Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002508.840ON62962933860.0
NCAS0C004108.840ON62562121270.0
YMR278W (PGM3)8.840ON62262320840.0
Smik_13.4918.840ON62262120510.0
Kpol_1068.88.840ON63263320310.0
Suva_13.4668.840ON62262220220.0
SAKL0D01474g8.840ON62462620160.0
Skud_13.4508.840ON62262220000.0
NDAI0K004108.840ON62662019920.0
KNAG0J002708.840ON62562619830.0
TDEL0B005708.840ON63062519360.0
TBLA0B032508.840ON64364319340.0
CAGL0M02981g8.840ON61761919190.0
ZYRO0G14190g8.840ON61062019100.0
KLTH0C03872g8.840ON62162819090.0
Kwal_27.102588.840ON62063318950.0
KAFR0B039208.840ON62462518610.0
KLLA0D01573g8.840ON60762518560.0
Ecym_46118.840ON63063617210.0
ABL126W8.840ON62462817190.0
NCAS0F014702.445ON5694911144e-05
KNAG0E023902.445ON5694861144e-05
Kwal_26.76282.445ON570861055e-04
TBLA0B090102.445ON5692971010.001
KLTH0D04796g2.445ON570420980.003
Kpol_1032.26.11ON53983980.003
Smik_5.296.11ON555153950.008
NDAI0H023502.445ON569481930.013
CAGL0B03597g6.11ON54035930.013
CAGL0K03421g2.445ON568554930.014
YEL058W (PCM1)6.11ON557149930.015
TDEL0E00210singletonON570305920.015
TDEL0G046006.11ON52869910.023
TBLA0I013802.445ON571375910.025
TPHA0G029002.445ON569127900.027
NCAS0F002006.11ON54933900.027
NDAI0K028906.11ON56130900.029
KAFR0L003406.11ON54028890.034
TBLA0G009806.11ON55828880.053
ACR015W6.11ON55253880.054
Kwal_56.223556.11ON54153880.057
TPHA0G024702.445ON569128880.059
Suva_11.982.445ON570125870.063
ABL029W2.445ON568123870.064
NCAS0A043502.445ON569127870.069
CAGL0K07480g2.445ON567127860.083
Kpol_1033.542.445ON570132860.084
ZYRO0F00506g6.11ON55024860.091
KLLA0D00858g6.11ON54185860.092
KLTH0C11506g6.11ON54452860.093
ZYRO0G02508g2.445ON569124860.096
TDEL0A022102.445ON572302860.096
Skud_5.316.11ON55735850.11
KNAG0E009406.11ON53824850.12
Suva_5.106.11ON55335850.12
Smik_11.1122.445ON570128840.16
Smik_13.2912.445ON569127830.20
YMR105C (PGM2)2.445ON569127820.23
KLLA0B12694g2.445ON568403820.28
Ecym_24752.445ON567126820.28
KNAG0A062802.445ON57086820.28
SAKL0E00902g6.11ON54419810.33
Skud_11.1022.445ON570125810.34
TPHA0M002106.11ON54598800.42
Skud_13.2632.445ON569127780.71
SAKL0E03630g2.445ON571124780.79
KAFR0D030102.445ON569150780.85
Suva_13.2822.445ON56984780.89
Ecym_30146.11ON55126761.5
KNAG0B017801.271ON158091752.1
Smik_7.203.564ON100490734.0
YKL127W (PGM1)2.445ON57085706.5
Kpol_286.45.510ON24959697.1
KLTH0C11308g6.17ON69050708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00250
         (629 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...  1308   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   823   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   807   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   794   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   786   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   783   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   781   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   775   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   771   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   768   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   750   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   749   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   743   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   740   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   739   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   734   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   721   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   719   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   667   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   666   0.0  
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    49   4e-05
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    49   4e-05
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    45   5e-04
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    44   0.001
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    42   0.003
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    42   0.003
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    41   0.008
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    40   0.013
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    40   0.013
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    40   0.014
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    40   0.015
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    40   0.015
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    40   0.023
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    40   0.025
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               39   0.027
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    39   0.027
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.029
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.034
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    39   0.053
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    39   0.054
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    39   0.057
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    39   0.059
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    38   0.063
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    38   0.064
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    38   0.069
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    38   0.083
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    38   0.084
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.091
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    38   0.092
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    38   0.093
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    38   0.096
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    38   0.096
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.11 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.12 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.12 
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    37   0.16 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    37   0.20 
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    36   0.23 
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    36   0.28 
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    36   0.28 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               36   0.28 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.33 
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    36   0.34 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    35   0.42 
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    35   0.71 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    35   0.79 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    35   0.85 
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    35   0.89 
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    34   1.5  
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    33   2.1  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...    33   4.0  
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    32   6.5  
Kpol_286.4 s286 (11833..12582) [750 bp, 249 aa] {ON} (11833..125...    31   7.1  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...    32   8.3  

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 1308 bits (3386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/629 (100%), Positives = 629/629 (100%)

Query: 1   MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIV 60
           MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIV
Sbjct: 1   MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIV 60

Query: 61  FGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQIT 120
           FGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQIT
Sbjct: 61  FGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQIT 120

Query: 121 AAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNG 180
           AAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNG
Sbjct: 121 AAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNG 180

Query: 181 CQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYI 240
           CQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYI
Sbjct: 181 CQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYI 240

Query: 241 IPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSF 300
           IPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSF
Sbjct: 241 IPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSF 300

Query: 301 PTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIG 360
           PTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIG
Sbjct: 301 PTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIG 360

Query: 361 FLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNK 420
           FLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNK
Sbjct: 361 FLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNK 420

Query: 421 ARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIET 480
           ARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIET
Sbjct: 421 ARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIET 480

Query: 481 GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGY 540
           GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGY
Sbjct: 481 GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGY 540

Query: 541 QSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEA 600
           QSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEA
Sbjct: 541 QSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEA 600

Query: 601 EANRLAKLTWDVLKREWFSSEKTGLTTNF 629
           EANRLAKLTWDVLKREWFSSEKTGLTTNF
Sbjct: 601 EANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/621 (63%), Positives = 487/621 (78%), Gaps = 6/621 (0%)

Query: 12  LSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRME 71
           LS+ PE+L+E I +W R D N+ET  EV +LC NK+  ELH+RFD RIVFGTAGLRSRME
Sbjct: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67

Query: 72  AGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKV 131
           AGF+RMN+L +LQSTQGLA+YIK QFP+NLTAVVGHDHR+HSKEFA +TA++FL AGFKV
Sbjct: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127

Query: 132 YYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKNI 191
           +YL P+D+FVHTP+VPF +    AS+GVMITASHNP+MDNGYKVYY+N CQIIPPHDKNI
Sbjct: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187

Query: 192 AECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYII-PKNISLGTT 250
           AE I+KNLEP S +W+ +A   K +E  KL++ K+ + ++Y++ + + +I   ++SL   
Sbjct: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247

Query: 251 IKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEE 310
              K P+FVYTPMHGVG +IF ++SS  LNL E++DY+ V EQ +PDPSFPTVSFPNPEE
Sbjct: 248 ---KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304

Query: 311 KGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQ 370
           KGAL L IK A+++ + LV+ANDPDADRFS AV N  T +++QLTGNEIGFL  Y+ ++ 
Sbjct: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364

Query: 371 YSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYY 430
           Y      F+   PLAMINSTVSSQMIK+MA++ GF+YEDTLTGFKWIGNKA +L +EGYY
Sbjct: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424

Query: 431 VPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKE 490
           VPFGFEEAIGYMFP MECDKDGI+A  VFLQAY  W    + S FDI+E GF K+GVFKE
Sbjct: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484

Query: 491 YNGYYIVNDLSLTKIIFDNIR-ENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVP 549
           YNGYYI+ DLS+TK +FD IR E  +  +KY S IG E  V  FRDLT+GYQS+T  N+P
Sbjct: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544

Query: 550 TLPVDPSSQMITMTIIPTSLPE-NGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKL 608
            LPVDP+SQMIT+   P+      G+VR T+RGSGTEPKLKVYIEA +K+E  A  LA+ 
Sbjct: 545 NLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARS 604

Query: 609 TWDVLKREWFSSEKTGLTTNF 629
           TWD+LKREWF  E TGLTT+F
Sbjct: 605 TWDILKREWFRPEVTGLTTSF 625

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/623 (61%), Positives = 490/623 (78%), Gaps = 3/623 (0%)

Query: 8   IENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLR 67
           ++ +L ++P DLK+ I +WF+ D N +T++EV  LC     +ELHKRFD RI FGTAGLR
Sbjct: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61

Query: 68  SRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNA 127
           S+M+AGF+RMN L V+Q++QGLA+Y++ QFP NL AVVGHDHR+HSKEFA+ TAA FL  
Sbjct: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLK 121

Query: 128 GFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPH 187
           GFKV+YLNP+ EFVHTP+VPF ++   AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPH
Sbjct: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 188 DKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISL 247
           D  I++ I+ NLEP ++ W+ + V++KA++  KL+YS+E++L+ Y+  + K ++  N  L
Sbjct: 182 DHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEIN-PL 240

Query: 248 GTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPN 307
              +K K PWFVYTPMHGVG+ IF  I    L LVE  DY+CV EQ  PDPSFPTV FPN
Sbjct: 241 KLEVKAK-PWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPN 299

Query: 308 PEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367
           PEEKGALD+GI  A+KH+IDL+VANDPDADRFSVAV++  + E++QLTGNEIGFLFA++ 
Sbjct: 300 PEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYE 359

Query: 368 WEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKE 427
           +++Y  +  +F+   PLAM+NSTVSSQMIKKMAE+EGF+YEDTLTGFKWIGN+A  LEK+
Sbjct: 360 YQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKK 419

Query: 428 GYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGV 487
           GYYVPFGFEEAIGYMFP ME DKDGI+A++VFLQAY  W +++     +++E GFKKYGV
Sbjct: 420 GYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGV 479

Query: 488 FKEYNGYYIVNDLSLTKIIFDNIRE-NKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIG 546
           FKEYNGYY+V + ++TK IFD IR     +   Y S IG E +V+ +RDLT GYQSDTI 
Sbjct: 480 FKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTIN 539

Query: 547 NVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLA 606
           + PTLPVDP+SQMIT++  P++  EN  +RFTIRGSGTEPKLKVYIEA A  E  A+ LA
Sbjct: 540 HKPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLA 599

Query: 607 KLTWDVLKREWFSSEKTGLTTNF 629
           KLTW+VL+REWF  ++  + T F
Sbjct: 600 KLTWNVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/621 (61%), Positives = 477/621 (76%), Gaps = 3/621 (0%)

Query: 10  NLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSR 69
             L ++P +LKE I +WF  D N ET++EV  LC     +ELH+RFD RI FGTAGLRS+
Sbjct: 4   QFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQ 63

Query: 70  MEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGF 129
           M+AGFNRMN L ++Q++QGLA+Y K QFP+NL AVVGHDHR+HSKEFA+ TA  FL  GF
Sbjct: 64  MQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGF 123

Query: 130 KVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDK 189
           KV+YLNP+ EFVHTP+VPF ++   AS+GVM+TASHNP+MDNGYKVYY+NGCQIIPPHD 
Sbjct: 124 KVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 190 NIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGT 249
            I++ I+ NLEP ++ WN + V++K ++  KL+YS+E++L+ Y+  + K ++  +  L  
Sbjct: 184 AISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTD-PLKF 242

