46128.841ON3263219081e-121
TPHA0G03760singletonON3313209051e-121
YPL273W (SAM4)8.841ON3253219021e-121
KLLA0D01551g8.841ON3313228971e-120
NDAI0F00250singletonON3293218931e-119
KLTH0C03850g8.841ON3293228901e-119
YLL062C (MHT1)na 1ON3243218881e-119
KNAG0B06970singletonON3323138821e-118
Suva_13.515na 2ON3253218811e-118
KAFR0F04420singletonON3263208751e-117
TBLA0B032608.841ON3263248721e-116
Skud_12.4na 1ON3253208651e-115
Smik_6.4848.841ON3253208651e-115
TDEL0E05690singletonON3283218581e-114
ZYRO0G14212g8.841ON3253138511e-113
ABL125W8.841ON3363198481e-112
TDEL0E00240singletonON3283218321e-110
KAFR0L00150singletonON3263248131e-107
Suva_64.1singletonON2732727534e-99
Suva_16.328.841ON2592476587e-85
SAKL0D09306gna 3ON3263366552e-83
Skud_100.1singletonON2001985502e-69
KLTH0H12716gna 3ON3483345529e-68
Kwal_0.322na 3ON3323375473e-67
Skud_101.1singletonON2001985345e-67
AFR410WsingletonON3703195131e-61
Skud_47.2singletonON96972993e-33
YMR321Cna 2ON105932524e-26
AFR041C2.106ON25762721.3
KAFR0E022005.80ON57664731.4
SAKL0D09504g1.359ON54172712.1
CAGL0D06050g1.495ON52471712.2
NDAI0A055103.306ON84978693.9
TBLA0D037901.495ON51650685.1
KLLA0A05434g5.80ON556138685.8
KNAG0B003101.494ON58737668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00260
         (323 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   667   0.0  
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   381   e-132
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   368   e-127
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   360   e-124
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               359   e-124
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       355   e-122
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   355   e-122
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   355   e-122
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   354   e-121
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     353   e-121
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   352   e-121
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   350   e-120
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       348   e-119
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   347   e-119
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   346   e-119
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             344   e-118
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   343   e-118
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               341   e-117
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   340   e-116
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   337   e-115
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   337   e-115
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   335   e-114
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   332   e-113
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   331   e-112
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       325   e-110
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      317   e-107
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        294   4e-99
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   258   7e-85
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   256   2e-83
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   216   2e-69
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   217   9e-68
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   215   3e-67
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   210   5e-67
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   202   1e-61
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      119   3e-33
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   101   4e-26
AFR041C Chr6 complement(508245..509018) [774 bp, 257 aa] {ON} Sy...    32   1.3  
KAFR0E02200 Chr5 complement(436140..437870) [1731 bp, 576 aa] {O...    33   1.4  
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    32   2.1  
CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} simila...    32   2.2  
NDAI0A05510 Chr1 complement(1245160..1247709) [2550 bp, 849 aa] ...    31   3.9  
TBLA0D03790 Chr4 complement(942926..944476) [1551 bp, 516 aa] {O...    31   5.1  
KLLA0A05434g Chr1 (497874..499544) [1671 bp, 556 aa] {ON} simila...    31   5.8  
KNAG0B00310 Chr2 complement(46976..48739) [1764 bp, 587 aa] {ON}...    30   8.6  

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/323 (100%), Positives = 323/323 (100%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
           CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240
           LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300

Query: 301 IIGGCCRTTPDDIKQIKKAVDAL 323
           IIGGCCRTTPDDIKQIKKAVDAL
Sbjct: 301 IIGGCCRTTPDDIKQIKKAVDAL 323

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  381 bits (978), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 168/320 (52%), Positives = 237/320 (74%), Gaps = 1/320 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           MRVP  + I   P+E+LV DGG GT LE+RG+N++SPLWST+ F+ D FWD   + ++R 
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            I  ++ D+  +G+ + ST+TYQTSF+ +S +T++K+++ Y +L+R IT FCR  I +D+
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+G IG + A +GAEY GNYG     I+YL+YFKPQL+EFNN+ +IDIIGFET+PNK+E
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240
           LEAILSWD+ +I++P++++LSL D  GLRDGTSFEE+  +F KY   N NL+  G NCIS
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYS-NNDNLILTGANCIS 239

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           + Y+ +NI KLH  +P L LI YPNSGEIYD  +K+W+      ++WE+++ E   + V+
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299

Query: 301 IIGGCCRTTPDDIKQIKKAV 320
           I+GGCCRTTPDDI +IK  +
Sbjct: 300 IVGGCCRTTPDDINKIKDMI 319

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 233/322 (72%), Gaps = 2/322 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWD-ENIENTER 59
           +R   ++F++++P E+LVLDGGQGTELENRG+ + +P+WSTI F+++ FW  E+  + +R
Sbjct: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61

Query: 60  KCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDD 119
           + ++EM++DF  AGA V  T+TYQ SF SVSENT IK+L+EY  LL +I  F R CI DD
Sbjct: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121

Query: 120 DYLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKH 179
            +L+GCIGA+ A   +E+ G+YG    KID+L+YFKPQLD F N+ NID+IGFETIPN H
Sbjct: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181

Query: 180 ELEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNC 238
           EL AILSWDE IIN+PF+I LS+ +   LRDGT+  ++  L   +  R N N   +G NC
Sbjct: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241

Query: 239 ISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAG 298
           +SY  S D +R LH+ +P + LIAYPNSGE+YD   K W+  ++  +SWE++V  Y D+G
Sbjct: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSG 301

Query: 299 VKIIGGCCRTTPDDIKQIKKAV 320
            +IIGGCCRT+P DI+ I +AV
Sbjct: 302 ARIIGGCCRTSPKDIEAIHEAV 323

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 226/322 (70%), Gaps = 5/322 (1%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R+   K I EHP ++LVLDGGQGTELENRG++INSP+WS   F++D FW+    +++R  
Sbjct: 3   RIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWEST--SSDRTL 60

