Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002408.839ON73270234250.0
Kpol_1068.98.839ON74564624930.0
ZYRO0G14168g8.839ON76464522970.0
TDEL0B005808.839ON71364522880.0
CAGL0M02959g8.839ON75859222840.0
KAFR0B039108.839ON72464722660.0
TBLA0D032608.839ON76868022440.0
NCAS0C004208.839ON72565021840.0
NDAI0K004208.839ON77869521670.0
Smik_13.4908.839ON73267319950.0
YMR277W (FCP1)8.839ON73266119950.0
KNAG0J002808.839ON74266419920.0
Skud_13.4498.839ON73467319910.0
SAKL0D01496g8.839ON68860019790.0
Suva_13.4658.839ON73266019760.0
ABL127W8.839ON72859819270.0
Kwal_27.102638.839ON74360019260.0
KLTH0C03894g8.839ON74560219220.0
Ecym_46108.839ON75165618980.0
KLLA0D01595g8.839ON71958717830.0
TPHA0E030705.202ON4941771224e-06
Kpol_1010.615.94ON932981172e-05
SAKL0G12870g5.202ON3991261082e-04
Smik_12.825.202ON3921121020.001
Skud_12.875.202ON3921121020.001
YLR019W (PSR2)5.202ON3971121020.001
NCAS0A068005.202ON4731221020.001
TBLA0I014602.530ON3931371010.001
NDAI0D018605.202ON514511020.001
YLL010C (PSR1)5.202ON4271081000.002
Suva_10.655.202ON415112980.004
Smik_12.535.202ON414108980.004
KNAG0M017405.202ON481113970.006
KLLA0F15620g5.202ON414119960.007
NCAS0D027405.202ON398113950.007
KAFR0E021405.94ON95181960.008
TBLA0C060905.202ON484117950.009
ZYRO0B10428g5.202ON482108940.011
CAGL0D03234g5.202ON410111930.012
Suva_10.995.202ON385112930.014
TPHA0N006705.202ON452104930.014
Skud_12.575.202ON415106930.015
NDAI0I021705.202ON391111920.017
KAFR0J009905.202ON483113910.024
TDEL0E042705.202ON453106910.026
TDEL0A030502.530ON355188900.028
TBLA0H019905.202ON688110910.030
Kpol_2002.1005.202ON477119890.044
CAGL0D05610g5.202ON447106860.097
Ecym_71045.202ON49240860.10
Kpol_478.165.202ON35094850.12
Kpol_348.82.530ON422106840.16
ZYRO0B01958g2.530ON336109840.17
Skud_8.492.530ON447109830.21
SAKL0G15620g5.94ON87993840.23
TPHA0H010705.94ON101582840.23
AAL158W5.202ON47840820.28
Kwal_33.151405.202ON410106820.29
Ecym_44607.111ON73187820.32
Kpol_1050.635.94ON105892820.35
KLTH0B03388g5.202ON409108810.36
Smik_8.532.530ON446109810.41
YHR004C (NEM1)2.530ON446109800.46
NDAI0C032305.94ON1034100800.55
Skud_16.2188.527ON480109790.65
KAFR0K010707.153ON99466800.71
Suva_16.2498.527ON480109771.1
YPL063W (TIM50)8.527ON476100771.3
KLLA0E23101g8.527ON480100761.4
NCAS0C022108.527ON491109761.5
Ecym_20665.94ON88096771.5
Ecym_72764.156ON593102761.6
ZYRO0D13706g5.572ON187192731.8
Smik_16.1728.527ON477109752.1
KNAG0E005705.94ON98182752.4
NDAI0E029108.527ON441108742.6
Smik_4.4308.382ON48686742.9
NCAS0D015105.94ON90074743.5
TBLA0A005408.527ON485109733.7
TPHA0I020008.527ON47899734.1
Kpol_2002.935.190ON2040129734.6
TPHA0D04700singletonON1510125734.8
SAKL0A09416g2.530ON385129715.5
KLLA0E15621g5.94ON89167725.6
TPHA0C048708.865ON139574725.6
KLLA0E09131g2.322ON37550707.2
TPHA0A051105.94ON106560717.3
TPHA0H028307.46ON923168717.4
CAGL0L06644g5.94ON828144717.7
ADL145C5.94ON87562708.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00240
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...  1323   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   964   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   889   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   885   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   884   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   877   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   868   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   845   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   839   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   773   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   773   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   771   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   771   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   766   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   765   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   746   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   746   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   744   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   735   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   691   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    52   4e-06
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    50   2e-05
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    46   2e-04
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    44   0.001
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    44   0.001
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    44   0.001
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   0.001
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    44   0.001
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     44   0.001
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    43   0.002
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    42   0.004
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    42   0.004
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    42   0.006
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    42   0.007
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    41   0.007
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    42   0.008
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    41   0.009
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    41   0.011
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    40   0.012
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    40   0.014
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    40   0.014
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    40   0.015
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     40   0.017
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    40   0.024
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    40   0.026
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...    39   0.028
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    40   0.030
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    39   0.044
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    38   0.097
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    38   0.10 
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    37   0.12 
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...    37   0.16 
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...    37   0.17 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    37   0.21 
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    37   0.23 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    37   0.23 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    36   0.28 
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    36   0.29 
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    36   0.32 
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    36   0.35 
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    36   0.36 
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    36   0.41 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    35   0.46 
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    35   0.55 
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    35   0.65 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    35   0.71 
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    34   1.1  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    34   1.3  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    34   1.4  
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     34   1.5  
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    34   1.5  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    34   1.6  
ZYRO0D13706g Chr4 complement(1148881..1149444) [564 bp, 187 aa] ...    33   1.8  
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    33   2.1  
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    33   2.4  
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    33   2.6  
Smik_4.430 Chr4 complement(781942..783402) [1461 bp, 486 aa] {ON...    33   2.9  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    33   3.5  
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    33   3.7  
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    33   4.1  
Kpol_2002.93 s2002 complement(218908..225030) [6123 bp, 2040 aa]...    33   4.6  
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            33   4.8  
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...    32   5.5  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    32   5.6  
TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON} Anc_...    32   5.6  
KLLA0E09131g Chr5 complement(815506..816633) [1128 bp, 375 aa] {...    32   7.2  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    32   7.3  
TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.4...    32   7.4  
CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some ...    32   7.7  
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    32   8.2  

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 1323 bits (3425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/702 (93%), Positives = 655/702 (93%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXXXXXXX 600
           ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS        
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600

Query: 601 XXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLXXXXXXXXXXXXXXX 660
                      TDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL               
Sbjct: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELEDVLDSEDDN 660

Query: 661 XXXXXXXXXXXXXFADVISKREEKKRSGEALEESNNKKQHLQ 702
                        FADVISKREEKKRSGEALEESNNKKQHLQ
Sbjct: 661 EDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQ 702

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/646 (71%), Positives = 534/646 (82%), Gaps = 10/646 (1%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TPV  P G+PYPITISKLIA +GS++ KG RLFAYKFWY+VEIAKSPDE D   N   
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVN--- 57

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
            E SKK+IRESI+FFD+PFEG ++ WNVDVGDEIVEP + +CE+ RPC+HDIVYAGICTM
Sbjct: 58  DEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE DQVSANLTISHTDTNLKVSR+EAN+IGQ  K RLIR KKLILVVDLDQTVIH
Sbjct: 118 CGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIH 177

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI+EWKNDP+NPN+ETLR+VKSFVLEEE ILPPMYMGPKPP HKC YYVK+RPGL
Sbjct: 178 CGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGL 237

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFE+V+ +YEMHIYTMATR+YA+EIAKIIDPDG+LF +RILSR+ENGSLTHKSLERLF
Sbjct: 238 KEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLF 297

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVV+IDDRGDVWNW PNLIKVTPYNFFVGIGDINSNFLPRQQ TMLQ+GRRNH  
Sbjct: 298 PTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNH-- 355

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K ++++ELLTDI+DTEKKLQEKID+EVKRQE +L+H+SAALGEE  +QVR  DITKKIE
Sbjct: 356 KKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           FSASLEVQQQNRPLAELQKHMHNQQLL DDDDEL YLK+IL  VQ ++Y+ L+       
Sbjct: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELK----TDK 471

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           +  IQ LMPKLK+ V + CNFVFSGLIPLGT+IQKADIVLWT MFGA S+++ITE+TTHV
Sbjct: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXXXXXXX 600
           ITKTP T KA+IAK+F   IKV+HPDWVFECL  WK++ E  +E  +   A+        
Sbjct: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFK 591

Query: 601 XXXXXXXXXXXTDAVNFSGD-LNNGTATMSSTDNVVDLFAGGSSWL 645
                         +  S + L   + + SS    VDLFA G+SWL
Sbjct: 592 EALERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/645 (66%), Positives = 505/645 (78%), Gaps = 12/645 (1%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           MATPV  P+ +PYPITI +LIAP+GS + KG RLFAYKFWY+VEIA SPDE D NG  Q 
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQ- 59

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
              SKKT+RESI+FF++PFEG ++ W VD GDE+    +++CE+ RPC+HD+VY G+CTM
Sbjct: 60  --HSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE DQ+ ANL ISHTDTNLKVSR+EA ++    K RL +SKKL+LVVDLDQTVIH
Sbjct: 118 CGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIH 177