Query: 250 TIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPE 309
            +K K PWFVYTPMHGVG+ IF  I    ++LVE  DY+CV EQ  PDPSFPTV+FPNPE
Sbjct: 243 EVKAK-PWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPE 301

Query: 310 EKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWE 369
           EKGALDLGI  A+ H I+L++ANDPDADRFSVA+++  + E++QLTGNEIGFLFA F ++
Sbjct: 302 EKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQ 361

Query: 370 QYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGY 429
           ++  +   F+   PLAM++STVSSQMIKKMAEVEGF+YE+TLTGFKWIGN+A  LEKEGY
Sbjct: 362 KFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGY 421

Query: 430 YVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFK 489
           YVPFGFEEAIGYMFP ME DKDG++A++VFLQAY  W +++      I+E GFKKYGVFK
Sbjct: 422 YVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFK 481

Query: 490 EYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGNV 548
           EYNGYYIV+   +T  IFD IR     K   Y S IG E +V+ +RDLT+GYQSDT  + 
Sbjct: 482 EYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHK 541

Query: 549 PTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKL 608
           PTLP+DPSSQMIT++  P+   E   +RFTIRGSGTEPK+KVYIEA A  E  A  LAKL
Sbjct: 542 PTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKL 601

Query: 609 TWDVLKREWFSSEKTGLTTNF 629
           TW+VLKREWF  EK  + T+F
Sbjct: 602 TWNVLKREWFRPEKMDIVTHF 622

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/633 (60%), Positives = 488/633 (77%), Gaps = 5/633 (0%)

Query: 1   MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIV 60
           M  S+ E +++L ++P DL++K+  W   D N ET++EV  LC   SL+ELHKRFD RI+
Sbjct: 1   MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL 60

Query: 61  FGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQIT 120
           FGTAGLRS+MEAGF+RMN L VLQ+TQGLA+YIK QFPSNL AV+GHDHRYHSKEFA+I 
Sbjct: 61  FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA 120

Query: 121 AAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNG 180
            +VFL+AGF VY LNP   FVHTP+VPF ++   AS+GVMITASHNP+MDNGYKVYY+NG
Sbjct: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG 180

Query: 181 CQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYI 240
           CQIIPP D +IA+CI++NLEP S++W++   I   + N KLIY + ++L  Y   +D  I
Sbjct: 181 CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI 240

Query: 241 IPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSF 300
           I K  ++    + +KPWFVYTPMHGVGY+IF  +    +NL E+ DY+ VKEQIVPDP+F
Sbjct: 241 IDKK-TIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAF 299

Query: 301 PTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIG 360
           PT+SFPNPEEKGALD+ I  AK+++I LV+ANDPDADRFS A+ N  + E+QQLTGNEIG
Sbjct: 300 PTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIG 359

Query: 361 FLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNK 420
           FLF Y+L+ +Y+ +  +FK   PLAM+NSTVSS+M+K MA+ E F + DTLTGFKWIGNK
Sbjct: 360 FLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNK 419

Query: 421 ARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIET 480
           A +L+KEGY+V FG+EEAIGYMFP ME DKDGITA+VVFLQAY+ W   +K ++ DI+E 
Sbjct: 420 AIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQ 479

Query: 481 GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIR-ENKNDKEKYVSHIGTEFKVITFRDLTLG 539
           G +KYG FKEYNGYY+V++  +T  IF  IR E   +  +Y   IGT  +V +FRDLT G
Sbjct: 480 GIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTG 539

Query: 540 YQSDTIGNVPTLPVDPSSQMITMT--IIPTSLPENGS-VRFTIRGSGTEPKLKVYIEANA 596
           +QSDT+ N+P+LPVDPSSQMIT+T  I      ++ S VRFT+RGSGTEPKLK+YIE ++
Sbjct: 540 FQSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHS 599

Query: 597 KTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629
           K    A+++AKLTWDVLK+EW   E TG+TT++
Sbjct: 600 KDPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/622 (61%), Positives = 470/622 (75%), Gaps = 3/622 (0%)

Query: 9   ENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRS 68
           + LL ++P DLK  I +WF  D N ET++EV  LC N   DELHKRFD RI FGTAGLRS
Sbjct: 3   QQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRS 62

Query: 69  RMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAG 128
            M+AGF+RMN L ++Q+TQGLA+YIK QFP NL  VVGHDHR+HSKEFA+ TA  FL  G
Sbjct: 63  EMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKG 122

Query: 129 FKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188
           FKV+YLNP+ EFVHTP+VPF ++   AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPHD
Sbjct: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248
             I++ I+ NLEP ++ W    V++KA++  KL+YS+E++L  Y   + K ++  N  L 
Sbjct: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETN-PLK 241

Query: 249 TTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNP 308
             IK K PWFVYTPMHGVG+ IF  I    ++LVE  DY+CV EQ  PDPSFPTV FPNP
Sbjct: 242 LEIKAK-PWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 309 EEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLW 368
           EEKGALD+G++ A++H+I+L+VANDPDADRFS+AV++  + +++QLTGNEIGFLFA+F +
Sbjct: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360

Query: 369 EQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEG 428
           ++Y     +F+   PLAM++STVSSQMIKKMAEVEGF YEDTLTGFKWIGN+A  LEKEG
Sbjct: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420

Query: 429 YYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVF 488
           YYVPFGFEEAIGYMFP ME DKDGI+A VV LQAY  W +++     DI+E GF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480

Query: 489 KEYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGN 547
           KEYNGYY+V    +T  IF+ IR         Y   IG E +V+ +RDLT GYQSDT  +
Sbjct: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540

Query: 548 VPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAK 607
            P LPVDP+SQMIT++  P+    N  +RFTIRGSGTEPKLKVYIEA A  E  A+ LAK
Sbjct: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600

Query: 608 LTWDVLKREWFSSEKTGLTTNF 629
           LTWDVL+R WF  E   +TT+F
Sbjct: 601 LTWDVLRRGWFRPEIMNITTDF 622

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/626 (61%), Positives = 462/626 (73%), Gaps = 16/626 (2%)

Query: 13  SSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEA 72
           +++P+DLKE + +W  YD N ET  E+  L   K  +ELH R D+RI FGTAGLRSRMEA
Sbjct: 6   TTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEA 65

Query: 73  GFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVY 132
           GF+RMN LTVLQ++QGLASYIKSQFP NL+ +VGHDHRYHS EFA++T   FL  GFKVY
Sbjct: 66  GFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVY 125

Query: 133 YLN-----PNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPH 187
           YLN       + FVHTPMVPF IN  +AS G+MITASHNP+MDNGYKVYY+NGCQIIPPH
Sbjct: 126 YLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPH 185

Query: 188 DKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISL 247
           D+ I+E I++NL P +  W+ + VI  AIE+  L   KE V  +Y+  +   ++   +  
Sbjct: 186 DRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM-- 243

Query: 248 GTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPN 307
              +   KPWFVYTPMHGVG++IF +I+   L L E   YVCV EQ  PDP+FPTVSFPN
Sbjct: 244 ---LDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300

Query: 308 PEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367
           PEEKGALDL I  A++ +I LV+ANDPDADRFSVAV+N   D + QLTGNEIGFLFAY+ 
Sbjct: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQ 358

Query: 368 WEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKE 427
           W+ Y  L   FK + PLAMINSTVSSQMIK +AE E F+YEDTLTGFKW+GN+A ELE +
Sbjct: 359 WQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQ 418

Query: 428 GYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGV 487
           GYYVPF +EEAIGYMFP++E DKDGI+A VVFLQ Y  W   ++ +   +++ GF KYGV
Sbjct: 419 GYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGV 478

Query: 488 FKEYNGYYIVNDLSLTKIIFDNIRENKN-DKEKYVSHIGTEFKVITFRDLTLGYQSDTIG 546
           FKEYNGYYIV  LSLTK +FD IRE+       Y   IG+EF VI+FRDLT GYQSDTI 
Sbjct: 479 FKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTID 538

Query: 547 NVPTLPVDPSSQMITMTIIPTSLPENGS---VRFTIRGSGTEPKLKVYIEANAKTEAEAN 603
           NVP LPVD SSQMIT T+ P++  E+ S   VRFTIRGSGTEPKLKVYIEA +  E  A 
Sbjct: 539 NVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQ 598

Query: 604 RLAKLTWDVLKREWFSSEKTGLTTNF 629
            LA+ TW VL+REWF  E+TGL T F
Sbjct: 599 HLARETWQVLRREWFRPERTGLETKF 624

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/622 (61%), Positives = 478/622 (76%), Gaps = 3/622 (0%)

Query: 9   ENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRS 68
           +  L +IP DLK  I +WF  D + ET++EV  LC     DELHKRFD RI FGTAGLRS
Sbjct: 3   QQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRS 62

Query: 69  RMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAG 128
           +M+AGF+RMN L ++Q++QGLA+YI+ QFP+NL AVVGHDHR+HSK+FA+ TA  FL  G
Sbjct: 63  QMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKG 122

Query: 129 FKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188
           FKV+YLNP  EFVHTP+VPF ++  +AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPHD
Sbjct: 123 FKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248
           + I+  I+ NLEP ++ WN + ++SK ++  KL+YS+E++L+ Y+  +   ++ +   L 
Sbjct: 183 QAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLV-ETTPLK 241

Query: 249 TTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNP 308
             ++ K PWFVYTPMHGVG+ IF  I    + LVE  DY+CV EQ  PDPSFPTV FPNP
Sbjct: 242 LEVRSK-PWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 309 EEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLW 368
           EEKGAL++G++ A+KH+I L++ANDPDADRFSVA+++  +  +QQLTGNEIGFLFA+F +
Sbjct: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEF 360

Query: 369 EQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEG 428
           E++  +   F+   PLAM++STVSSQMIK+MAEVEGF+YEDTLTGFKWIGN+A  LEKEG
Sbjct: 361 EKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420

Query: 429 YYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVF 488
           YYVPFGFEEAIGYMFP ME DKDGI+A+VVFLQAY  W + N     +++E GFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480

Query: 489 KEYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGN 547
           KEYNGYYIV +  +TK IF  IR+    +   Y  +IG E +V+ +RDLT GYQSDT+ +
Sbjct: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540

Query: 548 VPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAK 607
            PTLPVDP+SQMIT+   P     N  +RFTIRGSGTEPKLKVYIE  A  E  A+ LAK
Sbjct: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600

Query: 608 LTWDVLKREWFSSEKTGLTTNF 629
           LTWDVL+REWF  EKT +TTNF
Sbjct: 601 LTWDVLRREWFRPEKTNITTNF 622

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/620 (61%), Positives = 468/620 (75%), Gaps = 2/620 (0%)

Query: 11  LLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRM 70
           +    P +L+E I +W R D  +ET +EV +LC + +  ELHKRFD RIVFGTAGLRSRM
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 71  EAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFK 130
           EAGF+RMN L +LQ++QGLA YIK+QFP+NLTAVVGHDHR+HSK+FA ITA+VFL  GFK
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 131 VYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKN 190
           VYYLNP D FVHTP+VPF +N  +ASIGVMITASHNP+MDNGYKVYY+NGCQIIPPHDKN
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 191 IAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGTT 250
           IA  I++NLEP S +WN ++   K ++  KL+Y +E++  +Y+  +   ++  +IS    
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 251 IKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEE 310
             GKKPWFVYTPMHGVGY IF +IS   L+  E++DY  VKEQ+ PDP+FPTVSFPNPEE
Sbjct: 248 -NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEE 306