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           + EM+ DF DAGANV  T+TYQ +FSS+SENT IK+L +Y+  L ++  F RR I +D Y
Sbjct: 61  VEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRY 120

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G IG +AA + +EY G+YG     IDYL++FK QLD FN    ID+IGFET+PN HEL
Sbjct: 121 LIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHEL 180

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR--NKNLVYVGGNCI 239
           +AILSWDE+II++PF++ LS+ D   LRDGT+ EE+   + K  GR  N++ + +G NCI
Sbjct: 181 KAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAA-YVKSLGRKINRHFLLLGVNCI 239

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           S+  S   ++ LH  +P + L+AYPNSGE+YD K+K W      + SWE VV E+ D G 
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 300 KIIGGCCRTTPDDIKQIKKAVD 321
           +IIGGCCRT+  DI +I  AVD
Sbjct: 300 RIIGGCCRTSAKDISEIASAVD 321

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 232/321 (72%), Gaps = 3/321 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R   ++++ ++P+++LVLDGGQGTELENRG+N+ +P+WSTI FV++ FW +   N +R+ 
Sbjct: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSN-DRQI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           ++EMF DF  AGA +  T TYQTSF SVSENTDIK+LQEY+ELL +I  F R CI +  Y
Sbjct: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIG + A + AE++G+YG     IDY +YFKPQLD F  + N+D+IGFET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSWDE I+++PF+I LS+ +   LRDGT+ EE+G +F     + N NL+ +G NC+S
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQW-SSTSAIKISWEEVVNEYADAGV 299
           + +S   +  +H  +P + LIAYPNSGE+YD   K W    S   ++WE+VV  Y +AG 
Sbjct: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRTTP DI +I KAV
Sbjct: 302 RIIGGCCRTTPKDILEISKAV 322

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/320 (50%), Positives = 229/320 (71%), Gaps = 2/320 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R P +++++E+P ++LVLDGGQGTELENRG+++ +P+WSTI F+++ FW  N  + +R+ 
Sbjct: 3   RQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFW-SNASSKDREI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           ++ MF DF DAGA++  T+TYQTSF SV+ENT IK+L+EY+ELL +I  F R CI D+ Y
Sbjct: 62  VKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIG + A + AE++G+YG     IDY  YFKPQLD F  + ++D+IGFET+PN HEL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSWD+ I+++PF+I LS+ +   LRDGT+  E+G        + N N + +G NC+S
Sbjct: 182 KAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           ++ S D +  +H  +P + LIAYPNSGEIYD   K W       I+W +VVN Y  AG +
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGAR 301

Query: 301 IIGGCCRTTPDDIKQIKKAV 320
           IIGGCCRT PDDI+Q+  AV
Sbjct: 302 IIGGCCRTMPDDIEQVSAAV 321

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 228/321 (71%), Gaps = 2/321 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R P ++F  EHP+EILV+DGGQGTELENRG+ + +P+WSTI F+++ FW  N  + +R+ 
Sbjct: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           ++EMF+DF   G+ +  T TYQTSF SVSENT IK+L+EY++LL +I  F R CI +D Y
Sbjct: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIGA+ A +  E+ G+YG    +ID+L+YF+PQL  FN+   ID+IGFETIPN HEL
Sbjct: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSWDE II++PF+I LS+ +   LRDGT+ +E+  +      + N NL+ +G NC+S
Sbjct: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           + +S   +  LH  +P + +I YPNSGEIYD   K W      K++W++VV  Y + G +
Sbjct: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGAR 301

Query: 301 IIGGCCRTTPDDIKQIKKAVD 321
           IIGGCCRT+P DIK I +A++
Sbjct: 302 IIGGCCRTSPQDIKDIVQAIE 322

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 226/325 (69%), Gaps = 9/325 (2%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R+P  K + EHP ++LVLDGGQGTELENRG+NINSP+WS   FV+D FW+++  + ERK 
Sbjct: 3   RIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEKS--SRERKV 60

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           + EM+ DF +AGANV  T+TYQ +F S+S+NT IK+L  Y   L +I  F RR I ++ Y
Sbjct: 61  VEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERY 120

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G IG +AA + +EY GNYG     IDY ++F+PQLD FN + +ID+IGFETIPN HEL
Sbjct: 121 LIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHEL 180

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR----NKNLVYVGGN 237
           +AILSW EDII+RPF++ LS+ D   LRDGT+ EE+    A  KG     NKN + +G N
Sbjct: 181 KAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEIS---AHIKGLGSKINKNFLLLGVN 237

Query: 238 CISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADA 297
           CIS+  S   ++ LH+++P   L+ YPNSGEIYD K K W   +    SW+  V ++ D+
Sbjct: 238 CISFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDS 297

Query: 298 GVKIIGGCCRTTPDDIKQIKKAVDA 322
           G +IIGGCCRT+P DI +I  +VD 
Sbjct: 298 GARIIGGCCRTSPKDIAEIAASVDT 322

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  354 bits (908), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 228/321 (71%), Gaps = 2/321 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           +R   ++ +  +P++IL++DGGQGTELENRG+N+ +P+WSTI F+ND FW +   + +R+
Sbjct: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDR-SSRDRQ 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            +  MF ++  AGAN+  T+TYQ+SF SVSENTDIK+L+EY++LL +I  F R CI  D+
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+GCIG++ A I AE+ G+YG    +I YL YF+PQL+ FN   +ID+IGFETIPN HE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKY-KGRNKNLVYVGGNCI 239
           L AILSWDE II +PF+I +S+ +   LRDGT+  ++ +LF    K  N N + +G NC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           S+ YS   +  LH+ +P++ LIAYPNSGE+YD   K W       ++W+E+V  Y  +G 
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRTTP+DI+QI  AV
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAV 321

