Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002408.839ON73273239090.0
Kpol_1068.98.839ON74575525470.0
ZYRO0G14168g8.839ON76464523580.0
KAFR0B039108.839ON72473323400.0
TDEL0B005808.839ON71364523360.0
CAGL0M02959g8.839ON75864923150.0
TBLA0D032608.839ON76876922830.0
NCAS0C004208.839ON72565422690.0
NDAI0K004208.839ON77869522210.0
KNAG0J002808.839ON74275120700.0
YMR277W (FCP1)8.839ON73267220680.0
Skud_13.4498.839ON73467520670.0
SAKL0D01496g8.839ON68871120470.0
Smik_13.4908.839ON73266420470.0
Suva_13.4658.839ON73266020320.0
ABL127W8.839ON72872819960.0
Kwal_27.102638.839ON74366419850.0
KLTH0C03894g8.839ON74562019730.0
Ecym_46108.839ON75168419690.0
KLLA0D01595g8.839ON71965118340.0
TPHA0E030705.202ON4941771243e-06
Kpol_1010.615.94ON932981182e-05
SAKL0G12870g5.202ON3991261073e-04
Smik_12.825.202ON3921121039e-04
NCAS0A068005.202ON4731221030.001
NDAI0D018605.202ON514511020.001
YLR019W (PSR2)5.202ON3971121020.001
Skud_12.875.202ON3921121020.001
TBLA0I014602.530ON3931371010.001
YLL010C (PSR1)5.202ON427108980.004
Smik_12.535.202ON414108960.006
Suva_10.655.202ON415112950.007
TBLA0C060905.202ON484117950.008
KNAG0M017405.202ON481113950.008
NCAS0D027405.202ON398113950.008
KAFR0E021405.94ON95181960.008
KLLA0F15620g5.202ON414119950.009
SAKL0G15620g5.94ON879237950.011
ZYRO0B10428g5.202ON482108940.012
Suva_10.995.202ON385112930.014
TPHA0N006705.202ON452104930.015
CAGL0D03234g5.202ON410111930.015
NDAI0I021705.202ON39145920.017
Skud_12.575.202ON415106910.022
TDEL0A030502.530ON355183910.024
TDEL0E042705.202ON453106900.031
TBLA0H019905.202ON688110910.031
KAFR0J009905.202ON483113900.032
Kpol_2002.1005.202ON477119880.054
NDAI0C032305.94ON1034114890.056
CAGL0D05610g5.202ON44740860.095
Kpol_478.165.202ON35093860.096
Ecym_71045.202ON49240860.10
Kpol_348.82.530ON422106840.15
ZYRO0B01958g2.530ON336109830.18
TPHA0H010705.94ON101582850.18
Skud_8.492.530ON447109830.20
Kwal_33.151405.202ON410106820.26
Kpol_1050.635.94ON105892830.26
Ecym_44607.111ON73187830.27
AAL158W5.202ON47840820.27
ADL145C5.94ON875209830.28
Smik_8.532.530ON446109820.32
KLTH0B03388g5.202ON409108810.38
YHR004C (NEM1)2.530ON446109810.43
Skud_16.2188.527ON480109790.66
KAFR0K010707.153ON99466780.98
Ecym_72764.156ON593102781.1
Suva_16.2498.527ON480109771.2
YPL063W (TIM50)8.527ON476109771.2
Ecym_20665.94ON880118771.4
NCAS0C022108.527ON491109761.5
KLLA0E23101g8.527ON480100761.5
Smik_16.1728.527ON477109752.0
NDAI0E029108.527ON441108752.2
KNAG0E005705.94ON98182752.4
KLLA0E15621g5.94ON89191742.8
ZYRO0D13706g5.572ON187192723.0
Smik_4.4308.382ON48686743.0
TBLA0E012204.149ON63451733.5
NCAS0D015105.94ON90074743.5
TBLA0A005408.527ON485109734.0
TPHA0I020008.527ON47899724.2
TPHA0A051105.94ON106560734.4
TPHA0C048708.865ON139574725.2
SAKL0A09416g2.530ON385129715.4
CAGL0L06644g5.94ON828144725.5
Ecym_50527.46ON873120726.1
Kpol_2002.935.190ON2040129726.5
TPHA0H028307.46ON923168717.3
KLLA0F19140g8.262ON52737709.3
TDEL0D029504.156ON663164709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00240
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...  1510   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   985   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   912   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   905   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   904   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   896   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   884   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   878   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   860   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   801   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   801   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   800   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   793   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   793   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   787   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   773   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   769   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   764   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   763   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   711   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    52   3e-06
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    50   2e-05
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    46   3e-04
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    44   9e-04
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   0.001
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     44   0.001
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    44   0.001
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    44   0.001
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    44   0.001
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    42   0.004
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    42   0.006
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    41   0.007
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    41   0.008
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    41   0.008
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    41   0.008
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    42   0.008
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    41   0.009
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    41   0.011
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    41   0.012
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    40   0.014
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    40   0.015
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    40   0.015
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     40   0.017
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    40   0.022
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...    40   0.024
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    39   0.031
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    40   0.031
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    39   0.032
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    39   0.054
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    39   0.056
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    38   0.095
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    38   0.096
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    38   0.10 
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...    37   0.15 
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...    37   0.18 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    37   0.18 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    37   0.20 
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    36   0.26 
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    37   0.26 
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    37   0.27 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    36   0.27 
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    37   0.28 
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    36   0.32 
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    36   0.38 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    36   0.43 
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    35   0.66 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    35   0.98 
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    35   1.1  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    34   1.2  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    34   1.2  
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    34   1.4  
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     34   1.5  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    34   1.5  
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    33   2.0  
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    33   2.2  
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    33   2.4  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    33   2.8  
ZYRO0D13706g Chr4 complement(1148881..1149444) [564 bp, 187 aa] ...    32   3.0  
Smik_4.430 Chr4 complement(781942..783402) [1461 bp, 486 aa] {ON...    33   3.0  
TBLA0E01220 Chr5 complement(270455..272359) [1905 bp, 634 aa] {O...    33   3.5  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    33   3.5  
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    33   4.0  
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    32   4.2  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    33   4.4  
TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON} Anc_...    32   5.2  
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...    32   5.4  
CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some ...    32   5.5  
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    32   6.1  
Kpol_2002.93 s2002 complement(218908..225030) [6123 bp, 2040 aa]...    32   6.5  
TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.4...    32   7.3  
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...    32   9.3  
TDEL0D02950 Chr4 complement(556701..558692) [1992 bp, 663 aa] {O...    32   9.9  