Query: 311 KGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQ 370
           KGAL L  K A+++NI LV+ANDPDADRFSVA +N  T ++QQL+GNEIGFLFA F  E+
Sbjct: 307 KGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEK 366

Query: 371 YSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYY 430
           Y     +++   PLAMINSTVSSQMIKKMA+VE F+YEDTLTGFKWIGN+A +L+ +GYY
Sbjct: 367 YMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYY 426

Query: 431 VPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKE 490
           VPFGFEEAIGYMFP M  DKDG++A VVFL AY  W  N+    FDI+E GFKK+G FKE
Sbjct: 427 VPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKE 486

Query: 491 YNGYYIVNDLSLTKIIFDNIR-ENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVP 549
           YNGYYI +D   TK IFD +R +       Y  +IG EFK+  FRDLT GYQS+TI N+P
Sbjct: 487 YNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLP 546

Query: 550 TLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLT 609
            LPVDP S+MIT+  +P        VRFT+RGSGTEPKLK+YIEA A  E  A  LA   
Sbjct: 547 NLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEM 606

Query: 610 WDVLKREWFSSEKTGLTTNF 629
           W+VLK+EW   + TGLTT F
Sbjct: 607 WNVLKKEWIRPDVTGLTTTF 626

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/626 (59%), Positives = 466/626 (74%), Gaps = 3/626 (0%)

Query: 5   DQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTA 64
           D+   ++L + PE L+ +I  W R D N+ET  EV +LC  +   EL+ RF QRI+FGTA
Sbjct: 2   DKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTA 61

Query: 65  GLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVF 124
           GLRSRMEAG NR+N+L +LQ+TQGLA YI SQFP N  AVVGHDHR+HSKEFA +TAAVF
Sbjct: 62  GLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVF 121

Query: 125 LNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184
           L AGFKV YLNP D  VHTP+VPF ++  +AS+GVMITASHNP+MDNGYKVY+ NGCQII
Sbjct: 122 LRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQII 181

Query: 185 PPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKN 244
           PPHD NIA  I++NLEP   +W+   VI  A +  +++Y K+ + Q Y    +  +I   
Sbjct: 182 PPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGR 241

Query: 245 ISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVS 304
             L     G  PWFVYTPMHGVG +IF RIS   L + E+ DY+CV EQ  PDPSFPTVS
Sbjct: 242 KVLRN--PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVS 299

Query: 305 FPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFA 364
           FPNPEEKGALD  I+ A ++ I+LV+ANDPDADRFS+AV +  T  ++QLTGNEIGFLFA
Sbjct: 300 FPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFA 359

Query: 365 YFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKAREL 424
           Y  +E Y  +   F+ + PL ++NSTVSSQMIKKMAEVEGF+YEDTLTGFKWIGN+AR+L
Sbjct: 360 YQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDL 419

Query: 425 EKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKK 484
           EK+G++ PFG+EEAIGYMF +ME DKDGI+A+++FL +YY W  +  +   DI+E G+KK
Sbjct: 420 EKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKK 479

Query: 485 YGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDT 544
           YGVFKEYNGYYIV++  + K  FD IR ++    +Y   IG+EF+V++FRDLTLG+QSDT
Sbjct: 480 YGVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDT 539

Query: 545 IGNVPTLPVDPSSQMITMTIIPT-SLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEAN 603
             ++PTLPVDP+SQMIT+   PT    E   VRFTIRGSGTEPKLKVYIEA + +E  A 
Sbjct: 540 SDHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQ 599

Query: 604 RLAKLTWDVLKREWFSSEKTGLTTNF 629
           +LAK  WD L+  WF  + TGL T+F
Sbjct: 600 QLAKQMWDTLQEVWFRPQTTGLVTDF 625

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/625 (58%), Positives = 460/625 (73%), Gaps = 9/625 (1%)

Query: 9   ENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRS 68
           + +++S+P DL + +  W   D N++T  E+  LC  K   ELHKR D RI+FGTAGLRS
Sbjct: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70

Query: 69  RMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAG 128
           RMEAGF+RMN L VLQ+TQGLA +IK QFP  LTAVVGHDHR++S+EFA  T A FL AG
Sbjct: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130

Query: 129 FKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188
           FKV +LN  D+FVHTP+VPF +N   AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPHD
Sbjct: 131 FKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190

Query: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248
             IA+ IE+NL      W  + ++ + ++   L+Y+ E+++++Y   + + ++ +     
Sbjct: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDR----- 245

Query: 249 TTI---KGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSF 305
           TTI   K  KPWFVYTP+HGVGY IF +I+   +NL+   DY+CVKEQ +PDPSFPTV F
Sbjct: 246 TTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPF 305

Query: 306 PNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAY 365
           PNPEEKGALD+ I  A K+ I LV+ANDPDADRFS AV++  T  ++QLTGNEIG LFA+
Sbjct: 306 PNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAF 365

Query: 366 FLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELE 425
           + +++Y     ++K+K PLAM+NSTVSSQ+I KMAE+E F+Y DTLTGFKWIGN+  +LE
Sbjct: 366 YEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLE 425

Query: 426 KEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKY 485
              YYVPFGFEEAIGYMFP ME DKDGI+A  VFLQ Y  W + +K++L  ++E  F+KY
Sbjct: 426 AMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKY 485

Query: 486 GVFKEYNGYYIVNDLSLTKIIFDNIRENKND-KEKYVSHIGTEFKVITFRDLTLGYQSDT 544
           GVFKEYNGYY VND  + K +FD IR + ++  + Y S IG E KV  FRDLTLGYQSDT
Sbjct: 486 GVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDT 545

Query: 545 IGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANR 604
           +   P LPVDP+SQMIT            SVRFTIRGSGTEPKLKVYIEA +K+E  A+ 
Sbjct: 546 VNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASE 605

Query: 605 LAKLTWDVLKREWFSSEKTGLTTNF 629
           LA+LTW VLKREWF  + TGLTT F
Sbjct: 606 LAQLTWRVLKREWFRPDVTGLTTTF 630

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/643 (58%), Positives = 473/643 (73%), Gaps = 21/643 (3%)

Query: 5   DQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTA 64
           +Q+   L+   PEDL++K+ +W   D +  T  E+ +LC + ++ ELH+RFD RI FGTA
Sbjct: 4   EQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTA 63

Query: 65  GLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSN---LTAVVGHDHRYHSKEFAQITA 121
           GLRS MEAGF+RMN LTVLQ++QGLA+Y+K+   +    L AV+GHDHRYHSKEFA+I A
Sbjct: 64  GLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAA 123

Query: 122 AVFLNAGFKVYYLN------PND-EFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYK 174
            VFL AGFKVYYLN      P D +FVHTPMVPF +    AS+GVM+TASHNP+MDNGYK
Sbjct: 124 TVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYK 183

Query: 175 VYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYML 234
           VYY+NGCQIIPPHD  I++CI+ NLEP  ++WN + +++ A     LIY ++ +L  Y+ 
Sbjct: 184 VYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYIT 243

Query: 235 NLDKYIIPKNI-SLGTTIKGK-KPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKE 292
            L++ +  K+I  L   I  K KPWFVYTPMHGVGY+IF +IS+  L++ E  D++ V+E
Sbjct: 244 QLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEE 303

Query: 293 QIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTD-EF 351
           Q  PDP FPTVSFPNPEEKGA+D+GIK A+ + I LV+ANDPDADRFS+AV++  +   +
Sbjct: 304 QKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTW 363

Query: 352 QQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTL 411
            Q TGNEIG+LFAYF +++Y +   D      L M+NSTVSSQMIKKMAE+EGF YE+TL
Sbjct: 364 HQFTGNEIGYLFAYFEFQKYKISKQDLHR---LYMVNSTVSSQMIKKMAEIEGFNYEETL 420

Query: 412 TGFKWIGNKARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNK 471
           TGFKWIGN+A +L  +G  VPFG+EEAIGYMFP ME DKDGI ATV+F+QA+  W   +K
Sbjct: 421 TGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDK 480

Query: 472 QSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIREN-----KNDKEKYVSHIGT 526
              ++II+ GFKKYGVF EYNGYY   DL +TK IFD +R +         +KY  HIG 
Sbjct: 481 MDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGE 540

Query: 527 EFKVITFRDLTLGYQSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEP 586
           EFK+I +RDLT GYQSDT  N P LPVDPSSQMIT+ +IPT    +GS+R TIRGSGTEP
Sbjct: 541 EFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEP 600

Query: 587 KLKVYIEANAKTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629
           KLKVYIEA +++  EA+ LAK  W+VLKREW   E+TG+TT F
Sbjct: 601 KLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/619 (58%), Positives = 458/619 (73%), Gaps = 7/619 (1%)

Query: 13  SSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEA 72
           + IP +L+  I  W + D N+ET +EV +LC +++ DELHKRFD RIVFGTAGLR+RMEA
Sbjct: 4   TDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEA 63

Query: 73  GFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVY 132
           G NR+N L +LQ++QGLA+YIK +FP NLTAVVGHDHRYHS+EFAQ+TAA F+ AGFKVY
Sbjct: 64  GTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVY 123

Query: 133 YLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKNIA 192
           YLNP+DEFVHTPMVP+ ++  +AS+GVMITASHNP+MDNGYKVYY NGCQIIPPHD  IA
Sbjct: 124 YLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIA 183

Query: 193 ECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGTTIK 252
           E I  NLEP S +WN   ++S A  + K+ Y ++ +L  Y+ ++   +I ++ +      
Sbjct: 184 ETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFA----AP 239

Query: 253 GKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKG 312
            +KPWFVYTPMHGVG+QIF  I +  LNL ++IDY+ V EQ  PDPSF TVSFPNPEEKG
Sbjct: 240 DEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKG 299

Query: 313 ALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYS 372
           AL+L I  A+ + I LV+ANDP+ADRFSVAVR+   +E++QLTGNEIG LFA++ ++ Y 
Sbjct: 300 ALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQ 359

Query: 373 MLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYYVP 432
                     PLAM+NSTVS+Q+IK+MAE EGF Y+DTLTGFKWIGN+A +LE++GY+VP
Sbjct: 360 KAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVP 419

Query: 433 FGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKEYN 492
           FG+EEAIGYMFP ME DKDG++A +VFLQAY  W  ++   + DII   + KYGV  EYN
Sbjct: 420 FGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPI-DIIHECYDKYGVSAEYN 478

Query: 493 GYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGNVPTL 551
           GYYIV+D S T  +F++IR +       +   IG  F+V  FRDLT+G+ S T    P L
Sbjct: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538

Query: 552 PVDPSSQMITMTIIPTSLPENG-SVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLTW 610
           PVD +SQMIT+T +P+     G SVRFTIRGSGTEPKLKVYIE  + TE  A  LAK  W
Sbjct: 539 PVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLW 598

Query: 611 DVLKREWFSSEKTGLTTNF 629
           + LK EWF     GL+T+F
Sbjct: 599 ETLKHEWFKPSSNGLSTDF 617

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/620 (58%), Positives = 454/620 (73%), Gaps = 11/620 (1%)