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EWK DPSNPNYETL++V+ F LEEE I+PPMYMGP+ P  KC Y+VKVRPGL
Sbjct: 178 CGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGL 237

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           +EFF ++AP+YEMHIYTMATR YA EIAKIIDPDGSLFG+RILSRDENGSLT KSLERLF
Sbjct: 238 REFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLF 297

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMV++IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLPRQQ+ +LQ+GRR H  
Sbjct: 298 PTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTH-- 355

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K +ES+ELLTDI+DTEK+LQEKID+EVKRQE  L+H+     +E V       +TKK+E
Sbjct: 356 KKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQ-LTTNDEPVQGESKEQLTKKLE 414

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           +SASLEVQQQNRPLA LQKHMHNQ+LL DDDDEL YLK+ LA +  ++YK L+  N NS 
Sbjct: 415 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSA 474

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           D  IQ L+P +K  VFKDC FVFSGLIPLGT+I++ADIVLWT MFGA ++S I ENTTHV
Sbjct: 475 D--IQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXXXXXXX 600
           ITKTPGT KARIAK FN ++KVVHPDWVFECL TW HVDEK +EL +   A+        
Sbjct: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592

Query: 601 XXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
                           F  +    TA     D+ ++LFAGG+SWL
Sbjct: 593 RKIEQRHLIEEQRREQFESEALMKTA----QDSTLNLFAGGTSWL 633

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/645 (66%), Positives = 505/645 (78%), Gaps = 20/645 (3%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TPV  P+ +PYPITI +LIAP+GS++ KG RLFA+KFWY+VEIA SPDE        +
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDE-------NE 53

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G   KKT+RESI+FF+APFEG ++ WNVDVGDE+V P + +CE+ RPC+HDIVY G+CT+
Sbjct: 54  GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE +Q + NL ISHTD NLKVSR+EA +I    K+RL  SKKL+LVVDLDQTVIH
Sbjct: 114 CGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EWK D SNPNYE L++V+SF L+EE ILP +YMGPKPPV KC YYVKVRPGL
Sbjct: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFF+KVAP++EMHIYTMATRAYA EIAKIIDPDGSLFG+RILSRDENGS+T KSLERLF
Sbjct: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLPRQQ TMLQ+GR     
Sbjct: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGAR-- 351

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K +ES+EL+TDI+DTEKKLQEKID+EVKRQE  L H+ A+ GEE  A      + KK+E
Sbjct: 352 KKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMAS-GEEVPAPESKDQLAKKLE 410

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           +SASLEVQQQNRPLA LQKHMHNQ+LL DDDDEL+YL+EILA V  E+YK L   +    
Sbjct: 411 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKA 470

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           D  I+ L+P +K  VF+DC+FVFSGLIPLGT+I +ADIVLWT MFGA S+  I ++TTHV
Sbjct: 471 D--IKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHV 528

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXXXXXXX 600
           IT+TPGT KARIAK+FN +IKVVHPDWVFECL +WKHVDEK +EL V+Q A+        
Sbjct: 529 ITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYK 588

Query: 601 XXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
                         +          A  S+ +  ++LFAGG+SWL
Sbjct: 589 QKLARRSSALAEQEMEL--------AMESAKNGTINLFAGGTSWL 625

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/592 (70%), Positives = 492/592 (83%), Gaps = 4/592 (0%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TPV  P G+PYPIT+ +L+ P+GSY+ KG RLFAYKFWY+VEIA SPD+ D++    +
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
            E+SK+ +RESI+F++APFEG ++ WNVD  DEI  P   VCE+KRPC+HDIVY G+CTM
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE DQV ANLTISHTDTNL+VSR+EA ++ +   +RL   KKL+LVVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EWK DPSNPNYETL++VK F LEEE ILP +YMGPKPPV  C YYVK+RPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFEK+AP+YEMHIYTMATRAYA EIAKIIDPD SLFG+RILSRDENGSLT KSL RLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQ+GRR    
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTR-- 358

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K KESEELLTDI+DTEKKLQEKID+EVKRQE  L H+ A   EE+  Q     I KK+E
Sbjct: 359 QKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT-AEESTDQESKEKIAKKLE 417

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           FSASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YLK+ LA +  EFY  LE    + +
Sbjct: 418 FSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE-DASDQN 476

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           +  I  L+PKLK+ VFK+C+FVFSGLIPLGTDI++ADIV+WT +FGA STS+I E+TTHV
Sbjct: 477 EADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHV 536

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592
           +TKTPGT KAR+AK+FNP IKVVHPDW+FECL++WK +DEK + L V+Q  S
Sbjct: 537 VTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVS 588

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/647 (65%), Positives = 508/647 (78%), Gaps = 8/647 (1%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TPV  P+G+PYPITI +LI P+G+YI KG RLFAYKFWY+VEIA SPD+ D       
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
               KK IRESI+FFDAPFEGT+I WN+DVGDE+    +++CE+KRPC+HDIVY G+CT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 121 CGKEVDE--RDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTV 178
           CGKEVDE  + Q  +N T+SHTDTNLK+SR+EA +IG+  K RL   KKL+LVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 179 IHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRP 238
           IHCGVDPTI EWK+DP+NPNY+TL++V+ F LEEE +LP MYMGPKP   KC YYVKVRP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 239 GLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLER 298
           GLKEFF+KVAP++EMHIYTMATRAYA EI KIIDP G LFGNRILSRDENGSLT KSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 299 LFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNH 358
           LFPTDQSMV+IIDDRGDVWNWSPNLIKV PY+FFVG+GDINSNFLP+QQ TMLQ+GRR+ 
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 359 NAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKK 418
             EK KE++ELLTDI+DTEKKLQEKID+EVKRQE +L+H+     EE+V+     + TKK
Sbjct: 361 --EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVP-TEESVSNETKEEWTKK 417

Query: 419 IEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGN 478
           +E SAS+EVQQQNRPLA LQ+H+HNQ+LL DDDDEL +LK+ LA V +E+Y  LE K+ +
Sbjct: 418 LEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLD 477

Query: 479 SDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTT 538
                I+ +MPKLK+SVF+ C+FVFSGLIPL TDI++ADIV+WT MFGA S+S I E TT
Sbjct: 478 ESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTT 537

Query: 539 HVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXXXXX 598
           HVITKTPGT KAR+AKSFN  IK+VHPDWVFECL  W HVDEK + L V++  S      
Sbjct: 538 HVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKK 597

Query: 599 XXXXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
                         +  N SGD+  GT  + + DN VDLFA G+SWL
Sbjct: 598 FREDLNNRKLTERNNEQN-SGDI-TGT-IVENFDNTVDLFATGTSWL 641

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/680 (62%), Positives = 512/680 (75%), Gaps = 41/680 (6%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPD--------EL 52
           M+TPV  P  +P+PITI +LI P+GS++ KG RLFAYKFWY+VEIA+SPD          
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 53  DVNGNVQDGEQS-------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVK 105
           D++GN  D  ++       KK+IRESI+FF++PFEG +IGWNVD GDEI+   +++C++K
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 106 RPCDHDIVYAGICTMCGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRS 165
           RPC+HDIVYAGICT CGKEVD+ D + A+L+ISHTDTNLK+SR+EA +I Q++ SRL + 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           KKLILVVDLDQTVIHCGVDPTI EWKNDP NPNYETL++V+SF L+EE ILPP YMGP+P
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSR 285
           PV KC YYVKVRPGLKEFF K+AP+YEMHIYTMATRAYA EIAKIIDPDGSLFG+RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 286 DENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPR 345
           DENGSLT KSLERLFPTDQSMV+IIDDRGDVWNW  NLIKV PYNFFVGIGDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 346 QQATMLQMGRRNH---------NAEKEK-----------ESEELLTDIIDTEKKLQEKID 385
           QQ+TMLQ+G R+H         N+E +K           ++EELLTDI+DTEKKLQ+KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 386 KEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQ 445
           +EV+RQE  L        +    +  N +++KKIEFSASLEVQQQNRPLA LQ+H  NQ+
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 446 LLRDDDDELSYLKEILATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSG 505
           LL DDDDEL YLK+IL  V   FY+ L+     S   SIQ LMP+LK SVF   NFVFSG
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNES--VSIQTLMPRLKFSVFSGYNFVFSG 538

Query: 506 LIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHP 565
           LIPLGTDI++ADIVLWT MFGA+ST++I ENTTHVITKT GT KAR+AK+FNP IKVVHP
Sbjct: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598

Query: 566 DWVFECLSTWKHVDEKSFELKVDQVASXXXXXXXXXXXXXXXXXXXTDAVNFSGDLNNGT 625
           DW+FECL +WK + EK +EL ++Q AS                      +          
Sbjct: 599 DWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQF---- 654

Query: 626 ATMSSTDNVVDLFAGGSSWL 645
             +++ D  +DLFA G+SWL
Sbjct: 655 EALNTRDPAIDLFASGTSWL 674

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/650 (63%), Positives = 506/650 (77%), Gaps = 20/650 (3%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+T +  P G+PYPITI +LI  VG  + KGDRL AYKFW++V++A SPD+ DV+     
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G   KK+IRESI+FF++P++G +I WNVD+GDEI  P +++ E+ RPC+HD+VY G+CT+
Sbjct: 61  G---KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117