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 1510 bits (3909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/732 (100%), Positives = 732/732 (100%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
           ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600

Query: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELEDVLDSEDDN 660
           KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELEDVLDSEDDN
Sbjct: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELEDVLDSEDDN 660

Query: 661 EDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQDDADAASAKSESESDLDL 720
           EDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQDDADAASAKSESESDLDL
Sbjct: 661 EDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQDDADAASAKSESESDLDL 720

Query: 721 ELLNALDDSDSE 732
           ELLNALDDSDSE
Sbjct: 721 ELLNALDDSDSE 732

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/755 (66%), Positives = 599/755 (79%), Gaps = 39/755 (5%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TPV  P G+PYPITISKLIA +GS++ KG RLFAYKFWY+VEIAKSPDE D   N   
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVN--- 57

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
            E SKK+IRESI+FFD+PFEG ++ WNVDVGDEIVEP + +CE+ RPC+HDIVYAGICTM
Sbjct: 58  DEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE DQVSANLTISHTDTNLKVSR+EAN+IGQ  K RLIR KKLILVVDLDQTVIH
Sbjct: 118 CGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIH 177

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI+EWKNDP+NPN+ETLR+VKSFVLEEE ILPPMYMGPKPP HKC YYVK+RPGL
Sbjct: 178 CGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGL 237

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFE+V+ +YEMHIYTMATR+YA+EIAKIIDPDG+LF +RILSR+ENGSLTHKSLERLF
Sbjct: 238 KEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLF 297

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVV+IDDRGDVWNW PNLIKVTPYNFFVGIGDINSNFLPRQQ TMLQ+GRRNH  
Sbjct: 298 PTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNH-- 355

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K ++++ELLTDI+DTEKKLQEKID+EVKRQE +L+H+SAALGEE  +QVR  DITKKIE
Sbjct: 356 KKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           FSASLEVQQQNRPLAELQKHMHNQQLL DDDDEL YLK+IL  VQ ++Y+ L+       
Sbjct: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELK----TDK 471

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           +  IQ LMPKLK+ V + CNFVFSGLIPLGT+IQKADIVLWT MFGA S+++ITE+TTHV
Sbjct: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
           ITKTP T KA+IAK+F   IKV+HPDWVFECL  WK++ E  +E  +   A+++EL EFK
Sbjct: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFK 591

Query: 601 KNLEKRNKNKLTDAVNFSGD-LNNGTATMSSTDNVVDLFAGGSSWLVDDELEDVLDSEDD 659
           + LE+R K +    +  S + L   + + SS    VDLFA G+SWL+DD+ ++++DSE++
Sbjct: 592 EALERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWLIDDDDDEIIDSEEE 651

Query: 660 NEDDSDEDEDEYDEFA----DVISKREEKKRSGEAL-EESNNKKQHLQDDADAASAKSES 714
              +      EYDEFA    D+ + ++    S E   E+ +NKK H+ ++ +  +   + 
Sbjct: 652 ESKEP-----EYDEFADDNNDLQTVKKHPLESNEFTDEDGSNKKVHIAEEDEGQNEGQDE 706

Query: 715 ESDLDLE-------------------LLNALDDSD 730
             D  L                    +LNALDDSD
Sbjct: 707 GQDDQLSEDKTSQPKDEESDSELEEEILNALDDSD 741