Query: 11  LLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRM 70
           + S+IPE+LK+ I +W   D N++T  E+ ELC  ++  ELH+R + R+ FGTAGLR+RM
Sbjct: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60

Query: 71  EAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFK 130
           EAGF+RMN L V+Q+TQGLA YIK QFP +L AVVGHDHR++S +FA+ TA V L AGF+
Sbjct: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120

Query: 131 VYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKN 190
           V+YLN  D +VHTPMVPF ++   AS+GVMITASHNP++DNGYKVYY NGCQIIPPHD  
Sbjct: 121 VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA 180

Query: 191 IAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGTT 250
           IA  IE NLEP +  W+ +  + +A +  KLIY ++ +L+QY+  +    +     L + 
Sbjct: 181 IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV---TELDSL 237

Query: 251 IKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEE 310
            KG KPWFVYTPMHGVGYQ+F +I+S  L L  + D++ V EQ+ PDP FPTV FPNPEE
Sbjct: 238 PKG-KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEE 296

Query: 311 KGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQ 370
           KGALDL IK A+ H I LV+A+DPDADRFSVA + P    +QQL+GN+IGFLFAY+  ++
Sbjct: 297 KGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGP--HGWQQLSGNDIGFLFAYYELQK 354

Query: 371 YSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYY 430
           Y    A+++   PLAM+NSTVSSQMI  MA +EGF++EDTLTGFKWIGN+A ELE  GYY
Sbjct: 355 YRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYY 414

Query: 431 VPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKE 490
           VPFGFEEAIGYMFP  E DKDGI+A VVFLQAY+ W    K  L DI++    KYGVF+E
Sbjct: 415 VPFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPL-DILDEASAKYGVFRE 473

Query: 491 YNGYYIVNDLSLTKIIFDNIRENKNDK-EKYVSHIGTEFKVITFRDLTLGYQSDTIGNVP 549
           YNGYY+V++ SLT   F  IRE+   K E Y   IG + +V TFRDLT GYQSDT  N+P
Sbjct: 474 YNGYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIP 532

Query: 550 TLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLT 609
            L VDPSSQMIT+   P        VRFT+RGSGTEPKLKVYIEA A+++  A  LA+ T
Sbjct: 533 NLHVDPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQT 592

Query: 610 WDVLKREWFSSEKTGLTTNF 629
           WD+L+ EWF+  + GLTT F
Sbjct: 593 WDILREEWFN--RPGLTTKF 610

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/628 (58%), Positives = 460/628 (73%), Gaps = 24/628 (3%)

Query: 13  SSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEA 72
           + +PEDLK  +  W +YD N++T D++ +L  +KS  EL  R + RI FGTAGLRSRMEA
Sbjct: 7   AEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEA 66

Query: 73  GFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVY 132
           GFNRMN LTVLQ++QGLA YI S FP NL+ VVGHDHR++SK+FA++T   FL  GFKVY
Sbjct: 67  GFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVY 126

Query: 133 YLN-----PNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPH 187
            L        D  VHTPMVPFGI+   AS G+MITASHNP+MDNGYKVYY+NGCQIIPPH
Sbjct: 127 DLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPH 186

Query: 188 DKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISL 247
           D+ I++ I  NLEP    W+  AV ++A+++  LI +K+ ++ QY+  + + ++  N++ 
Sbjct: 187 DQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVN- 245

Query: 248 GTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPN 307
                 K PWFVYTP+HGVG++IF +I S+   L +  DY+CV+EQ  PDP+FPTVSFPN
Sbjct: 246 ----HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPN 301

Query: 308 PEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367
           PEEKGALD  I+ A+KH+I  V+ NDPDADRFSVA ++    +++QLTGNEIGFLFA + 
Sbjct: 302 PEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKH--NGQWRQLTGNEIGFLFAQYK 359

Query: 368 WEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKE 427
           WE Y +    FK   PLAMINSTVSSQMIKKMAEVEGF+YEDTLTGFKW+GN+ARELE  
Sbjct: 360 WETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENA 419

Query: 428 GYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSL--FDIIETGFKKY 485
           GY+VPF +EEAIGYMF  +  DKDGI+A VVFLQ  + W     Q+L  FD+++  ++KY
Sbjct: 420 GYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW---KAQALTPFDVLQRAYQKY 476

Query: 486 GVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTI 545
           GVFKEYNGYYIV DLSLT  +F  IR   + +    +HIG EF+V ++ DLT GYQS+T 
Sbjct: 477 GVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQP---THIGQEFRVESYTDLTTGYQSNTP 533

Query: 546 GNVPTLPVDPSSQMITMTIIPTSLPE----NGSVRFTIRGSGTEPKLKVYIEANAKTEAE 601
            + P LPVDPSSQMIT T+ PTS       + SVRFT RGSGTEPKLKVYIEA + +E  
Sbjct: 534 DSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEEL 593

Query: 602 ANRLAKLTWDVLKREWFSSEKTGLTTNF 629
           A+ LAK  WDVL+REWF  E+TGL TNF
Sbjct: 594 ASALAKKAWDVLRREWFKPEQTGLATNF 621

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/633 (56%), Positives = 456/633 (72%), Gaps = 24/633 (3%)

Query: 8   IENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLR 67
           +E++   IP DLK  +  WF +D N+ET +E+ +L   ++ +ELHKR DQRI FGTAGLR
Sbjct: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60

Query: 68  SRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNA 127
           S+MEAGF+RMN LTVLQ++QGLA YI  +FP N T  VGHDHR++S++FA++T+  FL  
Sbjct: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120

Query: 128 GFKVYYLNPN-----DEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQ 182
            FKVY L  N     D FVHTPMVPF I+   AS GVMITASHNP+MDNGYKVYY+NGCQ
Sbjct: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180

Query: 183 IIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIP 242
           IIPPHD+ IA+ I  NL P    W+ +AVI++A E    +  K+ ++  Y+  +   ++ 
Sbjct: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240

Query: 243 KNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPT 302
            +I         KPWFVYTP+HGVG++IF RI+S  L LVE  DY CV E   PDP+FPT
Sbjct: 241 SDIG-----DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPT 295

Query: 303 VSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFL 362
           VSFPNPEE GALDL I  A K+ I  V+ NDPDADRFS AV++    +++QLTGNEIGFL
Sbjct: 296 VSFPNPEEAGALDLAIALADKNGISFVLGNDPDADRFSAAVKH--QGKWRQLTGNEIGFL 353

Query: 363 FAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKAR 422
           FA F+WE+Y    ++FK + PLA+INSTVSSQMIKK+A VE F+YEDTLTGFKW+GN+AR
Sbjct: 354 FAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRAR 413

Query: 423 ELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSL--FDIIET 480
           +LE  GYYVPF +EEAIG+MF  +  DKDG++A VVFLQ  + W    KQ+L   D++++
Sbjct: 414 QLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSW---KKQALSPIDVLQS 470

Query: 481 GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGY 540
            F KYGVFKEYNGYY V DLSLT  IF +IR + +    Y  HIG +F V++F DLT G+
Sbjct: 471 AFGKYGVFKEYNGYYTVPDLSLTDRIFSDIRSSYD---SYPKHIGNQFDVVSFTDLTKGF 527

Query: 541 QSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGS----VRFTIRGSGTEPKLKVYIEANA 596
           QSDT  N P LPVDPSSQMI  T++P++   +G+    VRFT RGSGTEPKLKVYIEA +
Sbjct: 528 QSDTADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATS 587

Query: 597 KTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629
             E  A+ LA+ TW+VL+ EWF  ++TGL+T F
Sbjct: 588 VEETRASDLARTTWNVLRDEWFKPKETGLSTKF 620

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/625 (57%), Positives = 450/625 (72%), Gaps = 11/625 (1%)

Query: 10  NLLSSIPEDLKEKIRV----WFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAG 65
           N+LS I E + E+++V    W RYD N+ET  E+  +   K   EL  R + RI FGTAG
Sbjct: 6   NILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAG 65

Query: 66  LRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFL 125
           LR RMEAGF RMN+L +LQ++QGLA YI  +FP NL+ VVGHDHRYHSKEFA IT A FL
Sbjct: 66  LRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFL 125

Query: 126 NAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIP 185
           NAGFKV+YLN  +EFVHTP+VP+ ++   ++ GVMITASHNP+ DNGYKVYY+NGCQIIP
Sbjct: 126 NAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIP 185

Query: 186 PHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNI 245
           PHDKNIA  IEKNL P S +WN + + S    N  L ++   +   Y+ ++ +Y+     
Sbjct: 186 PHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGS 245

Query: 246 SLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSF 305
            +   +K  KPWFVYTPMHGVG++IF +I+   L L E++DY  V EQI PDPSFPTVSF
Sbjct: 246 PM---LKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSF 302

Query: 306 PNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAY 365
           PNPEEKGALD+ I+ A++  + L++ANDPDADRFS AV++  + E++QL+GNEIG LFA 
Sbjct: 303 PNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAI 362

Query: 366 FLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELE 425
           F  +++    A  K   PLAM+NSTVSSQM+KKMA+VEGF+YE+TLTGFKWIGN+A +LE
Sbjct: 363 FKLQEHKEKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLE 419

Query: 426 KEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKY 485
           ++GY V FG+EEAIGYMFP ME DKDGI A+VVFL  Y  W         D+++  F+KY
Sbjct: 420 QQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKY 479

Query: 486 GVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEK-YVSHIGTEFKVITFRDLTLGYQSDT 544
           GVF EYNGYY V + +L + +F  IR+    K + Y   +G EF + +FRDLTLGYQSDT
Sbjct: 480 GVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDT 539

Query: 545 IGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANR 604
           I   PTLPVD SSQMIT T+ P     +  +RFTIRGSGTEPKLKVYIE++A  +  A  
Sbjct: 540 IDFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAAN 599

Query: 605 LAKLTWDVLKREWFSSEKTGLTTNF 629
           LA LTW+VL+REWF  E TGL T+F
Sbjct: 600 LAHLTWNVLRREWFRPEITGLKTSF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/625 (57%), Positives = 450/625 (72%), Gaps = 30/625 (4%)

Query: 11  LLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRM 70
           ++ S+P DL+ K+R W +YD  +ET +E+ +LC+   + ELHKR D  I FGTAGLR RM
Sbjct: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65

Query: 71  EAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFK 130
           EAGFNRMNALTV Q++QGLA YIK QFP NLT VVGHDHR++S+ F ++T   FL  GFK
Sbjct: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125

Query: 131 VYYLNPNDE--FVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188
           V++LN  +E   VHTP+VPF +N   AS+G+MITASHNP+MDNGYKVYY NGCQIIPPHD
Sbjct: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185

Query: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248
           K IAE I  NLEP S           + +   +I  KE + ++Y+  +   +I   ++  
Sbjct: 186 KLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234

Query: 249 TTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNP 308
           T     +PWFVYTPMHGVG++IF  IS   L+L E  DY+ V+EQ  PD  FPTVSFPNP
Sbjct: 235 TN----EPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNP 290

Query: 309 EEKGALDLGIKYAKKHN-IDLVVANDPDADRFSVAVRN---PLTDEFQQLTGNEIGFLFA 364
           EEKGALDL ++Y +K++ +DL++ANDPDADRFSVAVR+     T  ++QLTGNEIGFLFA
Sbjct: 291 EEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFA 350