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  353 bits (905), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/320 (51%), Positives = 230/320 (71%), Gaps = 2/320 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R   + ++ E+PN++LV+DGGQGTELENRG+ + +P+WSTI F+++ FW +   + +RK 
Sbjct: 3   RQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQ-SSEDRKI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           ++EMFNDF +AGA +  T TYQTSF SVSENT IK+ + Y+ELL +I  F R CI ++ Y
Sbjct: 62  VKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIG++ A I AE+ G+YG     ID+ +YFKPQLD F N+  +D+IGFET+PN HEL
Sbjct: 122 LIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSWDE I+++PF+I LS+ +   LRDGTS +E+  L   +  + N NL  +G NC+S
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           Y +S D I+ +H  +P+L LIAYPNSGEIYD   K W        +W+++V  Y +AGV+
Sbjct: 242 YNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGVR 301

Query: 301 IIGGCCRTTPDDIKQIKKAV 320
           IIGGCCRTTP+DIK +  AV
Sbjct: 302 IIGGCCRTTPNDIKAVTIAV 321

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 229/321 (71%), Gaps = 4/321 (1%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFW-DENIENTERK 60
           R+P ++F+ ++P ++LVLDGGQGTELENRG+ + +P+WSTI F+++ FW DE+  N  RK
Sbjct: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSAN--RK 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            ++EMFNDF +AGA +  T TYQTS+ SVSENT I++L EY+ LL +I  F R CI +D 
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+GCIG + A I  E+ G+YG     ID+ +YFKPQL+ FN +  +D+IGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239
           L+AILSWDE I++RPF+I LS+ +   LRDGT+ EE+ ++      + N N  ++G NC+
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           S+  S D +  LH  +P++ L+AYPNSGE+YD + K W   S    SW+ VV +Y  +G 
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRT+P DI++I  AV
Sbjct: 301 RIIGGCCRTSPKDIQEISAAV 321

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 160/322 (49%), Positives = 230/322 (71%), Gaps = 2/322 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           MRVP +K+ +E+P+ +LV+DGGQGTELENRG+N+ +P+WST+ F+N+ FW  +  + +R 
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSD-ASKDRI 59

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            +++MF DF +AGA++  T+TYQTSF SVSENT I++L+EY+ LL +I  F R CI +D 
Sbjct: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+GCIGA+ A + +E+ G+YG    +IDY +YF+PQL  F    +IDIIGFETIPN HE
Sbjct: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239
           L AILSWDE ++++PF+I LS+ +   LRDGTS +++  L +    + N NL+++G NC 
Sbjct: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           ++  S   +  LH+  P++ LI YPNSGEIYD   K W        +W++VV  Y + G 
Sbjct: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGA 299

Query: 300 KIIGGCCRTTPDDIKQIKKAVD 321
           +IIGGCCRTT DDIK+++ AV+
Sbjct: 300 RIIGGCCRTTVDDIKEVRLAVN 321

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  348 bits (893), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 223/321 (69%), Gaps = 3/321 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R P + ++ E+P +IL+LDGGQGTELENRG+N+ +P+WSTI FVND FW     + +R+ 
Sbjct: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQ-SSKDREI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           +++MFNDF +AGA +  T TYQTSF SVSENT+IK+L+EY ELL +I  F R CI ++ Y
Sbjct: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIG + A I +E+ GNYG     IDY +YFKPQL  F  + ++DIIGFETIPN +EL
Sbjct: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           + ILSW  DI+ +PF+I LS+ +   LRDGT+  ++  +      + N NLV +G NC+S
Sbjct: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQW-SSTSAIKISWEEVVNEYADAGV 299
            A+S D +  +H  +P L LI YPNSGE+YD   K W        +SW+EVV  Y  AG 
Sbjct: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGA 301

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRTTP+DIKQI  AV
Sbjct: 302 RIIGGCCRTTPNDIKQISDAV 322

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/322 (50%), Positives = 221/322 (68%), Gaps = 2/322 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENT-ERK 60
           R   ++++  +P E+LVLDGGQGTELENRG+ + +P+WSTI F++D FW  N  ++ +R+
Sbjct: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            ++EM+ DF  AGA V  T+TYQ SF SVSENT I +L+EY  LL +I  F R CI DD 
Sbjct: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           +L+GCIG + A   +E+ G+YG    KIDYL+YFKPQLD F  + ++D+IGFETIPN HE
Sbjct: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239
           L AILSWD  I+ +PF+I LS+ +   LRDGT+  E+  L      + N N V +G NC+
Sbjct: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           SY +S + +R LH  +P L LIAYPNSGE+YD   K W+      ++W++VV  Y D+G 
Sbjct: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGA 302

Query: 300 KIIGGCCRTTPDDIKQIKKAVD 321
           +IIGGCCRT+P DI  I  AV+
Sbjct: 303 RIIGGCCRTSPKDIAAINAAVN 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  346 bits (888), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/321 (50%), Positives = 220/321 (68%), Gaps = 3/321 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R+P ++ I EHP ++L+LDGGQGTELENRG+NINSP+WS   F ++ FW+ +  + ERK 
Sbjct: 3   RIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWEPS--SQERKV 60

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           + EM+ DF  AGAN+  T+TYQ +F S+SENT IK+L  Y   L KI  F R  I ++ Y
Sbjct: 61  VEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERY 120

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G IG +AA +  EY G+YG     IDY  +FKPQL+ FN + +ID+IGFETIPN HEL
Sbjct: 121 LIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHEL 180

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSWDEDII++PF+I LS+ D + LRDGT+ EE+         + NKNL+ +G NC+S
Sbjct: 181 KAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVS 240

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           +  S   ++ LH+ +P + L+ YPNSGEIY+ K K W   +     WE  V ++ D G +
Sbjct: 241 FNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGAR 300