Query: 121 CGKEVDERDQ----VSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQ 176
           CG+EVDE D       ANLTISHTDTNLK+S +EA +IG   ++RL + KKL+LVVDLDQ
Sbjct: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177

Query: 177 TVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKV 236
           TVIHCGVDPTI EWKNDP NPN+ETL++VK F LEEE ILP +YMGPKPP+ KC YYVKV
Sbjct: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSL 296
           RPGLKEF EK+AP++EMHIYTMATRAYA EIAKIIDP+G LFG+RILSRDENGS+T KSL
Sbjct: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297

Query: 297 ERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRR 356
           ERLFPTDQSMV++IDDRGDVWNWSPNLIKV PYNFFVG+GDINSNFLP+QQATMLQ+GRR
Sbjct: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357

Query: 357 NHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG-DI 415
           +   EK K++E+LL DI+D+EKKL+EKID+EVKRQE +L+H+SA   E   +   N  +I
Sbjct: 358 SR--EKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEI 415

Query: 416 TKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELK 475
           +KKIE+SASLEVQQQNRPLA LQKH H+Q+LL DDDDEL +LK+ L  +  ++Y  L+ K
Sbjct: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLK-K 474

Query: 476 NGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITE 535
           +G      I+ +MP +K++V  +C FVFSGLIPLGTDIQ+ADIV+WT  FGA STS+I E
Sbjct: 475 DGEL-KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDE 533

Query: 536 NTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXX 595
            TTHVITKTPGT KAR+AKSFNP IK++HPDWVFECL++WKHVDEK +EL V+Q  S   
Sbjct: 534 KTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETE 593

Query: 596 XXXXXXXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
                            +  N S    NGT +       ++LF+GG SWL
Sbjct: 594 LEEFKKKLAKRQLLATANE-NLSP--ANGTNSAE-----LELFSGGMSWL 635

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/695 (59%), Positives = 512/695 (73%), Gaps = 54/695 (7%)

Query: 1   MATP--VKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELD----- 53
           MATP  ++ P G+PYPITI +L+ P+G+ +NK DRL AYKFWY+VEIA SPDEL+     
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 54  --------------VNGNVQDGEQSK--------------------KTIRESIDFFDAPF 79
                         +NGN      ++                    KT+RESI+FFD P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 80  EGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTMCGKEVDERD---QVSANLT 136
           +G +  W V+ GD+IV P + +CE++RPC+HD++Y G+CT+CGKEVDE D       NLT
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 137 ISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSN 196
           ISHTDTNLK+S +EA +IGQ+ K RL   KKLILVVDLDQTVIHCGVDPTI EWK DP+N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 197 PNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIY 256
           PN+ETL++VK F LEEE ILP MYMGPKPP  KC YYVKVRPGLK+FF+KVAP++EMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 257 TMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDV 316
           TMATRAYA EIAKIIDP G LFGNRILSRDENGSLT KSLERLFPTDQSMV+IIDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 317 WNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNAEKE---KESEELLTDI 373
           WNWSPNLIKV PYNFFVG+GDINSNFLP+QQATMLQ+GRR+   E +   KE+++LLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 374 IDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG-DITKKIEFSASLEVQQQNR 432
           +DTEK LQ KI++EVKRQE  L H+ A + E       N  +I+KKIE+SASLEVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 433 PLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD--DTSIQELMPK 490
           PLA LQKH H+Q+LL DDD+EL +LK+ L+ + S++Y+ L+  N N D  +  I+ +MP+
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 491 LKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKA 550
           +K++V +DC+FVFSGLIPLGT+IQK+DIV+WT MFGA ST++I ENTTHVITKTPGT KA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 551 RIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASXXXXXXXXXXXXXXXXXX 610
           R+AKS++P IK+VHPDWVFECL  WKHV+EK +EL V+Q+ S                  
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 611 XTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
                     L +G   +    N V+LFAGG+SWL
Sbjct: 661 ELKDEGLYNKLPDGNIDI----NEVNLFAGGTSWL 691

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/673 (57%), Positives = 476/673 (70%), Gaps = 57/673 (8%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T ++ P+G+PYPI I KLI  VGSY+++GDRL  YKFWYLVE A    E  V+ N  D
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERAS---ETGVDDNEHD 57

Query: 61  GEQS-----------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCD 109
                           K +RESI+FF++P+EG +I WNVDVGDE+    +++CE+KRPC+
Sbjct: 58  ASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCN 117

Query: 110 HDIVYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKK 167
           HDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KK
Sbjct: 118 HDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKK 174

Query: 168 LILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK--- 224
           LILVVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      
Sbjct: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 234

Query: 225 ---PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281
              PPV KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+R
Sbjct: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDR 294

Query: 282 ILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSN 341
           ILSRDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSN
Sbjct: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354

Query: 342 FLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401
           FLP+Q   MLQ+GR+    +K +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A 
Sbjct: 355 FLPKQSTGMLQLGRKTR--QKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461
             EE  A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L
Sbjct: 413 -AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 471

Query: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521
           + +   +Y+ L  +  N  + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+W
Sbjct: 472 SNIHMTYYQMLSQE--NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIW 529

Query: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
           T  FGA+STS+I   TTH+ITK P T KAR+AK FNP IK+VHPDW+FECL  WK VDEK
Sbjct: 530 TSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEK 589

Query: 582 SFELKVDQVASXXXXXXXXXXXXXXXXXXXTDAVNFSGDL---------NNGTATMSSTD 632
            + L VD   S                    +  NF   L         N     M ++ 
Sbjct: 590 PYTLIVDSPISDE------------------ELQNFQSQLQKRQEYLEENQEQQHMLTSQ 631

Query: 633 NVVDLFAGGSSWL 645
             ++LFA G+SWL
Sbjct: 632 ENLNLFATGTSWL 644

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/661 (58%), Positives = 473/661 (71%), Gaps = 33/661 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T ++ P G+PYPI I KLI  VGSY+++GDRL  YKFWYLVE A    + D   +V  
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 61  GEQS--------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDI 112
           G  +         K +RESI+FF++P+EG +I WNVDVGDE+    +++CE+KRPC+HDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 113 VYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLIL 170
           VY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KKLIL
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 171 VVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK------ 224
           VVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM         
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILS 284
           PPV KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+RILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297

Query: 285 RDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLP 344
           RDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 345 RQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGE 404
           +Q   MLQ+GR+    +K +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A   E
Sbjct: 358 KQSTGMLQLGRKTR--QKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT-AE 414

Query: 405 EAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATV 464
           E  A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L+ +
Sbjct: 415 EPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNI 474

Query: 465 QSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKM 524
              +Y  L  +  N  + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+WT  
Sbjct: 475 HKTYYDMLSQQ--NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 525 FGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFE 584
           FGA+ST +I   TTH+ITK P T KAR+AK FNP IK+VHPDW+FECL  WK VDEK + 
Sbjct: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 585 LKVDQVASXXXXXXXXXXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSW 644
           L VD   S                        +  +       ++S +N ++LFA G+SW
Sbjct: 593 LIVDSPISDEELQNFQTQLQKRQ--------EYLEETQEQQHMLTSQEN-LNLFAAGTSW 643

Query: 645 L 645
           L
Sbjct: 644 L 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/664 (57%), Positives = 482/664 (72%), Gaps = 32/664 (4%)

Query: 3   TPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIA--KSPDELDVNGNVQD 60
           TPV    G+PYP+T+ +LI  VG  +++GDRLFAYKFWY+VE+A   +  E D +G    
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGT--- 63

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G  +KK++RES++FF++PFEGT++ W+VD GDEI  PG  +C ++RPC+HD+VY G+CT+
Sbjct: 64  GTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTL 123

Query: 121 CGKEVDERD---------QVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILV 171
           CG+EVDE +          V  NLT+SH DTNL++SR EA  +    + RL  ++KL+LV
Sbjct: 124 CGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLV 183

Query: 172 VDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPV-HKC 230
           VDLDQTV+HCGVDPTI EWK DP NPNYE LR+V+SF LEEE ILP +Y+G K P   KC
Sbjct: 184 VDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKC 243

Query: 231 SYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGS 290
            YYVKVRPGLK+FF+++AP++EMHIYTMATRAYA EIAKIIDPD SLFG+RILSRDENGS
Sbjct: 244 WYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGS 303

Query: 291 LTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATM 350
           LTHKSLERLFPTDQSMV +IDDRGDVWNW  NLIKV PYNFFVG+GDINSNFLP+QQ TM
Sbjct: 304 LTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTM 363

Query: 351 LQMGRRNHNAEKEKESEE---------LLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401
           LQMGRR+   E+  ES++         LLTDI++TEK+LQEKID+EVKRQE  L   +AA
Sbjct: 364 LQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAA 423

Query: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461
             E+        + TKK+EFSAS+EVQQ+NRPLA LQKH+HNQ+LL D+DDEL YLK+ L
Sbjct: 424 GDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRL 483

Query: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521
           A +   +Y  L+    N  DT+IQ +M +LK  VF+DC+FVFSGLIPL T++Q ADIV+W
Sbjct: 484 ADLHKRYYSTLK---ENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIW 540