Query: 365 YFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKAREL 424
           Y+ WE+Y   P D     PLAM+NSTVSSQMIK+MAE+EGF+YEDTLTGFKW+GN+A EL
Sbjct: 351 YYEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALEL 406

Query: 425 EKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKK 484
           E+EGYY PF +EEAIGYMF  +  DKDGI+A +VFLQAY  W  +  Q++ DI+ T   K
Sbjct: 407 EQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASG-QTVLDILATASLK 465

Query: 485 YGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDT 544
           YG FKE+NGYYIV DL++TK +FD IR   + +  Y   +G+ F++I FRDLT GYQSDT
Sbjct: 466 YGHFKEFNGYYIVPDLAITKQVFDAIR---SIESPYPKKLGSSFEIIKFRDLTNGYQSDT 522

Query: 545 IGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANR 604
             ++P L  DPSSQMIT  ++    P    VRFTIRGSGTEPKLKVYIEA   TE  +  
Sbjct: 523 PDHIPELASDPSSQMITCEMLLVEQP-TSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581

Query: 605 LAKLTWDVLKREWFSSEKTGLTTNF 629
           LAK TWDVL++EWF  E TGL T F
Sbjct: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/636 (53%), Positives = 444/636 (69%), Gaps = 23/636 (3%)

Query: 7   EIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGL 66
           ++ ++   IP+DL++KI  WF+YD N +T  E++ L  +++ +EL  R  QRI FGTAGL
Sbjct: 5   QVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGL 64

Query: 67  RSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLN 126
           R+RMEAGF RMN LTV+Q++QGLA+YIKSQFP+NL  VVGHDHRY+SK FA++  A FL 
Sbjct: 65  RARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQ 124

Query: 127 AGFKVYYLN--PNDE----FVHTPMVPFGINLY--SASIGVMITASHNPEMDNGYKVYYN 178
            GF+VYYLN  P+++    +VHTPMVPF ++     AS G+MITASHNP+MDNGYKVYY+
Sbjct: 125 LGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYS 184

Query: 179 NGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDK 238
           NGCQI PPHDK IA  I+ NL P    W+ + +I  A  N +L   K+++++ Y+  +  
Sbjct: 185 NGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQS 244

Query: 239 YIIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDP 298
            ++  N    +     K WFVYTPMHGVGY+IF+ I +  L+L ED  Y+ V  Q  PDP
Sbjct: 245 SLVTTN----SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDP 300

Query: 299 SFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNE 358
            F TVSFPNPEE+GAL+L I+ A +   +LV+ANDPDADRFS AV++   ++++QLTGN+
Sbjct: 301 EFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQ 358

Query: 359 IGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIG 418
           +G+LFA    E++S      ++K PLAM+ STVSSQMI KMA+VEGF + +TLTGFKW+ 
Sbjct: 359 LGYLFAVGQLEKFS---NQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLA 415

Query: 419 NKARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDII 478
           N+A +LE +G+YVPF +EEAIGYMF  +  DKDG++A   FLQ    W    K  L D++
Sbjct: 416 NRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPL-DVL 474

Query: 479 ETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLT 537
             G++KYG F EYNGYY V DLS+   +F  IR   N  +  Y S IG EF V +FRDLT
Sbjct: 475 NAGYEKYGNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLT 534

Query: 538 LGYQSDTIGNVPTLPVDPSSQMITMTIIP----TSLPENGSVRFTIRGSGTEPKLKVYIE 593
           +GYQSDT  ++P LPV P S MIT  + P    T+   +  VRFTIRGSGTEPKLKVYIE
Sbjct: 535 VGYQSDTGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIE 594

Query: 594 ANAKTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629
           +NA  +  A +LAKLTWDVLKREWF  E TGL T F
Sbjct: 595 SNALDKEYATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/628 (54%), Positives = 430/628 (68%), Gaps = 22/628 (3%)

Query: 14  SIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEAG 73
           ++P  LK+ +  W  +D N ET  E+ EL  N   DEL KR   RI FGTAGLR+RMEAG
Sbjct: 7   AVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAG 66

Query: 74  FNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVYY 133
           F+RMN LTV+Q++QGLA YIKSQFP +L  V+GHDHR+HS+EFA+ T A FL   + +YY
Sbjct: 67  FSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYY 126

Query: 134 LN------PNDEFVHTPMVPFGINLYSA---SIGVMITASHNPEMDNGYKVYYNNGCQII 184
           LN        D FVHTPMVPF IN       S GVMITASHNP+MDNGYKVYY NGCQII
Sbjct: 127 LNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII 186

Query: 185 PPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPK- 243
           PPHD+ I   I+ NLEP +  W+++A+I +AI++ KL   ++++LQ+Y  ++   ++ + 
Sbjct: 187 PPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQS 246

Query: 244 NISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTV 303
           N+          PWFVYTPMHGVGY+ F    ++ L + ED DY+ V EQ  PDP FPTV
Sbjct: 247 NLKFAGG-----PWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTV 301

Query: 304 SFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLF 363
           SFPNPEE+GALD+ +K A  + I +V+ANDPDADRFSVAV+     E+ QLTGN+IG LF
Sbjct: 302 SFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILF 359

Query: 364 AYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARE 423
           A    + Y   P    D+  LAM+ S VSSQ+++KMAE EGF   +TLTGFKW+GN+ARE
Sbjct: 360 AQAEMQSYFKEPK--LDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARE 417

Query: 424 LEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFK 483
           LE EGYYVPF +EEAIGYMF ++  DKDGI A  VFLQ  Y W    K S  ++++  ++
Sbjct: 418 LELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQ-EVLQECYE 476

Query: 484 KYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEK-YVSHIGTEFKVITFRDLTLGYQS 542
           KYG F +YNGYYI +  ++TK +FD  R       K Y SHIG EF+V   RDLT+GYQS
Sbjct: 477 KYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQS 536

Query: 543 DTIGNVPTLPVDPSSQMITMTIIPTSLPENG-SVRFTIRGSGTEPKLKVYIEANAKTEAE 601
           DT  N+P LPVD +SQMIT  + P  +  +  SVRFT RGSGTEPKLKVYIE+ A     
Sbjct: 537 DTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQR 596

Query: 602 ANRLAKLTWDVLKREWFSSEKTGLTTNF 629
           A+ L+ L WDVLKREWF   +TGL TNF
Sbjct: 597 ASHLSHLAWDVLKREWFRPTETGLQTNF 624

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 122/491 (24%), Positives = 185/491 (37%), Gaps = 72/491 (14%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   +  N       T+     I    P      T VVG D RY++     
Sbjct: 19  GTSGLRKKTKIFKDTPN------YTENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHNP---EMDNGY 173
             AA+    G K   +      + TP     +  Y      G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQRG-LLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 174 KVYYNNGCQIIPPHDKNIAECIEK-------------NLEPLSDNWNTEAVISKAIENVK 220
           K   +NG     P    I E  +K              LE L  N     ++   I+  K
Sbjct: 132 KFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTTK 191

Query: 221 LIYSKEDVLQQYMLNLDKYIIPKNISLGTTIKGKKPW-FVYTPMHGVGYQIFHRISSTCL 279
                E V Q +  +L K  + K        +  K W  ++  M+GV       I    L
Sbjct: 192 AYV--EFVKQIFDFDLIKKFVHKQ-------RDTKHWKLLFDGMNGVTGPYGKAIFVDEL 242

Query: 280 NLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRF 339
            L  D     V +Q  P P F  V  P+P    A  L +    + NI+   A+D D DR 
Sbjct: 243 GLPAD----EVLQQWHPSPDFGGVH-PDPNLTYAKAL-VDRVDRENIEFGAASDGDGDRN 296

Query: 340 SVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKM 399
            +    P         G+ +  +  Y     Y      F  +    +  S  +S  I ++
Sbjct: 297 MIYGAGPAFVS----PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSSAIDRV 346

Query: 400 AEVEGFYYEDTLTGFKWIGN--KARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATV 457
           A+  G    +  TG+K+      A++L   G       EE+ G     +  +KDGI A +
Sbjct: 347 AKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHVR-EKDGIWAIL 398

Query: 458 VFLQ--AYYGWCMNNKQSLFDIIETGF-KKYG--VFKEYNGYYIVNDLSLTKIIFDNIRE 512
            +L   A Y     ++     II+  F  KYG   F  Y+ Y  V      K+I DN+R+
Sbjct: 399 AWLNLLAIYNKHHPDRDVSIKIIQDEFWNKYGRTFFTRYD-YEKVATEDAAKVI-DNLRK 456

Query: 513 NKNDKEKYVSH 523
           +   K  +V+H
Sbjct: 457 HVESKT-FVNH 466

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 120/486 (24%), Positives = 190/486 (39%), Gaps = 75/486 (15%)

Query: 56  DQRIVFGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNL---TAVVGHDHRYH 112
           DQR   GT+GLR +     N  +       T+     +    P      T VVG D RY+
Sbjct: 15  DQRP--GTSGLRKKTAVFTNEPH------YTENFIQAVMEAIPEGCKGATLVVGGDGRYY 66

Query: 113 SKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS--ASIGVMITASHN---P 167
           +       AA+    G +   +  N   + TP     +  Y    + G+++TASHN   P
Sbjct: 67  NDVILHKIAAIGAANGVRKLVIGQNG-LLSTPAASHIMRTYKEKCTGGIILTASHNPGGP 125

Query: 168 EMDNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNT-----EAVISKAIENVK-- 220
           + D G K   +NG     P    I E + K L    D++       E  +    ENV+  
Sbjct: 126 KNDMGIKYNLSNGGPAPEPVTNKIWE-VSKQL----DHYKIIPDLPELALDTLAENVQYG 180

Query: 221 -LIYSKEDVLQQYMLNLDK-YIIPKNISLGTTIKGKKPW-FVYTPMHGV----GYQIFHR 273
            L+    D  + Y+  L + +  P   S     + +K W  ++  M+GV    G  IF  
Sbjct: 181 PLLVDVVDTTRDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIF-- 238

Query: 274 ISSTCLNLVEDIDYVC--VKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVA 331
                   V++ +     V +   P P F  +  P+P    A  L +    + NI+   A
Sbjct: 239 --------VDEFELPAEEVLQNWHPQPDFGGIH-PDPNLTYARSL-VDRVDRENIEFGAA 288

Query: 332 NDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTV 391
           +D D DR  +    P         G+ +  +  Y     Y      F  +    +  S  
Sbjct: 289 SDGDGDRNMIYGAGPAFVS----PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFP 338

Query: 392 SSQMIKKMAEVEGFYYEDTLTGFKWIGN--KARELEKEGYYVPFGFEEAIGYMFPKMECD 449
           ++  I ++AE  G    +  TG+K+      A++L   G       EE+ G     +  +
Sbjct: 339 TASAIDRVAEKHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHVR-E 390

Query: 450 KDGITATVVFLQ--AYYGWCMNNKQSLFDIIETGF-KKYG-VFKEYNGYYIVNDLSLTKI 505
           KDG+ A + +L   A Y     ++     II+  F KKYG VF     Y  V+  S  K+
Sbjct: 391 KDGVWAIIAWLNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNSAKKV 450

Query: 506 IFDNIR 511
           I DN+R
Sbjct: 451 I-DNLR 455

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 100 NLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASI 157
           N T VVG D RY++ E  QI  A+    G +   L  N   + TP     I  Y    + 
Sbjct: 54  NATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILGQNG-ILSTPAASHIIRSYPEKCTG 112