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/645 (67%), Positives = 519/645 (80%), Gaps = 12/645 (1%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           MATPV  P+ +PYPITI +LIAP+GS + KG RLFAYKFWY+VEIA SPDE D NG  Q 
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQ- 59

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
              SKKT+RESI+FF++PFEG ++ W VD GDE+    +++CE+ RPC+HD+VY G+CTM
Sbjct: 60  --HSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE DQ+ ANL ISHTDTNLKVSR+EA ++    K RL +SKKL+LVVDLDQTVIH
Sbjct: 118 CGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIH 177

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EWK DPSNPNYETL++V+ F LEEE I+PPMYMGP+ P  KC Y+VKVRPGL
Sbjct: 178 CGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGL 237

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           +EFF ++AP+YEMHIYTMATR YA EIAKIIDPDGSLFG+RILSRDENGSLT KSLERLF
Sbjct: 238 REFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLF 297

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMV++IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLPRQQ+ +LQ+GRR H  
Sbjct: 298 PTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTH-- 355

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K +ES+ELLTDI+DTEK+LQEKID+EVKRQE  L+H+     +E V       +TKK+E
Sbjct: 356 KKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQ-LTTNDEPVQGESKEQLTKKLE 414

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           +SASLEVQQQNRPLA LQKHMHNQ+LL DDDDEL YLK+ LA +  ++YK L+  N NS 
Sbjct: 415 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSA 474

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           D  IQ L+P +K  VFKDC FVFSGLIPLGT+I++ADIVLWT MFGA ++S I ENTTHV
Sbjct: 475 D--IQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
           ITKTPGT KARIAK FN ++KVVHPDWVFECL TW HVDEK +EL +   A+E E+++FK
Sbjct: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592

Query: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
           + +E+R+  +      F  +    TA     D+ ++LFAGG+SWL
Sbjct: 593 RKIEQRHLIEEQRREQFESEALMKTA----QDSTLNLFAGGTSWL 633

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/733 (63%), Positives = 574/733 (78%), Gaps = 14/733 (1%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TPV  P+G+PYPITI +LI P+G+YI KG RLFAYKFWY+VEIA SPD+ D       
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
               KK IRESI+FFDAPFEGT+I WN+DVGDE+    +++CE+KRPC+HDIVY G+CT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 121 CGKEVDE--RDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTV 178
           CGKEVDE  + Q  +N T+SHTDTNLK+SR+EA +IG+  K RL   KKL+LVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 179 IHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRP 238
           IHCGVDPTI EWK+DP+NPNY+TL++V+ F LEEE +LP MYMGPKP   KC YYVKVRP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 239 GLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLER 298
           GLKEFF+KVAP++EMHIYTMATRAYA EI KIIDP G LFGNRILSRDENGSLT KSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 299 LFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNH 358
           LFPTDQSMV+IIDDRGDVWNWSPNLIKV PY+FFVG+GDINSNFLP+QQ TMLQ+GRR+ 
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 359 NAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKK 418
             EK KE++ELLTDI+DTEKKLQEKID+EVKRQE +L+H+     EE+V+     + TKK
Sbjct: 361 --EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVP-TEESVSNETKEEWTKK 417

Query: 419 IEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGN 478
           +E SAS+EVQQQNRPLA LQ+H+HNQ+LL DDDDEL +LK+ LA V +E+Y  LE K+ +
Sbjct: 418 LEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLD 477

Query: 479 SDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTT 538
                I+ +MPKLK+SVF+ C+FVFSGLIPL TDI++ADIV+WT MFGA S+S I E TT
Sbjct: 478 ESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTT 537

Query: 539 HVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEE 598
           HVITKTPGT KAR+AKSFN  IK+VHPDWVFECL  W HVDEK + L V++  S+REL++
Sbjct: 538 HVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKK 597

Query: 599 FKKNLEKRNKNKLTDAVN--FSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELEDVLDS 656
           F+++L   N  KLT+  N   SGD+  GT  + + DN VDLFA G+SWL D++ +++  S
Sbjct: 598 FREDL---NNRKLTERNNEQNSGDI-TGT-IVENFDNTVDLFATGTSWLNDEDEDEIPSS 652

Query: 657 EDDNEDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQDD-ADAASAKSESE 715
           ++D+E  SDE+E + ++    + KR   + S  A E  ++KK HLQ+D  +    + +SE
Sbjct: 653 DEDDESSSDEEEIKENDSGTGLPKRRVSEDSA-AEELLSHKKIHLQNDKEEDDEEEEDSE 711

Query: 716 SDLDLELLNALDD 728
           S L+ EL+N LDD
Sbjct: 712 SGLEDELMNVLDD 724

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/645 (66%), Positives = 516/645 (80%), Gaps = 20/645 (3%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TPV  P+ +PYPITI +LIAP+GS++ KG RLFA+KFWY+VEIA SPDE        +
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDE-------NE 53