Query: 301 IIGGCCRTTPDDIKQIKKAVD 321
           IIGGCCRT+P DI +I  AVD
Sbjct: 301 IIGGCCRTSPKDIAEIASAVD 321

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  344 bits (882), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/313 (50%), Positives = 223/313 (71%), Gaps = 2/313 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R P ++++  +P ++LVLDGGQGTELENRG+N+ +P+WST+ F++  FW  N  + +R  
Sbjct: 3   RQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFW-SNKSSKDRVI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           ++ MF+ F DAGA +  T TYQTSF SVSENT I++L+EY  LL +I  F R CI  D Y
Sbjct: 62  VKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIG + A + AE++G+YG    +IDYL YFKPQLD F ++ N+D+IGFETIPN HEL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
            AILSWDE I+++PF+I LS+ +   LRDG++ +++  L   + G+ NKNL  +G NC+S
Sbjct: 182 RAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           ++ S D +  +H  +P + LIAYPNSGE+YD   K W     + ++WEEVV+ Y  AG +
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGAR 301

Query: 301 IIGGCCRTTPDDI 313
           I+GGCCRT+P DI
Sbjct: 302 IVGGCCRTSPKDI 314

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  343 bits (881), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 160/321 (49%), Positives = 224/321 (69%), Gaps = 4/321 (1%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFW-DENIENTERK 60
           R+P ++ + + P ++LVLDGGQGTELENRG+ + +P+WSTI F+++ FW DE+  N  RK
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSAN--RK 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            ++EMFNDF  AGA +  T+TYQTSF SVSENT IK+L  Y  LL +I  F R CI ++ 
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           +L+GCIG + A +  E+ GNYG     ID+ +YFKPQLD FN +  +D++GFETIPN HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239
           L+AILSWDE I+++PF+I LS+ +   LRDGT+ E + ++      + N N + +G NC+
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           S+  S D +  LH  +P++ L+AYPNSGE+YD + K W   S    SW+ VV +Y  +G 
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRTTP DI+++  AV
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAV 321

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/320 (51%), Positives = 225/320 (70%), Gaps = 2/320 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           RVP ++++  + ++ILVLDGGQGTELE RG+NI+SP+WST+ F+N+ FW  N  + +RK 
Sbjct: 3   RVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFW-SNSSSNDRKI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           I++M++DF  AGA+V ST TYQTSF+S+SENT+I++L++YHELL +IT F R CI D  Y
Sbjct: 62  IKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G IG YAA + AEY G++G  A  IDY  YFKPQLD FN    IDIIGFETIPN HEL
Sbjct: 122 LVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
            AILS ++  +++PF+I+LS + K  LRDGTS + +  +   ++   N NL+ +G NCI 
Sbjct: 182 RAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIG 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
              S   +  L++ +P   LI YPNSGE YD   K W +      +WE +V+ Y DAG +
Sbjct: 242 LNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGAR 301

Query: 301 IIGGCCRTTPDDIKQIKKAV 320
           I+GGCCRTTP DI+ I +A+
Sbjct: 302 IVGGCCRTTPSDIRSISEAI 321

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  340 bits (872), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 230/324 (70%), Gaps = 1/324 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           MR  F+++ + HPN ++V+DGGQGTELE RGV+++S +WST+ F+  +FW ++ ++    
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            +++MF  F  AG+    ++TYQ SFS++S NT I++L+EY+ELL KI  FCR CI +  
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+G IG YA+ + AEY G+YGL    +DYL YFKPQLD FN++ +ID+I  ET+PNK+E
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240
           L+A+LSWD   I +PF+I+LS+ D   LRDGTS + +  +F   + +N NL+ VG NC+S
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKI-SWEEVVNEYADAGV 299
           Y  ++  I+KL   VP L L+ YPNSGE+YDQ ++ W + + IK+ SWE +V +    GV
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 300 KIIGGCCRTTPDDIKQIKKAVDAL 323
           +++GGCCRTTPDDI +I +AV  L
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAVSHL 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 217/320 (67%), Gaps = 3/320 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R+   K I E+P  +LVLDGGQGTELENRG+NI  P+WS   F +D FW+++  + +R+ 
Sbjct: 3   RISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWEQS--SHDREV 60

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           + EM+ DF +AGANV  T+TYQ +F S+SENT I++L  Y+  L +I  F RR I ++ Y
Sbjct: 61  VEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERY 120

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G IG +AA + +EY GNYG     IDY  +FKPQLD FN + +ID+IGFET+PN HEL
Sbjct: 121 LVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHEL 180

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSW EDII++PF++ LS+ D   LRDGT+ EE+         R NK+L+ +G NCIS
Sbjct: 181 KAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCIS 240

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           +  S   +R LH+ +P   L+ YPNSGE+YD K K W   +    SW+  V  + D+G +
Sbjct: 241 FNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGAR 300

Query: 301 IIGGCCRTTPDDIKQIKKAV 320
           IIGGCCRT+P DI +I  AV
Sbjct: 301 IIGGCCRTSPKDIAEIATAV 320

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 224/320 (70%), Gaps = 2/320 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R+P ++ + ++P ++LVLDGGQGTELENRG+ + +P+WSTI F+++ F   +  ++ RK 
Sbjct: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESF-WSDESSSSRKI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           ++EMFNDF DAGA +  T TYQTS+ SVSENT IK+L EY+ LL +I  F R CI +D Y
Sbjct: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+GCIG + A I  E+ G+YG     ID+ +YFKPQLD FN + N+D+IGFETIPN HEL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240
           +AILSWDE ++++PF+I LS+ +   LRDGT+ +E+ ++      + N N   +G NC+S
Sbjct: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241

Query: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300
           +  S D +  LH  +P + L+AYPNSGE+YD + K W   S    SW+ VV  Y  +G +
Sbjct: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGAR 301