Query: 158 GVMITASHN---PEMDNGYKVYYNNG 180
           G+++TASHN   PE D G K   +NG
Sbjct: 113 GIILTASHNPGGPENDFGIKYNLSNG 138

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 117/297 (39%), Gaps = 40/297 (13%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   +  N       T+     I    P    + T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFMDEPN------YTENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHN---PEMDNGY 173
             AA+    G K   +  N   + TP     I  Y   +  G+++TASHN   P  D G 
Sbjct: 73  KIAAIGAANGVKKLIIGQNG-ILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 174 KVYYNNGCQIIPPHDKNIAECIEKNLEPLSD----NWNTEAVISKAIEN-------VKLI 222
           K    NG     P  + + + I +  + L+D    N   E  ++  +EN       V +I
Sbjct: 132 KYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDII 187

Query: 223 YSKEDVLQQYMLNLDKYIIPKNISLGTTIKGKKPW-FVYTPMHGVGYQIFHRISSTCLNL 281
            S E  ++      D  +I K I    + +  K W  ++  ++GV       I +    L
Sbjct: 188 DSTEAYVKYMKEIFDFPLIKKFI---VSQRETKNWKLLFDSLNGVTGPYGKAIFADEFGL 244

Query: 282 VEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADR 338
             D     V +  VP P F  +  P+P    A  L +    K  I+   A+D D DR
Sbjct: 245 PAD----EVLQNYVPKPDFGGLH-PDPNLTYAKTL-VSRVDKEKIEFGAASDGDGDR 295

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 100/420 (23%), Positives = 166/420 (39%), Gaps = 58/420 (13%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   N  +       T+     I    P    +   VVG D RY++ E  Q
Sbjct: 19  GTSGLRKKTKVFMNEPH------YTENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASIGVMITASHN---PEMDNGY 173
               +    G K   +  N   + TP     I  Y   ++ G+++TASHN   PE D G 
Sbjct: 73  KIGEIGAANGVKKLIVGQNG-LLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 174 KVYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTE-------AVISKAIENVKLIYSKE 226
           K   +NG     P  +++   I +  + L+     +       + I K  E   L+    
Sbjct: 132 KYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDVI 187

Query: 227 DVLQQYMLNL----DKYIIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLV 282
           DV  +Y+  +    D  +I K I    + KG K   ++  ++G+       I +  L L 
Sbjct: 188 DVTAEYVKLMKEIFDFDLIKKFIDHQRSTKGFK--ILFDALNGITGPYGKAIFADELGLP 245

Query: 283 EDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVA 342
            +     V +   P P F  +  P+P    A  L ++   K  I    A+D D DR  + 
Sbjct: 246 AE----EVLQNYEPKPDFGGLH-PDPNLTYAHTL-VERVDKEQIAFGAASDGDGDRNMIY 299

Query: 343 VRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEV 402
              P         G+ +  +  Y      S +P  FK +    +  S  +S  I ++A+ 
Sbjct: 300 GCGPAFVS----PGDSVAIIAEY-----ASEIPY-FKKQGIYGLARSFPTSAAIDRVAKA 349

Query: 403 EGFYYEDTLTGFKWIGN--KARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFL 460
           +G    +  TG+K+      A++L   G       EE+ G     +  +KDG+ A V +L
Sbjct: 350 QGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHVR-EKDGVWAIVAWL 401

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 23/83 (27%)

Query: 108 DHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGI-------NLYSASIGVM 160
           DH+Y           V+  AGF+      N   ++T M   GI       +L   ++GVM
Sbjct: 14  DHKY-----------VYGTAGFR-----DNASILNTVMFTTGIVACLRSISLGGKAVGVM 57

Query: 161 ITASHNPEMDNGYKVYYNNGCQI 183
           ITASHNP  DNG K+   NG  +
Sbjct: 58  ITASHNPPEDNGVKIVEPNGAML 80

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 126 NAGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYNNGCQI 183
            AGF+    N +     T ++     + L    +GVMITASHNP  DNG K+   +G  +
Sbjct: 27  TAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

Query: 184 IP---PHDKNIAECIEKNLEPLSDNWNT-EAVISKAIENVKLIYSKEDVLQQYMLNLDKY 239
           +    P+   +A     N    + N+    A +++ IE+ K             + LD  
Sbjct: 87  LATWEPYAMQLA-----NTASFASNFEEFRAELTRLIEHEK-------------IGLDTS 128

Query: 240 IIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFH 272
           I+P +I +G   +   P+ +   +      +FH
Sbjct: 129 IVP-HIVVGRDSRESSPYLLRC-LTSTMVSVFH 159

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 119/481 (24%), Positives = 181/481 (37%), Gaps = 71/481 (14%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR +     ++         T+     I    P      T VVG D RY++     
Sbjct: 19  GTSGLRKKTRVFKDKP------HYTENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASIGVMITASHNP---EMDNGY 173
             AA+    G K   +  +   + TP     +  Y    + G+++TASHNP   E D G 
Sbjct: 73  KIAAIGAANGVKKLVVGQHG-LLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 174 KVYYNNGCQIIPP-------------HDKNIAECIEKNLEPLSDNWNTEAVISKAIENVK 220
           K   +NG     P             H K I +  E  LE L  N     ++   I+  K
Sbjct: 132 KYNLSNGGPAPEPVTNKIWEISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDITK 191

Query: 221 LIYSKEDVLQQYMLNLDKYIIPKNISLGTTIKGKKPW-FVYTPMHGVGYQIFHRISSTCL 279
                 D L++     D  +I K I      + KK W  ++  M+GV       I     
Sbjct: 192 AYV---DFLKEI---FDFELIKKFIH---NQREKKHWKLLFDGMNGVTGPYGKAIFVDEF 242

Query: 280 NLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRF 339
            L  D     V +Q  P P F  V  P+P    A  L +    +  I+   A+D D DR 
Sbjct: 243 GLPAD----EVLQQWHPQPDFGGVH-PDPNLTYAKAL-VDRVNREKIEFGAASDGDGDRN 296

Query: 340 SVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKM 399
            +    P         G+ +  +  Y      S +P  FK +    +  S  ++  I ++
Sbjct: 297 MIYGAGPAFVS----PGDSVAIIAEY-----ASEIPY-FKKQGIYGLARSFPTASSIDRV 346

Query: 400 AEVEGFYYEDTLTGFKWIGN--KARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATV 457
           A+  G       TG+K+      A +L   G       EE+ G     +  +KDG+ A +
Sbjct: 347 AKAHGLNCYQVPTGWKFFCALFDANKLSICG-------EESFGTGSNHVR-EKDGLWAII 398

Query: 458 VFLQ--AYYGWCMNNKQSLFDIIETGF-KKYG--VFKEYNGYYIVNDLSLTKIIFDNIRE 512
            +L   A Y      K     II+  F  KYG   F  Y+ Y  V   +  K+I D +R+
Sbjct: 399 AWLNVLAIYNKHNPEKDVSIKIIQDEFWNKYGRTFFTRYD-YEHVTTEAAGKVI-DQLRK 456

Query: 513 N 513
           +
Sbjct: 457 H 457

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%)

Query: 150 INLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184
           I+   A +GVMITASHNP  DNG K+  ++G  ++
Sbjct: 47  ISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 136/554 (24%), Positives = 214/554 (38%), Gaps = 68/554 (12%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITA 121
           GT+GLR + +   ++ N   V    Q +   I  +       VVG D RY++    Q  A
Sbjct: 18  GTSGLRKKTKVFEDQPN--YVENFIQSVMEAI-PEGAKGAVLVVGGDGRYYNDVILQKIA 74

Query: 122 AVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS--ASIGVMITASHN---PEMDNGYKVY 176
           A+    G K   +  N   + TP     +  Y    + G+++TASHN   PE D G K  
Sbjct: 75  AIGAANGVKKLVIGQNG-LLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGIKYN 133

Query: 177 YNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIEN-------VKLIYSKEDVL 229
            +NG     P    I E  +K           E  ++K +EN       V +I + +  +
Sbjct: 134 LSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTTDAYI 193

Query: 230 QQYMLNLDKYIIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVC 289
           Q      D  +I K I+     KG K   +   M+GV       I      L    D   
Sbjct: 194 QLLKEIFDFELIHKFIAKQRKEKGWK--LLVDSMNGVTGPYAKAIFVDEFGL----DSKE 247

Query: 290 VKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTD 349
           V +   P P F  +  P+P    A  L ++   K  I+   A+D D DR  +    P   
Sbjct: 248 VLQNWHPQPDFGGL-HPDPNLTYAHTL-VERVNKEKIEFGAASDGDGDRNMIYGYGPAFV 305

Query: 350 EFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYED 409
                 G+ +  +  Y     Y      FK +    +  S  ++  I ++A+  G    +
Sbjct: 306 S----PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAKKHGLNCYE 355

Query: 410 TLTGFKWIGN--KARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQ--AYYG 465
             TG+K+      A++L   G       EE+ G     +  +KDGI A + +L   A + 
Sbjct: 356 VPTGWKFFCALFDAKKLSICG-------EESFGTGSNHVR-EKDGIWAIMAWLNILAIFN 407

Query: 466 WCMNNKQSLFDIIETGF-KKYG--VFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVS 522
               +K++    I+  F   YG   F  Y+ Y  V      K+I +N+R+   D     S
Sbjct: 408 QRHPDKEASIKTIQNEFWDTYGRTFFTRYD-YEKVETDKANKVI-ENLRQYVADSGTKGS 465

Query: 523 HIGTEFKVITFRDLTLGYQSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGS 582
              T+   +T  D      +D  G +       SS      I+      NG+ RF +R S
Sbjct: 466 KFPTD-SALTVVDAGDFSYTDLDGTI-------SSHQGLYVIL-----SNGA-RFVVRLS 511

Query: 583 GTEPK---LKVYIE 593
           GT      +++YIE
Sbjct: 512 GTGSSGATIRLYIE 525

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 18/149 (12%)

Query: 126 NAGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYNNGCQI 183
            AGF+    N +     T ++     + L    +GVMITASHNP  DNG K+   +G  +
Sbjct: 27  TAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

Query: 184 IPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPK 243
           +               EP +      A  +   E  ++  +K  +++   ++L+  ++P 
Sbjct: 87  LA------------TWEPYAMQLANAASFATNFEEFRVELAK--LIEHEKIDLNTTVVP- 131

Query: 244 NISLGTTIKGKKPWFVYTPMHGVGYQIFH 272
           +I +G   +   P+ +      +   +FH
Sbjct: 132 HIVVGRDSRESSPYLLRCLTSSMA-SVFH 159

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 114/305 (37%), Gaps = 53/305 (17%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR +     N ++       T+     I    P    +   VVG D RY++ +  Q
Sbjct: 17  GTSGLRKKTAVFMNNVHY------TENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS------ASIGVMITASHN---PEM 169
           I AA+    G +   +  +   + TP     I  Y        + G+++TASHN   PE 
Sbjct: 71  IIAAISAANGVRKLVIGQHG-LLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 170 DNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKE--- 226
           D G K   +NG    P    N    I K L        T   I K    + L    E   
Sbjct: 130 DIGIKYNLSNGGP-APESVTNAIWDISKKL--------THYKIVKGFPEINLSVKGEKSY 180