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G   KKT+RESI+FF+APFEG ++ WNVDVGDE+V P + +CE+ RPC+HDIVY G+CT+
Sbjct: 54  GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE +Q + NL ISHTD NLKVSR+EA +I    K+RL  SKKL+LVVDLDQTVIH
Sbjct: 114 CGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EWK D SNPNYE L++V+SF L+EE ILP +YMGPKPPV KC YYVKVRPGL
Sbjct: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFF+KVAP++EMHIYTMATRAYA EIAKIIDPDGSLFG+RILSRDENGS+T KSLERLF
Sbjct: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLPRQQ TMLQ+GR     
Sbjct: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGAR-- 351

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K +ES+EL+TDI+DTEKKLQEKID+EVKRQE  L H+ A+ GEE  A      + KK+E
Sbjct: 352 KKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMAS-GEEVPAPESKDQLAKKLE 410

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           +SASLEVQQQNRPLA LQKHMHNQ+LL DDDDEL+YL+EILA V  E+YK L   +    
Sbjct: 411 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKA 470

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           D  I+ L+P +K  VF+DC+FVFSGLIPLGT+I +ADIVLWT MFGA S+  I ++TTHV
Sbjct: 471 D--IKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHV 528

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
           IT+TPGT KARIAK+FN +IKVVHPDWVFECL +WKHVDEK +EL V+Q A++ EL ++K
Sbjct: 529 ITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYK 588

Query: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
           + L +R+       +          A  S+ +  ++LFAGG+SWL
Sbjct: 589 QKLARRSSALAEQEMEL--------AMESAKNGTINLFAGGTSWL 625

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/649 (67%), Positives = 521/649 (80%), Gaps = 7/649 (1%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TPV  P G+PYPIT+ +L+ P+GSY+ KG RLFAYKFWY+VEIA SPD+ D++    +
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
            E+SK+ +RESI+F++APFEG ++ WNVD  DEI  P   VCE+KRPC+HDIVY G+CTM
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CGKEVDE DQV ANLTISHTDTNL+VSR+EA ++ +   +RL   KKL+LVVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EWK DPSNPNYETL++VK F LEEE ILP +YMGPKPPV  C YYVK+RPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFEK+AP+YEMHIYTMATRAYA EIAKIIDPD SLFG+RILSRDENGSLT KSL RLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           PTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQ+GRR    
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTR-- 358

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
           +K KESEELLTDI+DTEKKLQEKID+EVKRQE  L H+ A   EE+  Q     I KK+E
Sbjct: 359 QKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT-AEESTDQESKEKIAKKLE 417

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
           FSASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YLK+ LA +  EFY  LE    + +
Sbjct: 418 FSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE-DASDQN 476

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           +  I  L+PKLK+ VFK+C+FVFSGLIPLGTDI++ADIV+WT +FGA STS+I E+TTHV
Sbjct: 477 EADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHV 536

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
           +TKTPGT KAR+AK+FNP IKVVHPDW+FECL++WK +DEK + L V+Q  SE EL EFK
Sbjct: 537 VTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFK 596

Query: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDE 649
           K LE++ K      +    +LN     M  T   + LF G +SWL DDE
Sbjct: 597 KKLEQKKKKLEELEIEEEEELNERANQMEPT---MPLFGGDTSWLNDDE 642

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/769 (60%), Positives = 577/769 (75%), Gaps = 57/769 (7%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPD--------EL 52
           M+TPV  P  +P+PITI +LI P+GS++ KG RLFAYKFWY+VEIA+SPD          
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 53  DVNGNVQDGEQS-------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVK 105
           D++GN  D  ++       KK+IRESI+FF++PFEG +IGWNVD GDEI+   +++C++K
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 106 RPCDHDIVYAGICTMCGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRS 165
           RPC+HDIVYAGICT CGKEVD+ D + A+L+ISHTDTNLK+SR+EA +I Q++ SRL + 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           KKLILVVDLDQTVIHCGVDPTI EWKNDP NPNYETL++V+SF L+EE ILPP YMGP+P
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSR 285
           PV KC YYVKVRPGLKEFF K+AP+YEMHIYTMATRAYA EIAKIIDPDGSLFG+RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 286 DENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPR 345
           DENGSLT KSLERLFPTDQSMV+IIDDRGDVWNW  NLIKV PYNFFVGIGDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 346 QQATMLQMGRRNH---------NAEKEK-----------ESEELLTDIIDTEKKLQEKID 385
           QQ+TMLQ+G R+H         N+E +K           ++EELLTDI+DTEKKLQ+KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 386 KEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQ 445
           +EV+RQE  L        +    +  N +++KKIEFSASLEVQQQNRPLA LQ+H  NQ+
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 446 LLRDDDDELSYLKEILATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSG 505
           LL DDDDEL YLK+IL  V   FY+ L+     S   SIQ LMP+LK SVF   NFVFSG
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNES--VSIQTLMPRLKFSVFSGYNFVFSG 538