Query: 301 IIGGCCRTTPDDIKQIKKAV 320
           IIGGCCRT+P DI++I  AV
Sbjct: 302 IIGGCCRTSPKDIQEIFTAV 321

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  335 bits (858), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 219/321 (68%), Gaps = 3/321 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           +R+P +K + E   EILVLDGGQGTELENRG+ + +P+WSTI F+++ FW ++  + ERK
Sbjct: 2   VRIPIKKLVIES-KEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDS-SSKERK 59

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            +  +F+DFK +G+N+  T+TYQTSF+S+ ENT  K+L EY+ LL +I  F R CI D+ 
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+G +G + A +  E+ GNYGL    IDY +YFKPQLD FN    ID+IGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239
           L+AILSWDE  I +PF+I LS+ +   LRDGT+ EE+G        + + N + +G NC+
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           S+  S D ++ +H  +P + L+AYPNSGE+YD + K W        SW+ VV  Y D G 
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRT+P DI ++  AV
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAV 320

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  332 bits (851), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/313 (49%), Positives = 217/313 (69%), Gaps = 7/313 (2%)

Query: 14  NEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKCIREMFNDFKDAG 73
           + +LV+DGGQGTELENRG+NI+ P+WST+ F  ++FW+ +   T+R  +  MF  + DAG
Sbjct: 13  DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAG 72

Query: 74  ANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDYLLGCIGAYAASI 133
           A + ST+TYQTS+ ++  +TDI +  +Y +LL +I GFCRRCI DD YL+G IG YAA +
Sbjct: 73  AQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHV 132

Query: 134 GAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILSWDEDIIN 193
           GAEY G+YG    +IDY +YF+PQ+  FN +  IDIIG ET+PN HEL++ILSWDE  I+
Sbjct: 133 GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKIS 192

Query: 194 RPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCISYAYSIDNIRKLHD 253
           +PF+++L + D   LRDGT  E++  LFA     NKNL+ VG NC S + S   +  L++
Sbjct: 193 KPFYVSLCVGDDGNLRDGTPLEQLVPLFANRS--NKNLLLVGINCCSLSVSSQALSHLNE 250

Query: 254 IVPH--LNLIAYPNSGEIYDQKSKQWSSTSAI---KISWEEVVNEYADAGVKIIGGCCRT 308
           I+    + L+ YPNSGEIYD K++ WS  + +   ++SW  +V EY   G + IGGCCRT
Sbjct: 251 ILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAIGGCCRT 310

Query: 309 TPDDIKQIKKAVD 321
           TP DI++I K VD
Sbjct: 311 TPLDIQEICKVVD 323

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  331 bits (848), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 212/319 (66%), Gaps = 2/319 (0%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R+P R++++E P  +LV+DGGQGTELENRG+ + SP+WS   F++   W +  ++ ER  
Sbjct: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQP-DSRERAI 61

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           +  +  DF  AGA V  T+TYQ SF+SV+ NT I +LQ+Y+ LL +I GFCR  + DD Y
Sbjct: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G IGA+ A + AE+ G+YG     IDYL YFKPQLD FN    +D+IGFETIPN HEL
Sbjct: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCISY 241
            AILSWDE +I +PF++ALS+ D   LRDGT   ++  + A     N N + +G NC S 
Sbjct: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSSL 241

Query: 242 AYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVKI 301
           + +   + +LH ++P L +  YPNSGEIYD   K W+++  + + W  VV  Y  +G +I
Sbjct: 242 SRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGARI 300

Query: 302 IGGCCRTTPDDIKQIKKAV 320
           IGGCCRT P+DI+QI  AV
Sbjct: 301 IGGCCRTIPNDIRQIADAV 319

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  325 bits (832), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 221/321 (68%), Gaps = 5/321 (1%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           RVP RK + +   +ILVLDGGQGTE+ENRG+ + +P+WS+I FV++ FW +   + ERK 
Sbjct: 3   RVPLRKVLTDS-RKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEW-SKERKI 60

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121
           + E++ DF  +G+++  T+TYQ SF +++ENT++++L EY+ LL +I  F RRCI D+ Y
Sbjct: 61  VEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERY 120

Query: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181
           L+G +G +AA   +EY G+YGL A  IDY  Y+KPQLD FN    ID+IG ET+PN HEL
Sbjct: 121 LVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHEL 180

Query: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR--NKNLVYVGGNCI 239
           +AILSWDE  I +PF+++L+  D   LRDGT+ E++ + + K  G   N N + +G NC+
Sbjct: 181 KAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQ-YIKCLGNNLNPNFMLLGINCV 239

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           S+  S D +  LH+ +P + L+AYPNSGE+Y+ K K W +      SW+ VV  + ++G 
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 300 KIIGGCCRTTPDDIKQIKKAV 320
           +IIGGCCRT+P DI  +  AV
Sbjct: 300 RIIGGCCRTSPQDIADVSIAV 320

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 215/324 (66%), Gaps = 2/324 (0%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           +RVP +K++ E+P ++LV DGGQG ELE RG++I   LWST  F++  FW +   N  R 
Sbjct: 2   VRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR- 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            ++ MF DF +AGA +  T TYQTSF +VSE+T++KSL+EY+ELL KI GF R CI D+ 
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           YL+G IG+Y A +G EY G+YG     +D+  YFKPQLD F N+  IDI+GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKY-KGRNKNLVYVGGNCI 239
           L+++LSWDE  +++PF+I+LS+ D   LRDGT    +           N NL ++G NC+
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299
           +Y  + + I  +H+ +P + L  +PNSGE+++ +   W++      SWE VV  +  +GV
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 300 KIIGGCCRTTPDDIKQIKKAVDAL 323
           +I+GGCCRT P DI+QI KAV  L
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVKKL 324