Query: 227 --------DVLQQYMLNL----DKYIIPKNISLGTTIKGKKPW-FVYTPMHGVGYQIFHR 273
                   D  Q+Y+  L    D  +I K +    T +  K W  ++  ++GV       
Sbjct: 181 GSLVIDVVDTTQEYVDFLKGIFDFDLIKKFVD---TQRSTKNWKLLFDGLNGVTGPYGRA 237

Query: 274 ISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVAND 333
           I    L L E+     V +   P P F  +  P+P    A  L +    K  I+   A+D
Sbjct: 238 IFVDELGLPEN----EVLQNCHPKPDFGGI-HPDPNLTYARTL-VDRVDKEKIEFGAASD 291

Query: 334 PDADR 338
            D DR
Sbjct: 292 GDGDR 296

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 123 VFLNAGFKVYYLNPNDEFVHTPMVPFGIN-------LYSASIGVMITASHNPEMDNGYKV 175
           V+  AGF+      + E + T M   GI        L    +GVMITASHNP  DNG KV
Sbjct: 21  VYGTAGFR-----DDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKV 75

Query: 176 YYNNGCQII 184
              +G  +I
Sbjct: 76  VEPDGSMLI 84

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 91/375 (24%), Positives = 140/375 (37%), Gaps = 39/375 (10%)

Query: 56  DQRIVFGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNL---TAVVGHDHRYH 112
           DQR   GT+GLR +        N       T+     I    P      T VVG D RY+
Sbjct: 16  DQRP--GTSGLRKKTAIFEKEPN------YTENFIQAIMEAIPEGCKGATLVVGGDGRYY 67

Query: 113 SKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSA---SIGVMITASHN--- 166
           +       AA+    G K   +  N   + TP     I  Y+    + G+++TASHN   
Sbjct: 68  NDAILHNIAAIGAANGVKKLIVGQNG-LLSTPAASHIIRTYAPGEITGGIILTASHNPGG 126

Query: 167 PEMDNGYKVYYNNGCQIIPPHDKNIAECIEK--NLEPLSDNWNTE-AVISKAIENVKLIY 223
           P+ D G K    NG     P  + I E  +K  N + + D    E   + K  +   L+ 
Sbjct: 127 PKNDMGIKYNIQNGAPAPEPVTEAIWEASKKLQNYKIIKDFPELELKTLGKNKQYGPLLV 186

Query: 224 SKEDVLQQYMLNLDK-YIIPKNISLGTTIKGKKPW-FVYTPMHGVGYQIFHRISSTCLNL 281
              D  + Y+  + + +  P       T +  K W  ++  M+GV       I    L L
Sbjct: 187 DVIDTCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGL 246

Query: 282 VEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSV 341
             D     V +   P P F     P+P    A  L +    K  I+   A+D D DR  +
Sbjct: 247 PAD----EVLKDWHPSPDFGG-HHPDPNLTYAKSL-VDRVDKEKIEFGAASDGDGDRNMI 300

Query: 342 AVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAE 401
               P         G+ +  +  Y      S +P  FK      +  S  ++  I ++A+
Sbjct: 301 YGYGPAFVS----PGDSVAIIAEY-----ASDIPY-FKKNGIYGLARSFPTASSIDRVAK 350

Query: 402 VEGFYYEDTLTGFKW 416
             G    +  TG+K+
Sbjct: 351 AHGLKAYEVPTGWKF 365

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS---NLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   N  N       T+     I    P    N T VVG D R+++    Q
Sbjct: 19  GTSGLRKKSKVFMNEPN------YTENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHN---PEMDNGY 173
           + A +    G +   +      + TP     I  Y   +  G+++TASHN   PE D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 174 KVYYNNG 180
           K    NG
Sbjct: 132 KYNLANG 138

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%)

Query: 152 LYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184
           L    +GVM+TASHNP +DNG KV    G  +I
Sbjct: 55  LCGTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 155 ASIGVMITASHNPEMDNGYKVYYNNGCQII 184
           ++IGVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%)

Query: 314 LDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367
           L  GI      N  L  + D DADR      +P+T+ F  L G++I  LFA F 
Sbjct: 283 LPQGIPKDIDANSTLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFF 336

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 157 IGVMITASHNPEMDNGYKVYYNNGCQII 184
           IGVMITASHNP  DNG K+   +G  +I
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 565 IPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEA 602
           I  ++ +  S R  +R SGTE  +++Y EA  K E EA
Sbjct: 491 IDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEA 528

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 156 SIGVMITASHNPEMDNGYKVYYNNGCQI 183
           ++GVM+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 333 DPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINS 389
           D DADR     ++P ++ F  L G++I  LFA F+  Q  +   D++++  L ++ +
Sbjct: 294 DGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQT 350

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 152 LYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSD 204
           L  A +GVM+TASHNP  DNG K        ++ PH + +A   EK+   L++
Sbjct: 53  LGGAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALAN 97

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 126 NAGFKVYYLNPNDEFVHTPMVPFGIN---LYSASIGVMITASHNPEMDNGYKV 175
            AGF+ Y  +  D  + T  V  G+    L   ++GVMITASHNP  DNG K+
Sbjct: 25  TAGFR-YKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNPPEDNGVKI 76

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 53/128 (41%), Gaps = 15/128 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS---NLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   N  N       T+     I    P    + T VVG D R+++    Q
Sbjct: 19  GTSGLRKKTKIFMNEPN------YTENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHN---PEMDNGY 173
           + A +    G +   +      + TP     I  Y   +  G+++TASHN   PE D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 174 KVYYNNGC 181
           K    NG 
Sbjct: 132 KYNLANGA 139

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITA 121
           GT+GLR + +   N  +        Q +   I  + PS  T VVG D R+++       A
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENF--IQAMMECI-PEGPSGATLVVGGDGRFYNDVIMNKIA 75

Query: 122 AVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI---GVMITASHN---PEMDNGYKV 175
           AV    G K   +      + TP     I  Y  +    G+++TASHN   PE D G K 
Sbjct: 76  AVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGGGIILTASHNPGGPENDLGIKY 134

Query: 176 YYNNG 180
              NG
Sbjct: 135 NLPNG 139

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS---NLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +  F +         T+     I    P    N   V+G D RY++    Q
Sbjct: 19  GTSGLRKKTKV-FEQTE-----HYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHNPEM-DNGYKV 175
             A V    G +   +  N   + TP     I  Y   +  G+++TASHNP   DN + +
Sbjct: 73  KIAEVGSANGVRKLIIGQNG-LLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDNDFGI 131

Query: 176 YYN 178
            YN
Sbjct: 132 KYN 134

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 52/127 (40%), Gaps = 15/127 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR +     N  N       T+     +    P    + T VVG D R+++     
Sbjct: 19  GTSGLRKKTAIFMNEPN------YTENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHN---PEMDNGY 173
             AA+    G K   +  N   + TP     I  Y   +  G+++TASHN   PE D G 
Sbjct: 73  KIAAISAANGVKKLIIGQNG-LLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131

Query: 174 KVYYNNG 180
           K    NG
Sbjct: 132 KYNLANG 138

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +      N       T+     I    P    +   VVG D R+++    Q
Sbjct: 17  GTSGLRKKTKVFMEEPN------YTENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS--ASIGVMITASHN---PEMDNGY 173
             AA+    G +   +  N   + TP     I  Y+   + G+++TASHN   PE D G 
Sbjct: 71  KIAAIGAANGVRKLIIGQNG-LLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 174 KVYYNNG 180
           K    NG
Sbjct: 130 KYNLANG 136

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 24/132 (18%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS---NLTAVVGHDHRYHSK---- 114
           GT+GLR + +   +  N       T+     I +  P+   N T VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFMSEKNY------TENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 115 EFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI---GVMITASHN---PE 168
           +  QI+AA     G +   +  N   + TP   + I  Y  S    G+++TASHN   PE
Sbjct: 73  KIMQISAA----NGVRKLVIGQNG-ILSTPAASYIIRNYKESCNGGGIILTASHNPGGPE 127

Query: 169 MDNGYKVYYNNG 180
            D G K   +NG
Sbjct: 128 NDIGIKYNLSNG 139

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 157 IGVMITASHNPEMDNGYKVYYNNG 180
           IGVM+TASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query: 121 AAVFLNAGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYN 178
           A  +  AGF+ +    +     T +V     I L S  +GVMITASHNP  DNG KV   
Sbjct: 16  AYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKV--- 72

Query: 179 NGCQIIPPHDKNIAECIEKNLEPLS 203
                + P+     E + +N EP++
Sbjct: 73  -----VEPY----GEMLVQNWEPIA 88

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 127 AGFKVYYLNPNDEFVHTPMVPFGIN---LYSASIGVMITASHNPEMDNGYKV 175
           AGF+ Y  +  D  + T  V  G+    L   ++GVMITASHNP  DNG K+
Sbjct: 26  AGFR-YKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPPEDNGVKI 76

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNL---TAVVGHDHRYHSKEFAQ 118
           GT+GLR R +      N       T+     I    P  +     +VG D RY++    Q
Sbjct: 19  GTSGLRKRTKVFAEEPN------YTENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS---ASIGVMITASHNPEM-DNGYK 174
             AA+    G K   +  N   + TP     I  YS    + G+++TASHNP   +N + 
Sbjct: 73  KIAAIGAANGVKRLVVGQNG-ILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 175 VYYN 178
           + YN
Sbjct: 132 IKYN 135

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 119/302 (39%), Gaps = 47/302 (15%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +    + +       T+     I    P    + T VVG D RY++ +  Q
Sbjct: 19  GTSGLRKKTKVFMEKPHY------TENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS------ASIGVMITASHN---PEM 169
           I A++    G     +  +   + TP     I  Y        + G+++TASHN   P+ 
Sbjct: 73  IIASISAANGVGKLVIGQHG-LLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 170 DNGYKVYYNNGCQIIPPHDKNIAEC--------IEKNLEPLSDNWNTEAVISKAIENVKL 221
           D G K   +NG          I E         I KNL  L  +   E    K + N+++
Sbjct: 132 DIGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGE----KKLGNLEI 187

Query: 222 IYSKEDVLQQYMLNL----DKYIIPKNISLGTTIKGKKPW-FVYTPMHGVGYQIFHRISS 276
                DV Q Y+  L    D  +I K +    T +  K W  ++  ++GV       I  
Sbjct: 188 --DVVDVTQAYVEFLKEIFDFDLIKKFVD---TQRSTKHWKLLFDGLNGVTGPYGKAIFV 242

Query: 277 TCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDA 336
             L L E+     V +   P P F  +  P+P    A  L ++   K  I+   A+D D 
Sbjct: 243 DELGLPEN----EVLQNCHPKPDFGGI-HPDPNLTYARTL-VERVDKEKIEFGAASDGDG 296

Query: 337 DR 338
           DR
Sbjct: 297 DR 298

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 150 INLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184
           + L    +GVMITASHNP  DNG K+   +G  ++
Sbjct: 53  LKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 18/24 (75%)

Query: 152 LYSASIGVMITASHNPEMDNGYKV 175
           L  A +GVM+TASHNP  DNG KV
Sbjct: 53  LNGAQVGVMVTASHNPPEDNGVKV 76

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 150 INLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184
           + L    +GVMITASHNP  DNG K+   +G  ++
Sbjct: 53  LKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 56/128 (43%), Gaps = 16/128 (12%)