Query: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
           T  FGA++T+++ E TTH+ITKTPGT KAR+AK+FNP IK+VHPDW+FECL  W+ VD K
Sbjct: 541 TNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVK 600

Query: 582 SFELKVDQVASXXXXXXXXXXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641
            + L V+   S                         +    N  A        +DLFAGG
Sbjct: 601 PYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPD-----IDLFAGG 655

Query: 642 SSWL 645
            SWL
Sbjct: 656 ISWL 659

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/673 (57%), Positives = 477/673 (70%), Gaps = 56/673 (8%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T ++ P+G+PYPI I KL+  VGSY+++GDRL  YKFWYLVE  ++ D    + N  D
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVE--RASDTTGDDDNEHD 58

Query: 61  GEQSK-----------KTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCD 109
                           K +RESI+FF++P+EG +I WNVDVGDEI    +++CE+KRPC+
Sbjct: 59  ATPGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCN 118

Query: 110 HDIVYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKK 167
           HDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KK
Sbjct: 119 HDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKK 175

Query: 168 LILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG----- 222
           LILVVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      
Sbjct: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235

Query: 223 -PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281
              PPV KC YYVKVRPGLKEFF+KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+R
Sbjct: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295

Query: 282 ILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSN 341
           ILSRDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSN
Sbjct: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355

Query: 342 FLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401
           FLP+Q   MLQ+GR+    +K +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A 
Sbjct: 356 FLPKQSTGMLQLGRKTR--QKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 413

Query: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461
             EE  A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L
Sbjct: 414 -AEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 472

Query: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521
           + + + +Y+   +   N  + ++ E++P LK+ VF++C+FVFSGLIPLGTDIQ++DIV+W
Sbjct: 473 SNIHNTYYQM--ISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIW 530

Query: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
           T  FGA+STS+I   TTH+ITK P T KAR+AK FNP IK++HPDW+FECL  WK VDEK
Sbjct: 531 TSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEK 590

Query: 582 SFELKVDQVASXXXXXXXXXXXXXXXXXXXTDAVNFSGDL---------NNGTATMSSTD 632
            + L VD   S                    +  NF   L         N     M +  
Sbjct: 591 PYTLIVDSPISDE------------------ELQNFQKQLQKRQEYLEENQQQQHMLTPQ 632

Query: 633 NVVDLFAGGSSWL 645
             ++LFA G+SWL
Sbjct: 633 ENLNLFAAGTSWL 645

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/600 (61%), Positives = 454/600 (75%), Gaps = 26/600 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T +K PD +PYPITI++L A  G  I KG RLFAYK+W   ++  SP++         
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST------ 54

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
             + KK   + I  FD+P EG ++ +N+ +GDE V    +V E+K+ C HD+ Y G+C +
Sbjct: 55  --KPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112

Query: 121 CGKEVDERDQVSAN------LTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDL 174
           CGK V+E    SA+      LT+SHT+TN+K+S ++A  I +T + +L + KKL+LVVDL
Sbjct: 113 CGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDL 172

Query: 175 DQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYV 234
           DQTVIHCGVDPTI EW  DP NPNYE L+++KSF L EE ILPP YMGPKPP  KC YYV
Sbjct: 173 DQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYV 232

Query: 235 KVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHK 294
           K+RPGLKEFFEK+AP +E+HIYTMATRAYA EIAKIIDPDG LFG+RILSRDENGS+THK
Sbjct: 233 KLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHK 292

Query: 295 SLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMG 354
           SLERLFP DQSMVVIIDDRGDVWNW  NLIKV PY+FFVG+GDINSNFLPRQQ +ML +G
Sbjct: 293 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLG 352

Query: 355 RRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG- 413
           RR+    K+ E EELLTDI+DTEKKLQEKID+EVKRQE  L+     + EE   +  N  
Sbjct: 353 RRHR---KKAEEEELLTDILDTEKKLQEKIDEEVKRQEEKLS----KMTEEKQPEDTNSK 405

Query: 414 -DITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472
            D+ KK+E SASLEVQQQNRPLAELQKH+HNQ+LL DDDDEL +L  IL  V  ++Y+ L
Sbjct: 406 EDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL 465

Query: 473 ELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSN 532
              + +S   +I+ LMP+LK+ VF  C+FVFSGLIPLGTD++KADI LWT MFGA +T++
Sbjct: 466 ---SKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTAD 522

Query: 533 ITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592
           I E TTH+ITKTPGT KAR+AK+FNP IKVVHPDW+FECL  WK VDEK++EL ++Q  S
Sbjct: 523 IDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/660 (58%), Positives = 466/660 (70%), Gaps = 32/660 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVE-------IAKSPDELD 53
           M T ++ P+G+PYPI I KLI  VGS++ +GDRL  YKFWYLVE            D   
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 54  VNGNVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIV 113
             G         K +RESI+FF++P+EG +I WNVDVGDEI    +++CE+KRPC+HDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 114 YAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILV 171
           Y G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KKLILV
Sbjct: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177

Query: 172 VDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG-----PKPP 226
           VDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      PKPP
Sbjct: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237

Query: 227 -VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSR 285
            V KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+RILSR
Sbjct: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297

Query: 286 DENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPR 345
           DENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+
Sbjct: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357

Query: 346 QQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEE 405
           Q   MLQ+GR+    +K +ES+EL+TDI+D EKKLQEKID EVKRQE  L H+ A   EE
Sbjct: 358 QSTGMLQLGRKTR--QKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLAT-AEE 414

Query: 406 AVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQ 465
             A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L  + 
Sbjct: 415 PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIH 474

Query: 466 SEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMF 525
             +Y+   L      + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+WT  F
Sbjct: 475 KTYYQM--LSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532

Query: 526 GASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFEL 585
           GA+STS+I   TTH+ITK PGT KAR+AK FNP IKVVHPDW+FECL  WK VDEK + L
Sbjct: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592

Query: 586 KVDQVASXXXXXXXXXXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
            VD   S                           D ++    M      ++LFA G+SWL
Sbjct: 593 IVDSPISDDELQSFQKQLQKKQEYL---------DEHHEQQHMLMPQENINLFAAGTSWL 643

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/598 (60%), Positives = 455/598 (76%), Gaps = 27/598 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TP++ PD +PYPITI++L    G  + KG RL AYK+W LV++  +P E         
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGE--------- 51

Query: 61  GEQSKKTIRESIDF---FDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGI 117
            E++ K  ++ +D    FD+P  GT++  +V VGDE V   R V E+++ C HD+ Y G+
Sbjct: 52  -EEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGL 110

Query: 118 CTMCGKEVDERDQVS-----ANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172
           C  CG+ V++    +     A LT+SHT+T+++VS ++A ++GQ+ + +L  ++KL+LVV
Sbjct: 111 CVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVV 170

Query: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232
           DLDQTVIHCGVDPTI EW  DP+NPNYE L++V+SF L+EE +LPP YMGPKPP  KC Y
Sbjct: 171 DLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWY 230

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292
           YVK+RPGLKEFF K+AP +E+HIYTMATRAYA EIAKIIDPDG LFG+RILSRDENGSLT
Sbjct: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLT 290

Query: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352
            KSLERLFP DQSMVV+IDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLP QQ +ML 
Sbjct: 291 QKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLH 350

Query: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRN 412
           +GRRN   +K K+ EELLTDI+DTEKKL+EKI++EVKRQE D  H+   L +E +   R 
Sbjct: 351 LGRRNR--KKPKQEEELLTDILDTEKKLKEKINEEVKRQE-DQMHR---LTDEKLPDTR- 403

Query: 413 GDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472
            DI KK+E +ASLEVQQQNRPLAELQKHM N++LL DDDDEL +L  IL  V S +Y  L
Sbjct: 404 -DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQL 462

Query: 473 ELKNGNSDDT-SIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTS 531
           +  N   D    I+ LMPKLK +VF+ C FVFSGLIPL T+I++ADIVLWT MFGAS+T+
Sbjct: 463 QRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTA 522

Query: 532 NITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQ 589
           N+  NTTH+IT+TPGT+KAR+AKSFNP+IK+VHPDW+FECL  W+ V+E  +EL V++
Sbjct: 523 NLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEE 580

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/600 (60%), Positives = 444/600 (74%), Gaps = 26/600 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TP++ P  +P+PITI+KL    G  + KG RLF YK+W L ++  +P+E         
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------- 51

Query: 61  GEQSKKTIR-ESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICT 119
            E SKK  R + I  FD+P EGT++   V VGDE V    I+ E+++PC H++ Y  +C 
Sbjct: 52  -EASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCV 110

Query: 120 MCGKEVDERDQ-------VSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172
           +CGK VDE D         +  LT++H +TN+KVS ++A +I +T +  L   KKL+LVV
Sbjct: 111 VCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVV 170

Query: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232
           DLDQTVIHCGVDPTI EW NDPSNPNY+ L+NVK+F L+E+ ILPP YMGP+PP  +C Y
Sbjct: 171 DLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQY 230

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292
           YVK+RPGL+EFF+KVAP +E+HIYTMATRAYA EIAKIIDP  +LFG+RILSRDENGSLT
Sbjct: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLT 290