Query: 506 LIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHP 565
           LIPLGTDI++ADIVLWT MFGA+ST++I ENTTHVITKT GT KAR+AK+FNP IKVVHP
Sbjct: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598

Query: 566 DWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRN----KNKLTDAVNFSGDL 621
           DW+FECL +WK + EK +EL ++Q ASE ELEEFKK LE +N    K ++     F    
Sbjct: 599 DWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEA-- 656

Query: 622 NNGTATMSSTDNVVDLFAGGSSWL-VDDELEDVLDSEDDNEDDSDEDEDEYD-EFADVIS 679
                 +++ D  +DLFA G+SWL  DD+   + DS+   E D++++E++Y+   +D   
Sbjct: 657 ------LNTRDPAIDLFASGTSWLNDDDDDIPISDSDSSIESDTEKNEEDYEPNLSD--G 708

Query: 680 KREEKKRSGEALEESNNKKQHLQDDADAASAKSESESDLDL--ELLNAL 726
           KR  K+ S + +   NNKK  + D++++   K+E + D DL  ELLNAL
Sbjct: 709 KRSFKEESTDQMR--NNKKLKILDESESEVKKNEEQEDTDLEEELLNAL 755

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/654 (64%), Positives = 521/654 (79%), Gaps = 20/654 (3%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+T +  P G+PYPITI +LI  VG  + KGDRL AYKFW++V++A SPD+ DV+     
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G   KK+IRESI+FF++P++G +I WNVD+GDEI  P +++ E+ RPC+HD+VY G+CT+
Sbjct: 61  G---KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117

Query: 121 CGKEVDERDQ----VSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQ 176
           CG+EVDE D       ANLTISHTDTNLK+S +EA +IG   ++RL + KKL+LVVDLDQ
Sbjct: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177

Query: 177 TVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKV 236
           TVIHCGVDPTI EWKNDP NPN+ETL++VK F LEEE ILP +YMGPKPP+ KC YYVKV
Sbjct: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSL 296
           RPGLKEF EK+AP++EMHIYTMATRAYA EIAKIIDP+G LFG+RILSRDENGS+T KSL
Sbjct: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297

Query: 297 ERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRR 356
           ERLFPTDQSMV++IDDRGDVWNWSPNLIKV PYNFFVG+GDINSNFLP+QQATMLQ+GRR
Sbjct: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357

Query: 357 NHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG-DI 415
           +   EK K++E+LL DI+D+EKKL+EKID+EVKRQE +L+H+SA   E   +   N  +I
Sbjct: 358 SR--EKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEI 415

Query: 416 TKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELK 475
           +KKIE+SASLEVQQQNRPLA LQKH H+Q+LL DDDDEL +LK+ L  +  ++Y  L+ K
Sbjct: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLK-K 474

Query: 476 NGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITE 535
           +G      I+ +MP +K++V  +C FVFSGLIPLGTDIQ+ADIV+WT  FGA STS+I E
Sbjct: 475 DGEL-KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDE 533

Query: 536 NTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERE 595
            TTHVITKTPGT KAR+AKSFNP IK++HPDWVFECL++WKHVDEK +EL V+Q  SE E
Sbjct: 534 KTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETE 593

Query: 596 LEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDE 649
           LEEFKK L KR   +L    N +    NGT +       ++LF+GG SWL DDE
Sbjct: 594 LEEFKKKLAKR---QLLATANENLSPANGTNSAE-----LELFSGGMSWLDDDE 639

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/695 (60%), Positives = 524/695 (75%), Gaps = 54/695 (7%)

Query: 1   MATP--VKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELD----- 53
           MATP  ++ P G+PYPITI +L+ P+G+ +NK DRL AYKFWY+VEIA SPDEL+     
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 54  --------------VNGNVQDGEQSK--------------------KTIRESIDFFDAPF 79
                         +NGN      ++                    KT+RESI+FFD P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 80  EGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTMCGKEVDERD---QVSANLT 136
           +G +  W V+ GD+IV P + +CE++RPC+HD++Y G+CT+CGKEVDE D       NLT
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 137 ISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSN 196
           ISHTDTNLK+S +EA +IGQ+ K RL   KKLILVVDLDQTVIHCGVDPTI EWK DP+N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 197 PNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIY 256
           PN+ETL++VK F LEEE ILP MYMGPKPP  KC YYVKVRPGLK+FF+KVAP++EMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 257 TMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDV 316
           TMATRAYA EIAKIIDP G LFGNRILSRDENGSLT KSLERLFPTDQSMV+IIDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 317 WNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNAEKE---KESEELLTDI 373
           WNWSPNLIKV PYNFFVG+GDINSNFLP+QQATMLQ+GRR+   E +   KE+++LLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 374 IDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG-DITKKIEFSASLEVQQQNR 432
           +DTEK LQ KI++EVKRQE  L H+ A + E       N  +I+KKIE+SASLEVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 433 PLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD--DTSIQELMPK 490
           PLA LQKH H+Q+LL DDD+EL +LK+ L+ + S++Y+ L+  N N D  +  I+ +MP+
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 491 LKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKA 550
           +K++V +DC+FVFSGLIPLGT+IQK+DIV+WT MFGA ST++I ENTTHVITKTPGT KA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 551 RIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRNKNK 610
           R+AKS++P IK+VHPDWVFECL  WKHV+EK +EL V+Q+ S++EL +F + LE+R +  
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 611 LTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
                     L +G   +    N V+LFAGG+SWL
Sbjct: 661 ELKDEGLYNKLPDGNIDI----NEVNLFAGGTSWL 691