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  294 bits (753), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 193/272 (70%), Gaps = 4/272 (1%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFW-DENIENTERK 60
           R+P ++ + + P ++LVLDGGQGTELENRG+ + +P+WSTI F+++ FW DE+  N  RK
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSAN--RK 60

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120
            ++EMFNDF  AGA +  T+TYQTSF SVSENT IK+L  Y  LL +I  F R CI ++ 
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180
           +L+GCIG + A +  E+ GNYG     ID+ +YFKPQLD FN +  +D++GFETIPN HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239
           L+AILSWDE I+++PF+I LS+ +   LRDGT+ E + ++      + N N + +G NC+
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYD 271
           S+  S D +  LH  +P++ L+AYPNSGE+YD
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYD 272

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  258 bits (658), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 167/247 (67%), Gaps = 1/247 (0%)

Query: 75  NVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDYLLGCIGAYAASIG 134
           N   T+TYQTSF SVSENT IK+L  Y  LL +I  F R CI ++ +L+GCIG + A + 
Sbjct: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68

Query: 135 AEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILSWDEDIINR 194
            E+ GNYG     ID+ +YFKPQLD FN +  +D++GFETIPN HEL+AILSWDE I+++
Sbjct: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128

Query: 195 PFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCISYAYSIDNIRKLHD 253
           PF+I LS+ +   LRDGT+ E + ++      + N N + +G NC+S+  S D +  LH 
Sbjct: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188

Query: 254 IVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVKIIGGCCRTTPDDI 313
            +P++ L+AYPNSGE+YD + K W   S    SW+ VV +Y  +G +IIGGCCRTTP DI
Sbjct: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248

Query: 314 KQIKKAV 320
           +++  AV
Sbjct: 249 QEVSAAV 255

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  256 bits (655), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 141/336 (41%), Positives = 209/336 (62%), Gaps = 26/336 (7%)

Query: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61
           R P  ++++   + ILVLDGGQGTE+E RG+++  PLWST+ F+           T    
Sbjct: 3   RQPIAEYLE---SSILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKN-------PTHLNH 52

Query: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTD--IKSLQEYHELLRKITGFCR-RCISD 118
           I+ M++DF  +GA   ST+TYQ SF+++ + +D  + + Q+Y + L  I GF R +CISD
Sbjct: 53  IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISD 112

Query: 119 DDYLLGCIGAYAASI--GAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIP 176
             YL+GC+G YAA +  GAEY G+YG  + KID+ +YFKPQLD F+ D  ID++GFETIP
Sbjct: 113 SQYLIGCVGPYAAYLCNGAEYSGDYG--SEKIDFKQYFKPQLDVFSRDDRIDMVGFETIP 170

Query: 177 NKHELEAILSWD--EDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKY-KGRNKNLVY 233
           N  EL+ +LS D    +  +PF+I++S      LRDGT   ++        K    NL++
Sbjct: 171 NIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLF 230

Query: 234 VGGNCISYAYSIDNIRKLH----DIVPHLNLIAYPNSGEIYDQKSKQWSSTSAI--KISW 287
           +G NC+ Y +S + + +L+    D    L    YPNSGEIYD  +  W + S I  +++W
Sbjct: 231 LGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELTW 290

Query: 288 EEVVNEYADAGVKIIGGCCRTTPDDIKQIKKAVDAL 323
             +V+++A+   ++IGGCCRTTPDDIKQI  AV+ +
Sbjct: 291 NYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNKV 326

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  216 bits (550), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 137/198 (69%), Gaps = 1/198 (0%)

Query: 79  TLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDYLLGCIGAYAASIGAEYD 138
           T TYQTS+ SVSENT IK+L EY+ LL +I  F R CI +D YL+GCIG + A I  E+ 
Sbjct: 2   TTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEFT 61

Query: 139 GNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILSWDEDIINRPFFI 198
           G+YG     ID+ KYFKPQLD FN    +D+IGFETIPN HEL AILSWDE I+++PF+I
Sbjct: 62  GDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFYI 121

Query: 199 ALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCISYAYSIDNIRKLHDIVPH 257
            LS+ +   LRDGT+ EE+ ++      + N N   +G NC+S+  S D +  LH ++P+
Sbjct: 122 GLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLPN 181

Query: 258 LNLIAYPNSGEIYDQKSK 275
           + L+AYPNSGE+YD + K
Sbjct: 182 MALLAYPNSGEVYDTEKK 199

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  217 bits (552), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 127/334 (38%), Positives = 193/334 (57%), Gaps = 31/334 (9%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIEN-TER 59
           MR P ++F     N IL+LDGGQGTELE +GV+I+ PLWST+ F+        I+N T  
Sbjct: 1   MRKPLKEFFK---NNILLLDGGQGTELEKKGVSISHPLWSTLPFI--------IKNKTHL 49

Query: 60  KCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTD--IKSLQEYHELLRKITGFC-RRCI 116
           + I+EM+ DF +AG+N   T+TYQ SFSS+ + ++  + S ++Y   L  + GF  R CI
Sbjct: 50  EAIKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECI 109

Query: 117 SDDDYLLGCIGAYAA--SIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFET 174
           + D YL+G +G YA   S GAEY G YG   GKID++ Y+ PQ+  F     ID+IG ET
Sbjct: 110 TPDKYLVGSVGPYAGLLSNGAEYSGYYG--EGKIDFIDYYSPQVKHFALSPRIDLIGIET 167

Query: 175 IPNKHELEAILS--WDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKG-RNKNL 231
           IPN  E +A+LS  +     ++P++I+++  +   LRDGTS  E+ R   +       N 
Sbjct: 168 IPNIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNF 227

Query: 232 VYVGGNCISYAYSIDNIRKLHDIVPHLNL-------IAYPNSGEIYDQKSKQWSST--SA 282
           V+   NC+ + + ++ ++ L+D +    +        AYPNSGEIY   +  WSS   + 
Sbjct: 228 VFFAINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAG 287