Query: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352
           HKSLERLFP DQSMVVIIDDRGDVW+W  NLIKV PYNFFVG+GDINSNFLPRQQ +ML 
Sbjct: 291 HKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH 350

Query: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRN 412
           MGRR+    K+ E EELLTDI+DTEKKLQEKID+EVK+QE      S     +    +  
Sbjct: 351 MGRRHR---KKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEE--NQPDRSMSK 405

Query: 413 GDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472
            D+TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L EIL  V   +Y+ L
Sbjct: 406 EDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL 465

Query: 473 ELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSN 532
                  D   I+ LMP++K  VF  C+FVFSGLIPLGT+I+ ADIVLWT MFGA ++S+
Sbjct: 466 AKTEVFPD---IKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSD 522

Query: 533 ITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592
           I ENTTHVITKTPGT KAR+AKS+NP IK+VHPDW+FECL  W   DEK +EL ++Q  S
Sbjct: 523 IDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVS 582

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/602 (59%), Positives = 449/602 (74%), Gaps = 30/602 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TP++ P  +P+P+TI+KL    G  + KG RLF YK+W L +I  +P+E         
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE--------- 51

Query: 61  GEQSKKTIR-ESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICT 119
            E  KK  R + I  FD+P EGT++  N+ +GDE V    ++ EV + C H++ Y G+C 
Sbjct: 52  -EAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCV 110

Query: 120 MCGKEVDERDQ-VSAN------LTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172
           +CGK V+E DQ VS N      LT++H +TN+KVS ++A  I +T +  L   KKL+LVV
Sbjct: 111 VCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVV 170

Query: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232
           DLDQTVIHCGVDPTI EW NDPSNPNY+ L+NVK+F L+E+ ILPP YMGP+PP  KC Y
Sbjct: 171 DLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQY 230

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292
           YVK+RPGL+EFF+K+AP +E+HIYTMATRAYA EIAKIIDP G LFG+RILSRDENGSLT
Sbjct: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLT 290

Query: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352
           HKSLERLFP DQSMVVIIDDRGDVW+W  NLIKV PYNFFVG+GDINSNFLPRQQ +ML 
Sbjct: 291 HKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH 350

Query: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQ--V 410
           +GRRN    K+ E EELLTDI+DTEKKLQEKID+EVK+QE     K   + EE   +  +
Sbjct: 351 LGRRNR---KKAEEEELLTDIMDTEKKLQEKIDQEVKKQE----EKFNKINEENQPERPI 403

Query: 411 RNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYK 470
              D+TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L  IL  V   +Y 
Sbjct: 404 SKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYD 463

Query: 471 ALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASST 530
            L  +    D   I+ LMP++K  VFK C+FVFSGLIPLGT++++ADIVLWT MFGA+++
Sbjct: 464 KLAEQGQPPD---IKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTS 520

Query: 531 SNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQV 590
            ++ E TTHVITKTPGT KAR+AK++NP+IKV+HPDW+FECL  W  V+EK +EL  +Q 
Sbjct: 521 VDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQD 580

Query: 591 AS 592
            S
Sbjct: 581 VS 582

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/656 (55%), Positives = 458/656 (69%), Gaps = 30/656 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TP++ PD +PYPIT+++L    G  + +G RLFAYK+W   +I  SP      G+   
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSP------GDESA 54

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G +SK+   + +  FD+P  G ++  N+ +GDE V     V E+K+PC HD+ Y G+C  
Sbjct: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114

Query: 121 CGKEVDERDQVS-------ANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVD 173
           CG+ V E +Q S       A LT+SHT+ N+++S ++A  + ++ + +L  ++KL+LVVD
Sbjct: 115 CGQTV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVD 173

Query: 174 LDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYY 233
           LDQTVIHCGVDPTI EW  DP NPNYE+L++V+SF L EE +LPP YMGPKPP  KC YY
Sbjct: 174 LDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYY 233

Query: 234 VKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTH 293
           VK+RPGL++FF  +AP +E+HIYTMATR YA EIAKIIDPDG+LFG+RILSRDENGSLT 
Sbjct: 234 VKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQ 293

Query: 294 KSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQM 353
           KSLERLFP DQSMVVIIDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ +ML +
Sbjct: 294 KSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHL 353

Query: 354 GRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQ--VR 411
           GRRN   +K K+ EELLTDI+DTEKKL+ KI +EVKRQE ++      L EE +      
Sbjct: 354 GRRNR--KKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM----QKLSEEKIPDHTTS 407

Query: 412 NGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKA 471
             DI KK+E +ASLEVQQQNRPLAELQKH+HN++LL DDDDEL +L +IL  V S +Y  
Sbjct: 408 KEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQ 467

Query: 472 LELKNGNSDDTS--IQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASS 529
           LE     + + S  I+ L+P LK  VFK CNFVFSGLIPL T+I +ADIVLWT  FGA +
Sbjct: 468 LEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKT 527

Query: 530 TSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQ 589
           T NI  NTTH+ITKTPGT+KAR+A SFN  IK+VHPDW+FEC+  WK VDEK +EL V++
Sbjct: 528 TINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEE 587

Query: 590 VASXXXXXXXXXXXXXXXXXXXTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
             S                   T+    S D N  +    + ++ + L  G  SWL
Sbjct: 588 PVS------KEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWL 637

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/587 (57%), Positives = 423/587 (72%), Gaps = 17/587 (2%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           + T VK    +PYPIT+++L    G ++ KG RLFAY++W   ++            V+ 
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVL-----------VKY 51

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
            E++KK   + +  FD+P  GT+  W+  V DE       V  +++ C+HDI Y G+C  
Sbjct: 52  EEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CG  VDE D  S NLTISH +TN+KVS Q+A  + +++ +RL   KKL+LVVDLDQTVIH
Sbjct: 112 CGNTVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EW  DP NPNY+ L++VKSF LE+E I+P  Y GPKPP  K  YYVK+RPGL
Sbjct: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFE V+P +EMHIYTMATR+YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLF
Sbjct: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           P DQSMVV+IDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ ++L +GR +   
Sbjct: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHH--- 347

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
            +++E E+L++DIID EKKL+EKID+EVKRQE  ++H       +        DI+KK+E
Sbjct: 348 RRKQEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLE 407

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
            SASLEVQQQNRPLAELQKH+HNQ LL DDDDEL +L +IL  V  E++        N  
Sbjct: 408 HSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPP 467

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           D  I+ L+P++K  VF+ C+FVFSGLIPL TD++KADIVLWT MFGA+++S+I   TTH+
Sbjct: 468 D--IKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHI 525

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKV 587
           IT T  T KAR+AKSFNP IK+VHPDW+FECL  W+ V E  +EL +
Sbjct: 526 ITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLI 572

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 81/177 (45%), Gaps = 45/177 (25%)

Query: 124 EVDERDQVSANLTISHTDTN----------LKVSRQEANNIGQTNKSRLIRSKKL----- 168
           +V++ D V  N+++++ + N          + +S+ +AN +  T    L+  K++     
Sbjct: 263 QVNQNDPVMNNMSLNYAEINENNKMIDGNLIDLSKLQANQVSATGYETLLAPKEIKRFGR 322

Query: 169 --ILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
              L++DLD+T++H       S +K                +V   + ++P         
Sbjct: 323 KKCLILDLDETLVH-------SSFK----------------YVDSADFVIPVTIDNQTHH 359

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL 283
           V     YV  RPG+ EF ++V+ +YE+ ++T +   Y + +  I+DP  ++  +R+ 
Sbjct: 360 V-----YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

Query: 493 RSVFKDCNFVFSGLIPLGTDIQKADIVLWTKM---FGASSTSNITENTTHVITKTPG--T 547
           R + KDC    S  +       + + +L++++    G S +  I+  TTH+I+  P    
Sbjct: 120 RHILKDCTIYVSRTV-----FNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPA 174

Query: 548 LKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFEL 585
           L A +A   +  IK V+P W+ +C    K+VDEK+F L
Sbjct: 175 LIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFIL 212

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 32/126 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                 +++ LR    FV+       P+ +  +  
Sbjct: 229 KKCLVLDLDETLVHS----------------SFKYLRTA-DFVI-------PVEIDDQ-- 262

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS----LFGNRI 282
           VH    YV  RPG+ EF E+V  +YE+ ++T +   Y + +  I+DP G+    LF +  
Sbjct: 263 VHNV--YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSC 320

Query: 283 LSRDEN 288
            + D N
Sbjct: 321 YNYDGN 326

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K            +   FVL       P+ +  + 
Sbjct: 221 QKKCLILDLDETLVH-------SSFK----------YMHTADFVL-------PVEIDDQ- 255

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V  +YE+ ++T +   YA  +   +DP+G++
Sbjct: 256 -VHNV--YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K                FVL       P+ +  + 
Sbjct: 221 QKKCLILDLDETLVH-------SSFK----------YMQTADFVL-------PVEIDDQ- 255

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V+ +YE+ ++T +   YA  +   +DP+G++
Sbjct: 256 -VHNV--YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K            +   FVL       P+ +  + 
Sbjct: 226 QKKCLILDLDETLVH-------SSFK----------YMHSADFVL-------PVEIDDQ- 260