Query: 62  GTAGLRSRMEAGFNRMN-ALTVLQSTQGLASYIKS--QFPSNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR +     + ++     +Q+T      I+S    P  +T VVG D R+++     
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT------IESIPNGPGGVTLVVGGDGRFYNDVIMN 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY---SASIGVMITASHN---PEMDNG 172
             AAV    G +   +      + TP     I  Y    +  G+++TASHN   PE D G
Sbjct: 73  KIAAVGAANGVRKLVIG-QGGLLSTPAASHVIRTYEDKCSGGGIILTASHNPGGPENDLG 131

Query: 173 YKVYYNNG 180
            K    NG
Sbjct: 132 IKYNLPNG 139

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   ++ N       T+     I    P      T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASIGVMITASHN---PEMDNGY 173
             AA+    G K   +  +   + TP     +  Y    + G+++TASHN   PE D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQHG-LLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYNNG 180
           K   +NG
Sbjct: 132 KYNLSNG 138

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   +  N       T+     I    P      T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASIGVMITASHN---PEMDNGY 173
             AA+    G K   +  +   + TP     +  Y    + G+++TASHN   PE D G 
Sbjct: 73  KIAAIGAANGIKKLVIGQHG-LLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYNNG 180
           K   +NG
Sbjct: 132 KYNLSNG 138

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 93/403 (23%), Positives = 156/403 (38%), Gaps = 48/403 (11%)

Query: 102 TAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASIGV 159
           T V+G D RY++    Q  AA+    G +   +  N   + TP     I  Y    + G+
Sbjct: 56  TLVIGGDGRYYNDVVIQKIAAIGSANGVRKIVIGHNG-ILSTPAASHIIRAYHEKCTGGI 114

Query: 160 MITASHNPEM-DNGYKVYYN--NGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAI 216
           ++TASHNP    N + + YN  NG     P  +++   I      L+     E+  +  +
Sbjct: 115 ILTASHNPGGPTNDFGIKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDL 170

Query: 217 ENVKLIYSKEDVLQQYMLNLDKYI--------IPKNISLGTTIKGKKPWFVYTPMHGVGY 268
             +       D+L   + +   Y+         P   S   T        ++  M+GV  
Sbjct: 171 TKIGQDQKYGDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTG 230

Query: 269 QIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDL 328
                +    L L E        +   P P F  +  P+P    A  L ++   K+ I  
Sbjct: 231 PYGEALFVKELGLPE-----SSLQNYHPKPDFGGLH-PDPNLTYAHTL-VERVDKYGIQF 283

Query: 329 VVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMIN 388
             A+D D DR  +    P         G+ +  +  Y      S +P  FK +    +  
Sbjct: 284 GAASDGDGDRNMIYGAGPAFVS----PGDSVAIIAEY-----ASAIPY-FKKQGIYGLAR 333

Query: 389 STVSSQMIKKMAEVEGFYYEDTLTGFKWIGN--KARELEKEGYYVPFGFEEAIGYMFPKM 446
           S  +S  I ++A+ +G    +  TG+K+      A++L   G       EE+ G     +
Sbjct: 334 SFPTSSAIDRVAKEQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV 386

Query: 447 ECDKDGITATVVFLQ--AYYGWCMNNKQSLFDIIETGF-KKYG 486
             +KDG+ A + +L   A Y     NK++    I+T F +KYG
Sbjct: 387 R-EKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFWQKYG 428

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 20/126 (15%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS------NLTAVVGHDHRYHSKE 115
           GT+GLR + +          V Q      ++I++   +      +   VVG D RY++  
Sbjct: 19  GTSGLRKKTK----------VFQQEHYTENFIQAILEAIPEGCQDAILVVGGDGRYYNDV 68

Query: 116 FAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHNPEM-DNG 172
             Q  A V    G K   +  N   + TP     I  Y+  +  G+++TASHNP   DN 
Sbjct: 69  VMQKIAEVGSANGVKKLIIGQNG-LMSTPAASHLIRTYAEKVTGGIILTASHNPGGPDND 127

Query: 173 YKVYYN 178
             + YN
Sbjct: 128 LGIKYN 133

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 100 NLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS--ASI 157
           + T V+G D R+++       AA+    G +   +  N   + TP   + I  Y   A+ 
Sbjct: 55  DATLVIGGDGRFYNDVVINKIAAISAANGVRKLVIGQNG-LLSTPATSYIIRSYKDKATG 113

Query: 158 GVMITASHN---PEMDNGYKVYYNNG 180
           G+++TASHN   PE D G K    NG
Sbjct: 114 GIILTASHNPGGPENDMGIKYNLANG 139

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 157 IGVMITASHNPEMDNGYKV 175
           +GVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 51/125 (40%), Gaps = 10/125 (8%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITA 121
           GT+GLR + +   N  +        Q +   I +  P   T VVG D R+++       A
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENF--IQAMMESIPNG-PDGATLVVGGDGRFYNDVIMNKIA 75

Query: 122 AVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI---GVMITASHN---PEMDNGYKV 175
           AV    G +   +      + TP     I  Y       G+++TASHN   PE D G K 
Sbjct: 76  AVGAANGIRKLIIGQGG-LLSTPAASHIIRTYEDRCNGGGIILTASHNPGGPENDLGIKY 134

Query: 176 YYNNG 180
              NG
Sbjct: 135 NLRNG 139

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 26/98 (26%)

Query: 93  IKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFG--- 149
           ++S F S  T     +HRY           V+  AGF+      +   + T MV  G   
Sbjct: 6   LESVFESCCTT---RNHRY-----------VYGTAGFR-----DDATVLDTVMVTTGLLA 46

Query: 150 ----INLYSASIGVMITASHNPEMDNGYKVYYNNGCQI 183
               I L   ++GVMITASHN   DNG K+   +G  +
Sbjct: 47  CLRSIALDGKAVGVMITASHNQPCDNGVKIVEPDGSML 84

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +   ++ N       T+     I    P      T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYS--ASIGVMITASHN---PEMDNGY 173
             AA+    G K   +      + TP     +  Y    + G+++TASHN   PE D G 
Sbjct: 73  KIAAIGSANGIKKLVIGQYG-LLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYNNG 180
           K   +NG
Sbjct: 132 KYNLSNG 138

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 52/124 (41%), Gaps = 14/124 (11%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR + +      N       T+     +    P    + T VVG D R+++    Q
Sbjct: 19  GTSGLRKKTKVFMEEPN------YTENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY-SASI--GVMITASHNP-EMDNGYK 174
             AA+    G     +  N   + TP     I  Y  A I  G+++TASHNP    N + 
Sbjct: 73  KIAAIGAANGVHKLVIGQNG-ILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131

Query: 175 VYYN 178
           + YN
Sbjct: 132 IKYN 135

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 62/150 (41%), Gaps = 19/150 (12%)

Query: 62  GTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFP---SNLTAVVGHDHRYHSKEFAQ 118
           GT+GLR +     +  N       T+     I    P      T VVG D RY++    +
Sbjct: 19  GTSGLRKKTVIFKDEPNY------TENFIQAIMESIPEGSDGATLVVGGDGRYYNDVILE 72

Query: 119 ITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI--GVMITASHN---PEMDNGY 173
             A +    G K   +  N   + TP     I  Y   +  G+++TASHN   P+ D G 
Sbjct: 73  KIAKIGAANGVKKLVVGQNG-LLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMGI 131

Query: 174 KVYYNNGCQIIPPHDKNIAECIEKNLEPLS 203
           K    NG     P  +++ + I +N + L+
Sbjct: 132 KYNLANGG----PAPESVTDKIWENSKKLT 157

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 102 TAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLY--SASIGV 159
           T VVG D RY++       AA+    G K   +  +   + TP     +  Y    + G+
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAISAANGVKKLVIGQHG-LLSTPAASHIMRTYEDKCTGGI 114

Query: 160 MITASHN---PEMDNGYKVYYNNG 180
           ++TASHN   PE D G K   +NG
Sbjct: 115 ILTASHNPGGPENDMGIKYNLSNG 138

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 150 INLYSASIGVMITASHNPEMDNGYKV 175
           ++L    +G MITASHNP  DNG K+
Sbjct: 51  MHLKGQYVGAMITASHNPPQDNGVKL 76

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
           YJL095W
          Length = 1580

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 9/91 (9%)

Query: 275 SSTCLNLVEDIDYVCVKEQIVPD----PSFPTVSFPNPEEKGALDLGIKYAKKHNIDLV- 329
           ++T  N  E+ DY  +K+QI+P+    P  PT S   P   G L    +   + N D   
Sbjct: 817 TATPTNSNEEQDYWSIKQQILPELDSTPLNPTFSMKMP---GRLKTNTRNDLEDNDDKTP 873

Query: 330 VANDPDADRFSVAVRNPLTDEFQQLTGNEIG 360
            A+  D  R+ VA  +P+   FQ L  +E G
Sbjct: 874 TASTADEARY-VASSSPIASSFQVLRKDETG 903

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W
           (REAL)
          Length = 1004

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 12/90 (13%)

Query: 461 QAYYGWCMNNK-QSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKND--K 517
           +++   C++   Q L  ++  GF    V         V+ L L  II++N+   KND  K
Sbjct: 216 KSFISQCLSTSLQRLGQLLTMGFHSENV---------VSQLKLKSIIYENLVLIKNDFSK 266

Query: 518 EKYVSHIGTEFKVITFRDLTLGYQSDTIGN 547
             +   +  +FK++T +DL      DT GN
Sbjct: 267 NHFSIDLQKQFKIVTVQDLNNIAHLDTNGN 296

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 36/85 (42%), Gaps = 7/85 (8%)

Query: 102 TAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASI---G 158
           T VVG D R+++       AAV    G +   +      + TP     I  Y       G
Sbjct: 56  TLVVGGDGRFYNDVIMNKIAAVGAANGVRKLVIGQGG-LLSTPAASHIIRTYEEKCTGGG 114

Query: 159 VMITASHN---PEMDNGYKVYYNNG 180
           +++TASHN   PE D G K    NG
Sbjct: 115 IILTASHNPGGPENDLGIKYNLPNG 139

>Kpol_286.4 s286 (11833..12582) [750 bp, 249 aa] {ON} (11833..12582)
           [750 nt, 250 aa]
          Length = 249

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 144 PMVPF-GINLYSASIGVM------ITASHNPEMDNGYKVYYNNGCQIIPPHDKNIAECI 195
           P+V F   NLY  ++ V       ITA +NP   +      NNG   I  H   I ECI
Sbjct: 51  PLVGFKNFNLYLVALSVFHFTEFYITAKYNPGKCHSESFIINNGFSYIAAHSVAILECI 109

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 260 YTPMHGVGYQIF---------HRISSTCLNLVEDIDYVCVKEQIVPDPSF 300
           + P+HG+ Y +F         H+  S CL L  DI +  +K  ++P P  
Sbjct: 8   FVPVHGIFYSVFHPTEGTKVRHQFPSGCLEL-SDITFDTIKNYVIPKPQL 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,600,357
Number of extensions: 3453466
Number of successful extensions: 10259
Number of sequences better than 10.0: 85
Number of HSP's gapped: 10481
Number of HSP's successfully gapped: 88
Length of query: 629
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 513
Effective length of database: 40,180,143
Effective search space: 20612413359
Effective search space used: 20612413359
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)