Query: 283 IKISWEEVVNEYADAGVKIIGGCCRTTPDDIKQI 316
            + +WE +          ++GGCCRT  ++I+Q+
Sbjct: 288 PEDTWENLTLGLLSQECLMLGGCCRTGSEEIRQM 321

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  215 bits (547), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 193/337 (57%), Gaps = 29/337 (8%)

Query: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60
           MR+   +++    +EIL+LDGGQGTELE RG+NI  PLWST+ +V         +    K
Sbjct: 1   MRLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYVTK-------DKKHLK 50

Query: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTD--IKSLQEYHELLRKITGFCR-RCIS 117
            I+EM++ F+ AG N   T+TYQ SF S+  ++D  I + +EY   L  +  +   +CIS
Sbjct: 51  IIKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCIS 110

Query: 118 DDDYLLGCIGAYAA--SIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETI 175
            + YL+G +G YAA  S GAEY G+Y      ID++++F+PQ+  F     ID+IG ETI
Sbjct: 111 PNSYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETI 168

Query: 176 PNKHELEAIL--SWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAK-YKGRNKNLV 232
           PN  E +A+L   +      +P++I+++  ++  LRDGT+ +++     +  +    NLV
Sbjct: 169 PNFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLV 228

Query: 233 YVGGNCISYAYSIDNIRKLHDIVPHLNL-------IAYPNSGEIYDQKSKQWSSTSAIKI 285
           + G NC+S+A+  D ++ L+D +  + +         YPNSGE+Y   +  W     I  
Sbjct: 229 FFGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGP 288

Query: 286 --SWEEVVNEYADAGVKIIGGCCRTTPDDIKQIKKAV 320
             +WE + ++    G  +IGGCCRT+P D++QI   V
Sbjct: 289 ADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  210 bits (534), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 136/198 (68%), Gaps = 1/198 (0%)

Query: 79  TLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDYLLGCIGAYAASIGAEYD 138
           T TYQTS+ SVSENT IK+L EY+ LL +I  F R CI ++ YL+GCIG + A I  E+ 
Sbjct: 2   TTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREFT 61

Query: 139 GNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILSWDEDIINRPFFI 198
           G+YG     ID+ +YFKPQLD FN +  +D+IGFETIPN HEL AILSWDE I+++PF+I
Sbjct: 62  GDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFYI 121

Query: 199 ALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCISYAYSIDNIRKLHDIVPH 257
            LS+ +   LRDGT+ EE+ ++      + N N   +G NC+S+  S D +  LH  +P 
Sbjct: 122 GLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALPD 181

Query: 258 LNLIAYPNSGEIYDQKSK 275
           + L+AYPNSGE+YD + K
Sbjct: 182 MALLAYPNSGEVYDTEKK 199

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  202 bits (513), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 176/319 (55%), Gaps = 23/319 (7%)

Query: 16  ILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKCIREMFNDFKDAGAN 75
           +LV+DGG G ELE RG+++ SPLWST  F+         +      IR ++ +F+ AG+ 
Sbjct: 59  VLVMDGGMGVELERRGMDVKSPLWSTAPFLRG-------DRAALDTIRGLYREFRAAGSR 111

Query: 76  VFSTLTYQTSFSS-VSENTDIKSLQEYHELLRKITGFC-RRCI-SDDDYLLGCIGAYAAS 132
             STLTYQ SF S V  +  + S  +Y + L ++  F  R C+    DY++G +G YAA 
Sbjct: 112 GISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAAF 171

Query: 133 I--GAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILS--WD 188
           +  GAEY G+YG     I++  YF+PQ+ +F  D  ID I FET+PN  EL A+L   + 
Sbjct: 172 LCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEFH 229

Query: 189 EDIINRPFFIALSLSDKNGLRDGTSFEEMGRLF-AKYKGRNKNLVYVGGNCISYAYSIDN 247
             + N+PF+I++S  D++ LRDGT    +G+L   +      NL+  G NC+    S   
Sbjct: 230 ALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAAM 289

Query: 248 I----RKLHDIVPHLNLIAYPNSGEIYDQKSKQW-SSTSAIKISWEEVVNEYADAGVKII 302
           +     +L D       I YPN   ++D+    W  S  A  ++W E V  Y +   ++I
Sbjct: 290 LAELNMQLQDCPIKFQAI-YPNGTSVFDESLSAWRPSKDAESLTWAEAVKLYLNQDCRMI 348

Query: 303 GGCCRTTPDDIKQIKKAVD 321
           GGCC TTP D++QI +A+D
Sbjct: 349 GGCCGTTPQDMRQIAEALD 367

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  119 bits (299), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 76/97 (78%), Gaps = 3/97 (3%)

Query: 1  MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFW-DENIENTER 59
          +R+P ++ ++++P ++LVLDGGQGTELENRG+ + +P+WSTI F++D FW DE+  N  R
Sbjct: 2  VRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSAN--R 59

Query: 60 KCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIK 96
          K ++ MFNDF +AGA +  T TYQTS+ SVSENT IK
Sbjct: 60 KIVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  101 bits (252), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (67%)

Query: 228 NKNLVYVGGNCISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISW 287
           N NL ++G NC+S+  S D +  LH  +P++ L+AYPNSGE+YD + K W   S    SW
Sbjct: 9   NPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSW 68

Query: 288 EEVVNEYADAGVKIIGGCCRTTPDDIKQIKKAV 320
           + VV +Y  +G +IIGGCCRT+P DI++I  AV
Sbjct: 69  DTVVKQYISSGARIIGGCCRTSPKDIQEISAAV 101

>AFR041C Chr6 complement(508245..509018) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL155W
          Length = 257