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V+ +YE+ ++T +   YA  +   +DP+G++
Sbjct: 261 -VHNV--YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 32/122 (26%)

Query: 166 KKLI----LVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYM 221
           KKLI    LV+DLD+T++H                  ++ L+    FVL       P+ +
Sbjct: 297 KKLIGKKCLVLDLDETLVHSS----------------FKYLQTA-DFVL-------PVNI 332

Query: 222 GPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281
             +  +H    YV  RPG++EF ++V  ++E+ ++T +   Y + +  I+DP   L  +R
Sbjct: 333 DEQ--IHNV--YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHR 388

Query: 282 IL 283
           + 
Sbjct: 389 LF 390

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 143 NLKVSRQEANNIGQTNKSRLIRSKKLI------------LVVDLDQTVIHCGVDPTISEW 190
           N  V    +N IG  N  R +  KKLI            L++DLD+T+IH     ++S  
Sbjct: 156 NKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIH-----SMSRN 210

Query: 191 KNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPI 250
            +  +  NY  L  VK F     A  P    GP  P+    YYV  RP    F   V+  
Sbjct: 211 ISSSTISNYH-LIEVK-FPTPTSA--PTSAPGPSLPLSSL-YYVYKRPYCDHFLNLVSDW 265

Query: 251 YEMHIYTMATRAYAEEI 267
           Y++ I+T + + YA+ +
Sbjct: 266 YDLIIFTASMKEYADPV 282

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL 283
           YV  RPG+ EF EKV  ++E+ I+T +   Y + +   +DP G    +R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 28/108 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H                 +++ LR+   FVL  E             
Sbjct: 257 KKCLILDLDETLVHS----------------SFKYLRSA-DFVLSVEI---------DDQ 290

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPD 274
           VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D D
Sbjct: 291 VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 29/112 (25%)

Query: 163 IRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG 222
           I+ KK  L++DLD+T++H                  ++ LR+   FVL       P+ + 
Sbjct: 242 IKDKKC-LILDLDETLVHSS----------------FKYLRSA-DFVL-------PVEID 276

Query: 223 PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPD 274
            +  VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D D
Sbjct: 277 DQ--VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 324

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 54/108 (50%), Gaps = 28/108 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H                 +++ LR+   FVL       P+ +  +  
Sbjct: 244 KKCLILDLDETLVHS----------------SFKYLRSA-DFVL-------PVEIDDQ-- 277

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPD 274
           VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D D
Sbjct: 278 VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD 323

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 28/113 (24%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S +  LV+DLD+T++H                  ++ L++   FVL       P+ +  +
Sbjct: 309 SHRKCLVLDLDETLVHSS----------------FKYLKSAD-FVL-------PVDIDDQ 344

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +H    YV  RPG+ EF  +V  +YE+ ++T +   Y + +  I+D D S+
Sbjct: 345 --IHNV--YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 29/119 (24%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           K+ + + KK  LV+DLD+T++H                 +++ LR    FV+       P
Sbjct: 237 KADMFKGKK-CLVLDLDETLVHS----------------SFKYLRTAD-FVI-------P 271

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
           + +  +  VH    YV  RPG+ EF  ++  +YE+ ++T +   Y + +  I+D D ++
Sbjct: 272 VEIDNQ--VHNV--YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 28/113 (24%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S K  LV+DLD+T++H       S +K                +V   + +LP   +  +
Sbjct: 226 SNKKCLVLDLDETLVH-------SSFK----------------YVRTADFVLP---VEIE 259

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +H    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  I+D   S+
Sbjct: 260 DQIHNV--YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 509 LGTDIQKADIVLWTKM---FGASSTSNITENTTHVITKTPGTLKARIAK-SFNPSIKVVH 564
           L    + ++ +L+T++    G +   NI   TTH+IT  P      I K +   SIK ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 565 PDWVFECLSTWKHVDEKSFEL 585
           P W+  C+   + +DE   E+
Sbjct: 193 PTWLIHCVKESQLIDESEHEI 213

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 27/117 (23%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H       S +K                F+   + ILP      +  
Sbjct: 312 KKCLILDLDETLVH-------SSFK----------------FINNPDFILPIEIEDGQ-- 346

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL 283
           +H    YV  RPG+  F  +V   YE+ I+T +   YA  +  ++D D +L  +R+ 
Sbjct: 347 IHNV--YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 28/108 (25%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S K  LV+DLD+T++H                 +++ L+    FVL       P+ +  +
Sbjct: 310 SGKKCLVLDLDETLVHS----------------SFKYLKGAD-FVL-------PVDIDDQ 345

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
             +H    YV  RPG+ EF +KV  ++E+ I+T +   Y + +  I+D
Sbjct: 346 --IHNV--YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 28/111 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                  ++ LR    FVL       P+ +  +  
Sbjct: 240 KKCLVLDLDETLVHSS----------------FKYLR-TADFVL-------PVNIDDQ-- 273

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
           VH    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  I+D   S+
Sbjct: 274 VHNV--YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K            +   FVL       P+ +  + 
Sbjct: 214 QKKCLILDLDETLVH-------SSFK----------YLHTADFVL-------PVEIDDQ- 248

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V+ +YE+ ++T +   YA  +   +DP+ ++
Sbjct: 249 -VHNV--YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 28/104 (26%)

Query: 170 LVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHK 229
           LV+DLD+T++H       S +K            N+  FVL       P+ +  +     
Sbjct: 285 LVLDLDETLVH-------SSFK----------YLNIADFVL-------PVDIDNQVQ--- 317

Query: 230 CSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP 273
            + YV  RPG+ EF + V  +YE+ ++T +   Y   +  I+DP
Sbjct: 318 -NVYVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H                 +++ LR+   FVL  E             
Sbjct: 245 KKCLILDLDETLVHS----------------SFKYLRSA-DFVLPVEI---------DDQ 278

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D
Sbjct: 279 VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 28/111 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H       S +K            +   FVL       P+ +  +  
Sbjct: 221 KKCLVLDLDETLVH-------SSFK----------YLHTADFVL-------PVDIDDQ-- 254

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
           +H    YV  RPG+ EF  +VA +YE+ ++T +   Y + +  I+D   S+
Sbjct: 255 IHNV--YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 53/113 (46%), Gaps = 28/113 (24%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S+K  LV+DLD+T++H       S +K                ++   + +LP   +   
Sbjct: 311 SRKKCLVLDLDETLVH-------SSFK----------------YLKSADFVLP---VDID 344

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +H    YV  RPG+ EF ++V  I+E+ ++T +   Y + +  ++D   S+
Sbjct: 345 DQIHNV--YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI 395

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                 +++ LR    FVL       P+ +  +  
Sbjct: 283 KKCLVLDLDETLVHS----------------SFKYLRTA-DFVL-------PVDIDDQ-- 316

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           +H    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  I+D
Sbjct: 317 IHNV--YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 73/188 (38%), Gaps = 40/188 (21%)

Query: 127 ERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLI------------LVVDL 174
           +RD V  +L  +    +   SR     +G     R +  KKLI            LVVDL
Sbjct: 116 QRDAVKGSLAPAKYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDL 175

Query: 175 DQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYV 234
           D+T+IH     T        SN     +  ++ F +   + L               YYV
Sbjct: 176 DETLIHSASRTT------SHSNSAQGHMVEIR-FAISGVSTL---------------YYV 213

Query: 235 KVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS------LFGNRILSRDEN 288
             RP    F  KV+  Y++ ++T + R YA+ +   ++   S      L+ N  + RD  
Sbjct: 214 HKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGV 273

Query: 289 GSLTHKSL 296
           G +   S+
Sbjct: 274 GYIKDLSI 281

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 51/110 (46%), Gaps = 28/110 (25%)

Query: 163 IRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG 222
           I S K  L++DLD+T++H       S +K                ++   + ++P   + 
Sbjct: 514 IFSGKKCLILDLDETLVH-------SSFK----------------YLTSADFVIP---VD 547

Query: 223 PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
               +H    YV  RPG+ +F E V+ I+E+ ++T +   Y + +  ++D
Sbjct: 548 IDEQIHNV--YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 29/119 (24%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           K  + ++KK  LV+DLD+T++H       S +K                ++   + +LP 
Sbjct: 300 KDPVFKNKKC-LVLDLDETLVH-------SSFK----------------YIDTADFVLP- 334

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +      H+   YV  RPG+ EF ++V  I+E+ ++T +   Y + +  I+D   S+
Sbjct: 335 --VTIDDQTHQV--YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H       S +K                ++   + +LP   +     
Sbjct: 277 KKCLVLDLDETLVH-------SSFK----------------YLHTADFVLP---VDIDDQ 310

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           +H    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  ++D
Sbjct: 311 IHNV--YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           YV  RPG+ EF  +V  +YE+ ++T +   Y + +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDE----N 288
           YV  RPG+  F +  + ++E+ I+T +   Y   +  I+D    L  +R+  RD     N
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 289 GSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPN 322
           G+   K+L +L     S ++I+D+    + + PN
Sbjct: 276 GNYI-KNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 164 RSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP 223
           R KKL+L  DLD+T+IH     +IS      S PN     N ++ ++E            
Sbjct: 191 RKKKLVL--DLDETLIH-----SISR-----STPNSN---NAQAHLVEV----------- 224