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/751 (55%), Positives = 540/751 (71%), Gaps = 40/751 (5%)

Query: 3   TPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAK--SPDELDVNGNVQD 60
           TPV    G+PYP+T+ +LI  VG  +++GDRLFAYKFWY+VE+A   +  E D +G    
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGT--- 63

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G  +KK++RES++FF++PFEGT++ W+VD GDEI  PG  +C ++RPC+HD+VY G+CT+
Sbjct: 64  GTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTL 123

Query: 121 CGKEVDERD---------QVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILV 171
           CG+EVDE +          V  NLT+SH DTNL++SR EA  +    + RL  ++KL+LV
Sbjct: 124 CGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLV 183

Query: 172 VDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPV-HKC 230
           VDLDQTV+HCGVDPTI EWK DP NPNYE LR+V+SF LEEE ILP +Y+G K P   KC
Sbjct: 184 VDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKC 243

Query: 231 SYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGS 290
            YYVKVRPGLK+FF+++AP++EMHIYTMATRAYA EIAKIIDPD SLFG+RILSRDENGS
Sbjct: 244 WYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGS 303

Query: 291 LTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATM 350
           LTHKSLERLFPTDQSMV +IDDRGDVWNW  NLIKV PYNFFVG+GDINSNFLP+QQ TM
Sbjct: 304 LTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTM 363

Query: 351 LQMGRRNHNAEKEKESEE---------LLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401
           LQMGRR+   E+  ES++         LLTDI++TEK+LQEKID+EVKRQE  L   +AA
Sbjct: 364 LQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAA 423

Query: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461
             E+        + TKK+EFSAS+EVQQ+NRPLA LQKH+HNQ+LL D+DDEL YLK+ L
Sbjct: 424 GDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRL 483

Query: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521
           A +   +Y  L+    N  DT+IQ +M +LK  VF+DC+FVFSGLIPL T++Q ADIV+W
Sbjct: 484 ADLHKRYYSTLK---ENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIW 540

Query: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
           T  FGA++T+++ E TTH+ITKTPGT KAR+AK+FNP IK+VHPDW+FECL  W+ VD K
Sbjct: 541 TNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVK 600

Query: 582 SFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641
            + L V+   SE ++ EFK+ L  R K +     + +  L          +  +DLFAGG
Sbjct: 601 PYLLIVEDPVSEAQVREFKEKL-TRQKERAERQTSRTALL----PANKPAEPDIDLFAGG 655

Query: 642 SSWLVDDELEDVLDSEDDNEDDSDEDEDEYDEFAD----VISKREEKKRSGEALEESNNK 697
            SWL D++ E++   ++++EDD DE+++      D          +K+   E  ++   K
Sbjct: 656 ISWLNDEDDEEIPKEDEESEDDEDENDENNTTMLDDGEPETGGTPDKRSLFENPDQPAEK 715

Query: 698 KQHLQDDADAASAKSESESDLDLELLNALDD 728
           K  +QD    A   SES+S+L+ ELLN LDD
Sbjct: 716 KPRIQD----AEPSSESDSELEDELLNVLDD 742

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/672 (58%), Positives = 492/672 (73%), Gaps = 33/672 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T ++ P G+PYPI I KLI  VGSY+++GDRL  YKFWYLVE A    + D   +V  
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 61  GEQS--------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDI 112
           G  +         K +RESI+FF++P+EG +I WNVDVGDE+    +++CE+KRPC+HDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 113 VYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLIL 170
           VY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KKLIL
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 171 VVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP------K 224
           VVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM         
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILS 284
           PPV KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+RILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297

Query: 285 RDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLP 344
           RDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 345 RQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGE 404
           +Q   MLQ+GR+    +K +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A   E
Sbjct: 358 KQSTGMLQLGRKTR--QKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT-AE 414

Query: 405 EAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATV 464
           E  A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L+ +
Sbjct: 415 EPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNI 474

Query: 465 QSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKM 524
              +Y  L  +  N  + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+WT  
Sbjct: 475 HKTYYDMLSQQ--NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 525 FGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFE 584
           FGA+ST +I   TTH+ITK P T KAR+AK FNP IK+VHPDW+FECL  WK VDEK + 
Sbjct: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 585 LKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSW 644
           L VD   S+ EL+ F+  L+KR +        +  +       ++S +N ++LFA G+SW
Sbjct: 593 LIVDSPISDEELQNFQTQLQKRQE--------YLEETQEQQHMLTSQEN-LNLFAAGTSW 643