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 201 SLSDKNGLRDGT-SFEEMGRLFAKYKGRNKNLVYVGGNCISYAYSIDNIRKLHDIVPHLN 259
           S+ D+   R+ T + +++ R FAKY  + KN+     N +     I    K  D +PH N
Sbjct: 101 SIKDRLVQRNSTNALDKLKRFFAKYSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPN 160

Query: 260 LI 261
            +
Sbjct: 161 RV 162

>KAFR0E02200 Chr5 complement(436140..437870) [1731 bp, 576 aa] {ON}
           Anc_5.80 YGR246C
          Length = 576

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 234 VGGNCISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNE 293
           + G C+  A  ++N+R+ H  +  ++ +A     E   ++  ++  T+A K+S EE  N 
Sbjct: 226 IAGACVLLACRMNNLRRTHSEIVAVSHVAE----ETLQKRLNEFKHTNAGKLSIEEFRNH 281

Query: 294 YADA 297
            ADA
Sbjct: 282 DADA 285

>SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly
           similar to uniprot|P43601 Saccharomyces cerevisiae
           YFR021W ATG18 Phosphatidylinositol 3 5-
           bisphosphate-binding protein of the vacuolar membrane
           predicted to fold as a seven-bladed beta-propeller
           required for recycling of Atg9p through the pre-
           autophagosomal structure
          Length = 541

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 15/72 (20%)

Query: 241 YAYSIDNIRKLHDI------------VPHL--NLIAYPNSGEIYDQKSKQWSSTSAIKIS 286
           Y Y I N+R LH I             P L  N +AYP+  +I + + K  ++T+ I IS
Sbjct: 114 YIYDISNMRLLHTIETTSNPHGLIAMSPSLDNNYLAYPSPPKIINSEIKDHATTNNINIS 173

Query: 287 WEEV-VNEYADA 297
             EV +N+  D+
Sbjct: 174 SSEVPLNQVLDS 185

>CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} similar
           to uniprot|P47114 Saccharomyces cerevisiae YJR054w
          Length = 524

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 59  RKCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISD 118
           R CIR +F D       VF+ LT  +   +V+   D+  L+ +H L+ KI     + I+D
Sbjct: 155 RNCIRLLFTD---TPRQVFNALTLWSVLVTVNNGADLGRLETFHGLINKI-----KTIAD 206

Query: 119 DDYLLGCIGAY 129
            ++    I ++
Sbjct: 207 TNHAEAVILSF 217

>NDAI0A05510 Chr1 complement(1245160..1247709) [2550 bp, 849 aa]
           {ON} Anc_3.306 YDR057W
          Length = 849

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 42  ISFVNDKFWDENIENT----ERKCIREMFNDFKDAGANV--FSTLTYQTSFSSVSENTDI 95
           I++V  +FWDENI N     +   I E+ ND K   +NV   STL    S  +  E T I
Sbjct: 36  INYVTPQFWDENIANNKSLLDNGSILEVGNDMKCLVSNVTKLSTLEKLRSDQNKYETTLI 95

Query: 96  KSLQEYHELLRK-ITGFC 112
            +L +   ++ K + G C
Sbjct: 96  STLNQGVNIINKALDGHC 113

>TBLA0D03790 Chr4 complement(942926..944476) [1551 bp, 516 aa] {ON}
           Anc_1.495 YJR054W
          Length = 516

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 59  RKCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKI 108
           + CIR +F    D+   V + LT  +   +V  N+D+K LQ ++ L+ +I
Sbjct: 155 KDCIRLLF---ADSPRQVINGLTLWSVLLTVHSNSDLKDLQTFNNLISRI 201

>KLLA0A05434g Chr1 (497874..499544) [1671 bp, 556 aa] {ON} similar
           to uniprot|P29056 Saccharomyces cerevisiae YGR246C BRF1
           TFIIIB B-related factor one of three subunits of RNA
           polymerase III transcription initiation factor TFIIIB
           binds TFIIIC and TBP and recruits RNA pol III to
           promoters amino-terminal half is homologous to TFIIB
          Length = 556

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 63/138 (45%), Gaps = 12/138 (8%)

Query: 158 LDEFNNDMNIDI--IG--FETIPNKHELEAILSWDEDIINRPFFIALSLSDKN--GLRDG 211
           L +F++ + + +  IG  F  +  K ++  +   D  +  + F   L L DK    +RD 
Sbjct: 154 LIDFSSRLQVSVYSIGATFLKLAKKLQIVKLPLADPSLFIQHFAEKLELGDKKIKVIRDA 213

Query: 212 TSFEEMGRLFAKYKGRNKNLVYVGGNCISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYD 271
               +       Y+GR      + G C+  A  ++N+R+ H  +  ++ +A     E   
Sbjct: 214 VKLAQTMSRDWMYEGRRP--AGIAGACLLLACRMNNLRRTHSEIVAISHVAE----ETLQ 267

Query: 272 QKSKQWSSTSAIKISWEE 289
           Q+  ++ +T++ K+S +E
Sbjct: 268 QRLNEFKNTTSAKLSVKE 285

>KNAG0B00310 Chr2 complement(46976..48739) [1764 bp, 587 aa] {ON}
           Anc_1.494 YJR053W
          Length = 587

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 33  NINSPLWSTISFVNDKFWDENIENTERKCIREMFNDF 69
           N+N P+ S I  VND++ DENIEN +   I E  N +
Sbjct: 205 NLN-PIGSPIVEVNDEYADENIENLDDTVIIEPLNSY 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,669,044
Number of extensions: 1933551
Number of successful extensions: 5512
Number of sequences better than 10.0: 56
Number of HSP's gapped: 5578
Number of HSP's successfully gapped: 56
Length of query: 323
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 213
Effective length of database: 40,868,139
Effective search space: 8704913607
Effective search space used: 8704913607
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)