Query: 224 KPPVHKCS--YYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
           K P+   S  YYV  RP    F  KV   Y++ I+T + + YA+ +
Sbjct: 225 KFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPV 270

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           +S L   +K  LVVDLD+T+IH              S+ N      V       E   PP
Sbjct: 145 QSILFAERKKRLVVDLDETLIHSATRSV--------SHSNSAQGHMV-------EVRFPP 189

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
             +          YYV  RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 190 SSIS-------TLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPV 231

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK  +    + +P 
Sbjct: 243 KSILNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVKFGI----SGIPT 292

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
           +Y      +HK       RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 293 LYF-----IHK-------RPYCDFFLTKVSRWYDLIIFTASMKEYADPV 329

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 487 LMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPG 546
           L+  L+  +F     + S    LG   Q+  I    +  G +ST+ +++  THV++  P 
Sbjct: 332 LLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKKNTHVLSCMPY 389

Query: 547 TLKARIAKSFNPSIKVVHPDWVFECLSTWKHVD 579
             K + A  ++ + KVV+  W+ EC    K +D
Sbjct: 390 GQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLD 422

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 515 KADIVLWTKM---FGASSTSNITENTTHVITKTPG--TLKARIAKSFNPSIKVVHPDWVF 569
           K +++ ++++    G ++  +I+  TTH+IT  P    + A IA     +I  V+P W+ 
Sbjct: 134 KTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLC 193

Query: 570 ECLSTWKHVDEKSFELKVDQVA 591
           +C  +   V+E    + +   A
Sbjct: 194 QCFKSMTLVNESDHLINIQSSA 215

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           YV  RPG+ EF ++V  ++E+ ++T +   Y + +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                 +++ LR    FV+       P+ +  +  
Sbjct: 240 KKCLVLDLDETLVHS----------------SFKFLRTA-DFVI-------PVEIDNQ-- 273

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           +H    YV  RPG+ EF + V  +YE+ ++T +   Y + +  ++D
Sbjct: 274 IHNV--YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLD 317

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 10/87 (11%)

Query: 275 GSLFGNRILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP---NLIKVTPYNF 331
           G L   R LS+ +   L H  LER      S+V + D R +++N+ P   N+IK+  +NF
Sbjct: 90  GGLTSLRGLSKSKPNRLAH-GLERCLFEPMSIVPLKDRRSNIYNFKPFLENIIKLKDFNF 148

Query: 332 FVGIGDINSNFLPRQ-QATMLQMGRRN 357
                D  + F+P    + +L++ R++
Sbjct: 149 -----DAITGFVPPSLDSRLLELARKH 170

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 492 KRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKAR 551
           K+SVF     + +     G   Q+  I   T   G  +T+ ++     ++   P  +K +
Sbjct: 340 KKSVFNKDELILTYTNLFGP--QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYK 397

Query: 552 IAKSFNPSIKVVHPDWVFECLSTWKHVDEKSF 583
            A+ +   + +V P+W+ EC    K +D K F
Sbjct: 398 TAEKWGDKLIIVGPNWLEECYKANKKLDPKLF 429

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 28/108 (25%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S K  LV+DLD+T++H                 +++ LR    FV+       P+ +  +
Sbjct: 237 SGKKCLVLDLDETLVHS----------------SFKFLRTAD-FVI-------PVEIDNQ 272

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
             VH    YV  RPG+ +F   V  +YE+ ++T +   Y + +  ++D
Sbjct: 273 --VHNV--YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLD 316

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK F +     L  
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGISGIRTL-- 293

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
                        Y++  RP    F  KV+  YE+ I+T + + YA+ +
Sbjct: 294 -------------YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPV 329

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK F L     L  
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGLSGIRTL-- 293

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
                        Y++  RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 294 -------------YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPV 329

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 487 LMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPG 546
           L    K+ +FK    + +     G   Q++ I   T+M G  ST+ +++  TH++++ P 
Sbjct: 348 LFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHLVSRMPV 405

Query: 547 TLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELK 586
             K   AK +    +V++  W+     T    D  S E +
Sbjct: 406 GKKFFQAKKWKDRCQVINHLWLERTYKTGIKQDPNSSEFQ 445

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 3/68 (4%)

Query: 525 FGASSTSNITENTTHVIT---KTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
            G + T  I   TTH+I      P  +  +     N  IK V+P W+ +C    K++DE 
Sbjct: 160 LGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYIDES 219

Query: 582 SFELKVDQ 589
              +  DQ
Sbjct: 220 PHLITEDQ 227

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG + F   ++  YE+ +++     Y+E+ A+ +DP       +LF    
Sbjct: 212 QKYGWRTAKRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHC 271

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 272 VYKD---GVHIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7.153
           YIR002C
          Length = 994

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 354 GRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKR----QEADLTHKSAALGEEAVAQ 409
           GR+  +  K KE EE+L  I    KK QEK+++E +R    ++A +   S    +E + Q
Sbjct: 505 GRKKGDKLKRKEEEEIL-QIAKKRKKEQEKLEREGRRTGSSEDAQINGMSQKQQKEVIQQ 563

Query: 410 VRNGDI 415
            +NGD 
Sbjct: 564 FKNGDF 569

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG   F   ++  +E+ +++     Y+E+IA+ +DP       +LF    
Sbjct: 214 QKYGWRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHC 273

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 274 VYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRILSRDENGSL 291
           RPG   F   ++  YE+ +++     Y+++IA+ +DP       +LF    + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 292 THKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
             K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRILSRDENGSL 291
           RPG+  F   ++  YE+ +++     YAE+IA+ +DP       +LF    L +D    +
Sbjct: 221 RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYKD---GV 277

Query: 292 THKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
             K L +L   D   V+IID   + +   P N I + P++
Sbjct: 278 HIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG+  F   ++  YE+ +++     Y E+IA+ +DP       +LF    
Sbjct: 220 QKYGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEHC 279

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D + V+IID   + +   P N I V P++
Sbjct: 280 VYKD---GVHIKDLSKL-NRDVNKVLIIDTEPNNYKLQPENAIPVKPWD 324

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 36/96 (37%), Gaps = 9/96 (9%)

Query: 492 KRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMF---GASSTSNITENTTHVITKTPGTL 548
           K    KDC    S           A+  L+T M    G      ++   TH+IT  P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 549 KARIAKSFNP-SIKVVHPDWVFECLSTWKHVDEKSF 583
              + K FN   +  V   W+ EC    ++V E ++
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY 205

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 490 KLKRSVFKDCNFVFSGLIPL--GTDIQKADIVLWTKMFGASS-TSNITENTTHVITKTPG 546
           K++     D + +   L PL    D+ K  + +  K  GA      ++ +TTH +     
Sbjct: 161 KVRTHKMTDMSGITVCLGPLVKSGDVTKEHMEVSLKAIGAKPLQKRVSLDTTHFVCNDAQ 220

Query: 547 TLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVD 588
           +    +A++ N +I VV P+W+  C    + V  + F L VD
Sbjct: 221 SDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVD 262

>ZYRO0D13706g Chr4 complement(1148881..1149444) [564 bp, 187 aa]
           {ON} highly similar to uniprot|P15454 Saccharomyces
           cerevisiae YDR454C GUK1 Guanylate kinase converts GMP to
           GDP required for growth and mannose outer chain
           elongation of cell wall N-linked glycoproteins
          Length = 187

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 78/192 (40%), Gaps = 33/192 (17%)

Query: 1   MATPVKF--PDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVE-IAKSPDELDVNG- 56
           M+ P+ F  P G      + KL A            F  KF + V    +SP   +VNG 
Sbjct: 1   MSRPIVFSGPSGTGKSTLLKKLFAE-----------FPDKFGFSVSSTTRSPRPGEVNGR 49

Query: 57  --NVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVY 114
             N    EQ +K I+E      A F G   G  VD   +++E G++       C  DI  
Sbjct: 50  EYNFVQVEQFQKMIQEGKFIEWAQFSGNYYGTAVDSVKKVIESGKV-------CLLDIDM 102

Query: 115 AGICTMCGKEVDER---------DQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRS 165
            G+  +   +++ R         + + + L    T+T   +S++ A   G+ + +     
Sbjct: 103 QGVKAVKSSDLNARFLFIAPPSVEDLESRLRGRGTETEESISKRLAAAKGEMDFASTGVH 162

Query: 166 KKLILVVDLDQT 177
            K+I+  DL++ 
Sbjct: 163 DKIIVNDDLNRA 174

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG   F   ++  +E+ +++     Y+++IA+ +DP       +LF    
Sbjct: 209 QKYGWRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHC 268

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 269 VYKD---GVHIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 491 LKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKA 550
           LK+SV +    + S     G  +Q++ I   T+  G  ST+++T+  TH++++     K 
Sbjct: 344 LKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVSTTSLTKRNTHLVSRMAIGKKF 401

Query: 551 RIAKSFNPS-IKVVHPDWVFEC 571
            +AK +     +VV+  W+ EC
Sbjct: 402 ELAKQWGGQRCRVVNHLWLEEC 423

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 16/108 (14%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG+  F   ++  YE+ +++     Y E+IA+ +DP       SLF    
Sbjct: 228 QKYGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYSLFKEHC 287