Query: 645 LVDDELEDVLDS 656
           L +D+ ED+ D+
Sbjct: 644 LNNDDDEDIPDT 655

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/675 (58%), Positives = 494/675 (73%), Gaps = 38/675 (5%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T ++ P+G+PYPI I KL+  VGSY+++GDRL  YKFWYLVE  ++ D    + N  D
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVE--RASDTTGDDDNEHD 58

Query: 61  G-----------EQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCD 109
                           K +RESI+FF++P+EG +I WNVDVGDEI    +++CE+KRPC+
Sbjct: 59  ATPGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCN 118

Query: 110 HDIVYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKK 167
           HDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KK
Sbjct: 119 HDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKK 175

Query: 168 LILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG----- 222
           LILVVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      
Sbjct: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235

Query: 223 -PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281
              PPV KC YYVKVRPGLKEFF+KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+R
Sbjct: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295

Query: 282 ILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSN 341
           ILSRDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSN
Sbjct: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355

Query: 342 FLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401
           FLP+Q   MLQ+GR+    +K +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A 
Sbjct: 356 FLPKQSTGMLQLGRKTR--QKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 413

Query: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461
             EE  A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L
Sbjct: 414 -AEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 472

Query: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521
           + + + +Y+   +   N  + ++ E++P LK+ VF++C+FVFSGLIPLGTDIQ++DIV+W
Sbjct: 473 SNIHNTYYQM--ISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIW 530

Query: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
           T  FGA+STS+I   TTH+ITK P T KAR+AK FNP IK++HPDW+FECL  WK VDEK
Sbjct: 531 TSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEK 590

Query: 582 SFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641
            + L VD   S+ EL+ F+K L+KR +           + N     M +    ++LFA G
Sbjct: 591 PYTLIVDSPISDEELQNFQKQLQKRQE---------YLEENQQQQHMLTPQENLNLFAAG 641

Query: 642 SSWLVDDELEDVLDS 656
           +SWL +D+ ED+ D+
Sbjct: 642 TSWLNNDDDEDIPDT 656

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/711 (56%), Positives = 503/711 (70%), Gaps = 52/711 (7%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T +K PD +PYPITI++L A  G  I KG RLFAYK+W   ++  SP++         
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST------ 54

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
             + KK   + I  FD+P EG ++ +N+ +GDE V    +V E+K+ C HD+ Y G+C +
Sbjct: 55  --KPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112

Query: 121 CGKEVDERDQVSAN------LTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDL 174
           CGK V+E    SA+      LT+SHT+TN+K+S ++A  I +T + +L + KKL+LVVDL
Sbjct: 113 CGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDL 172

Query: 175 DQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYV 234
           DQTVIHCGVDPTI EW  DP NPNYE L+++KSF L EE ILPP YMGPKPP  KC YYV
Sbjct: 173 DQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYV 232

Query: 235 KVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHK 294
           K+RPGLKEFFEK+AP +E+HIYTMATRAYA EIAKIIDPDG LFG+RILSRDENGS+THK
Sbjct: 233 KLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHK 292

Query: 295 SLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMG 354
           SLERLFP DQSMVVIIDDRGDVWNW  NLIKV PY+FFVG+GDINSNFLPRQQ +ML +G
Sbjct: 293 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLG 352

Query: 355 RRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG- 413
           RR+    K+ E EELLTDI+DTEKKLQEKID+EVKRQE  L+     + EE   +  N  
Sbjct: 353 RRHR---KKAEEEELLTDILDTEKKLQEKIDEEVKRQEEKLS----KMTEEKQPEDTNSK 405

Query: 414 -DITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472
            D+ KK+E SASLEVQQQNRPLAELQKH+HNQ+LL DDDDEL +L  IL  V  ++Y+ L
Sbjct: 406 EDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL 465

Query: 473 ELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSN 532
              + +S   +I+ LMP+LK+ VF  C+FVFSGLIPLGTD++KADI LWT MFGA +T++
Sbjct: 466 ---SKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTAD 522

Query: 533 ITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592
           I E TTH+ITKTPGT KAR+AK+FNP IKVVHPDW+FECL  WK VDEK++EL ++Q  S
Sbjct: 523 IDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582

Query: 593 ERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELED 652
           E EL++FKK LE   K+           +      +SS +  ++L AG  SWL       
Sbjct: 583 EEELDDFKKKLENEKKD---------AQIQEEVDRVSSDE--INLLAGNDSWL------- 624

Query: 653 VLDSEDDNEDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQD 703
                 DN+D  DE ++  ++  +   K    KR+    EES NK+ HL D
Sbjct: 625 ------DNDD--DEMDEFLNDDDEDDEKEVSNKRTLPDGEESENKRVHLDD 667

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/664 (59%), Positives = 484/664 (72%), Gaps = 39/664 (5%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M T ++ P+G+PYPI I KLI  VGSY+++GDRL  YKFWYLVE A    E  V+ N  D
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERAS---ETGVDDNEHD 57