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYN 330
           + +D    +  K L +L   D + V+IID         PN  K+ P N
Sbjct: 288 VYKD---GVHIKDLSKL-NRDVNKVLIIDT-------DPNNYKLQPEN 324

>Smik_4.430 Chr4 complement(781942..783402) [1461 bp, 486 aa] {ON}
           YDR181C (REAL)
          Length = 486

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 309 IIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQA--TMLQ----MGRRNHNAEK 362
           +I DR D+ NW+  L KVT  N F    ++ +     +Q   +ML     M ++ HN  +
Sbjct: 167 LISDRLDMLNWATTLQKVTKINDFTDENEMETKRYQTKQLIDSMLHKFESMKKKGHNLAR 226

Query: 363 EKESEELLTDIIDTEK--KLQEKIDK 386
              S + L  ++ ++   KL  +ID+
Sbjct: 227 RPASSDSLLKMVSSKDWPKLYSRIDR 252

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 514 QKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFN-PSIKVVHPDWVFECL 572
           Q++ I    ++ G  ST+  ++  TH+I+++    K + A  +   S+ VV+  W+ EC 
Sbjct: 364 QRSYIQRLVELLGGVSTTEFSKRNTHLISRSNVGKKFKTAMKWGESSVIVVNHLWLEECY 423

Query: 573 STWKHVDEKSFELK 586
              K +D K+ E +
Sbjct: 424 KLNKKLDPKTNEFR 437

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG+  F   ++  YE+ +++     Y++ IA+ +DP       +LF    
Sbjct: 213 QKHGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFVSYNLFKEHC 272

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           L +D    +  K L +L   D+  V+IID   + +   P N I + P++
Sbjct: 273 LYKD---GVHIKDLSKL-NRDEKKVLIIDVDPNSYKLQPENAIPMKPWD 317

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRD---ENGSLTH 293
           RPG   F   ++  YE+ +++     Y+E+IA+ +DP  +     +       + G  TH
Sbjct: 218 RPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLYKEHCVYKEG--TH 275

Query: 294 -KSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
            K L +L   D   V+IID   + + + P N I V P+N
Sbjct: 276 IKDLSKL-NRDLDKVLIIDCDPNNYKFQPENAIPVKPWN 313

>Kpol_2002.93 s2002 complement(218908..225030) [6123 bp, 2040 aa] {ON}
            complement(218908..225030) [6123 nt, 2041 aa]
          Length = 2040

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 50/129 (38%), Gaps = 28/129 (21%)

Query: 6    KFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQDGEQSK 65
            +F   MP+   I KL++     I   +  + Y+  +L+  A   DE       Q   +SK
Sbjct: 1065 QFSKTMPFTRFIYKLLSAA---IEMSEGSYLYELLHLIH-AIFKDE-------QILMESK 1113

Query: 66   KTIRES----------IDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYA 115
            K I +S          +  FD+ FE           D IV     + E    CDHD VY 
Sbjct: 1114 KIIPDSYLEVPICELLVKIFDSQFENKF-------SDSIVTKANFLFEEMVSCDHDRVYE 1166

Query: 116  GICTMCGKE 124
             +    GK+
Sbjct: 1167 TLTNTLGKD 1175

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 56/125 (44%), Gaps = 15/125 (12%)

Query: 382 EKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE---FSASLEVQQQNRPLAELQ 438
           EK DK +++    LT  S  L  + V    N D+   +    FS SL  +  N    ++ 
Sbjct: 26  EKADKRIRQLAQQLTRTSTNLDTQDVNGNNNNDVQSTVSRSIFSDSLLKEGVNPVFTDIN 85

Query: 439 KHMHNQQLLRDDDDELSY--LKEI--LATVQSEFYKALEL----KN----GNSDDTSIQE 486
              +N++L  + D+  SY  +K I  LA    ++YK  +L    KN    GNS D S Q 
Sbjct: 86  DPNYNEKLDPNSDNFSSYDWVKNISNLANADPDYYKPYKLGCSWKNLTAEGNSSDVSYQS 145

Query: 487 LMPKL 491
            +  L
Sbjct: 146 TVLNL 150

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           +S L   KK ILV+DLD+T+IH     T              +  + +  ++E +  +  
Sbjct: 192 QSVLNNEKKKILVLDLDETLIHSMSRGT-------------SSSNSSQGHMVEVKFAVSG 238

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS-L 277
           +            Y+V  RP    F  KVA  Y + ++T + + YA+ +   ++   S  
Sbjct: 239 I---------SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGS 289

Query: 278 FGNRILSRD 286
           F  R+  +D
Sbjct: 290 FSQRLYRQD 298

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/67 (19%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 524 MFGASSTSNITENTTHVITKTPGTLKARIAKSFNP-SIKVVHPDWVFECLSTWKHVDEKS 582
           +FG +    ++   TH+IT     +  +  + F+  ++  + P+W+ +CL   +++ E  
Sbjct: 148 VFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKEDE 207

Query: 583 FELKVDQ 589
           + + V++
Sbjct: 208 YLINVNE 214

>TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON}
           Anc_8.865 YML091C
          Length = 1395

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 11/74 (14%)

Query: 505 GLIPLGTDIQKADIVLWTKMFGA--SSTSNITENTTHVITKTPGTLKARIAKSFNPSIKV 562
            LI LG  + K DI   T++F    +  S++T N   +          ++ K+F  S+ +
Sbjct: 514 SLIILGNILIKGDINYATQIFETKLNEISSLTSNKNEIF---------QLVKNFILSVSI 564

Query: 563 VHPDWVFECLSTWK 576
           V+P+  +E LST+K
Sbjct: 565 VNPNHGYELLSTFK 578

>KLLA0E09131g Chr5 complement(815506..816633) [1128 bp, 375 aa] {ON}
           similar to uniprot|A2TBP4 Saccharomyces cerevisiae
           YDL115C IWR1 Protein of unknown function deletion causes
           hypersensitivity to the K1 killer toxin
          Length = 375

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 32  DRLFAYKFWYLVEIAKSPDELDVNGNVQDGEQSKKTIRESIDFFDAPFEG 81
           DR  +    YL E+    DELD N NV DGEQ+ +T  ++ D FDA F+ 
Sbjct: 236 DRTDSEDIVYLDELN---DELDQNYNV-DGEQANETTNDNGDEFDALFQN 281

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 525 FGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFE 584
            G  ST  +++  TH+I   P   K   A+S    I VV+  W+ +C+     V E  FE
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.46
           YOR346W
          Length = 923

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 72/168 (42%), Gaps = 21/168 (12%)

Query: 415 ITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALEL 474
           I  KI+   +L   ++N+ +A++++ +H+     DD    S + +     + ++++  E 
Sbjct: 53  IDDKIKNVTNLNFSEKNK-IAKVEEQVHS-----DDRSSNSNIVKTAHYGRGQYFRDKEF 106

Query: 475 KNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNIT 534
           K    D   +QE   K+K  +FK+C    +G       +    IV+    F    TS   
Sbjct: 107 KQLQQDQKLVQENQDKIK--IFKNCVIYINGYTDPDRLVLHKLIVIHGGKFLHHMTS--K 162

Query: 535 ENTTHVI-TKTPGTLKARIAKSFNPSIKVVHPDWVF-----ECLSTWK 576
              TH++ T  P   +   AK      KV+ P+W+      E L  W+
Sbjct: 163 GRVTHIVATNLPLKKRVEFAK-----YKVITPEWILDSVKAEVLQPWQ 205

>CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154w
          Length = 828

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/144 (18%), Positives = 59/144 (40%), Gaps = 25/144 (17%)

Query: 453 ELSYLKEILATVQSEFYKALELKNGNSDDTSIQELMPKLK------RSVFKDCNFVFSGL 506
           +L++L  +        YK +E K           ++P++       R + + C    S  
Sbjct: 83  QLAFLYMVPVVTPEWLYKCIEEK----------RVIPQVHKYSPDARHILRYCQLYISPF 132

Query: 507 IPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKAR-------IAKSFNPS 559
               ++ Q  + +  T+  G  + + I++ TTH++ KT      +       + +  NP+
Sbjct: 133 TIDSSERQFLEDI--TQTLGGITQNFISDKTTHIVIKTFDDPLVKEMDDNVILKEVLNPT 190

Query: 560 IKVVHPDWVFECLSTWKHVDEKSF 583
           +K+V   W+ +C  T    +E  +
Sbjct: 191 MKIVSYQWLLDCFKTVSWANEIKY 214

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 524 MFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSF 583
           + G SST+ ++   TH+I+  P   K   A  +N  I V H  W+ +C    K +D  + 
Sbjct: 364 LLGGSSTTELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYKLRKKLDPNAP 422

Query: 584 EL 585
           E 
Sbjct: 423 EF 424

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,845,328
Number of extensions: 3249588
Number of successful extensions: 15095
Number of sequences better than 10.0: 275
Number of HSP's gapped: 15633
Number of HSP's successfully gapped: 293
Length of query: 732
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 615
Effective length of database: 40,065,477
Effective search space: 24640268355
Effective search space used: 24640268355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)