Query: 61  GEQS-----------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCD 109
                           K +RESI+FF++P+EG +I WNVDVGDE+    +++CE+KRPC+
Sbjct: 58  ASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCN 117

Query: 110 HDIVYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKK 167
           HDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KK
Sbjct: 118 HDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKK 174

Query: 168 LILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP---- 223
           LILVVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      
Sbjct: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 234

Query: 224 --KPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281
              PPV KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+R
Sbjct: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDR 294

Query: 282 ILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSN 341
           ILSRDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSN
Sbjct: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354

Query: 342 FLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401
           FLP+Q   MLQ+GR+    +K +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A 
Sbjct: 355 FLPKQSTGMLQLGRKTR--QKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461
             EE  A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L
Sbjct: 413 -AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 471

Query: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521
           + +   +Y+ L  +  N  + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+W
Sbjct: 472 SNIHMTYYQMLSQE--NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIW 529

Query: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
           T  FGA+STS+I   TTH+ITK P T KAR+AK FNP IK+VHPDW+FECL  WK VDEK
Sbjct: 530 TSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEK 589

Query: 582 SFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641
            + L VD   S+ EL+ F+  L+KR +           + N     M ++   ++LFA G
Sbjct: 590 PYTLIVDSPISDEELQNFQSQLQKRQEYL---------EENQEQQHMLTSQENLNLFATG 640

Query: 642 SSWL 645
           +SWL
Sbjct: 641 TSWL 644

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/660 (59%), Positives = 478/660 (72%), Gaps = 32/660 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVE-------IAKSPDELD 53
           M T ++ P+G+PYPI I KLI  VGS++ +GDRL  YKFWYLVE            D   
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 54  VNGNVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIV 113
             G         K +RESI+FF++P+EG +I WNVDVGDEI    +++CE+KRPC+HDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 114 YAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILV 171
           Y G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KKLILV
Sbjct: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177

Query: 172 VDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG-----PKPP 226
           VDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      PKPP
Sbjct: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237

Query: 227 -VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSR 285
            V KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+RILSR
Sbjct: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297

Query: 286 DENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPR 345
           DENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+
Sbjct: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357

Query: 346 QQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEE 405
           Q   MLQ+GR+    +K +ES+EL+TDI+D EKKLQEKID EVKRQE  L H+ A   EE
Sbjct: 358 QSTGMLQLGRKTR--QKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLAT-AEE 414

Query: 406 AVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQ 465
             A     ++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L  + 
Sbjct: 415 PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIH 474

Query: 466 SEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMF 525
             +Y+   L      + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+WT  F
Sbjct: 475 KTYYQM--LSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532

Query: 526 GASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFEL 585
           GA+STS+I   TTH+ITK PGT KAR+AK FNP IKVVHPDW+FECL  WK VDEK + L
Sbjct: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592

Query: 586 KVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645
            VD   S+ EL+ F+K L+K+ +           D ++    M      ++LFA G+SWL
Sbjct: 593 IVDSPISDDELQSFQKQLQKKQEYL---------DEHHEQQHMLMPQENINLFAAGTSWL 643

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/728 (53%), Positives = 510/728 (70%), Gaps = 51/728 (7%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TP++ PD +PYPITI++L    G  + KG RL AYK+W LV++  +P E         
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGE--------- 51

Query: 61  GEQSKKTIRESIDF---FDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGI 117
            E++ K  ++ +D    FD+P  GT++  +V VGDE V   R V E+++ C HD+ Y G+
Sbjct: 52  -EEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGL 110

Query: 118 CTMCGKEVDERDQVS-----ANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172
           C  CG+ V++    +     A LT+SHT+T+++VS ++A ++GQ+ + +L  ++KL+LVV
Sbjct: 111 CVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVV 170

Query: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232
           DLDQTVIHCGVDPTI EW  DP+NPNYE L++V+SF L+EE +LPP YMGPKPP  KC Y
Sbjct: 171 DLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWY 230

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292
           YVK+RPGLKEFF K+AP +E+HIYTMATRAYA EIAKIIDPDG LFG+RILSRDENGSLT
Sbjct: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLT 290

Query: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352
            KSLERLFP DQSMVV+IDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLP QQ +ML 
Sbjct: 291 QKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLH 350

Query: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRN 412
           +GRRN   +K K+ EELLTDI+DTEKKL+EKI++EVKRQE D  H+   L +E +   R 
Sbjct: 351 LGRRNR--KKPKQEEELLTDILDTEKKLKEKINEEVKRQE-DQMHR---LTDEKLPDTR- 403

Query: 413 GDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472
            DI KK+E +ASLEVQQQNRPLAELQKHM N++LL DDDDEL +L  IL  V S +Y  L
Sbjct: 404 -DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQL 462

Query: 473 ELKNGNSDDTS-IQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTS 531
           +  N   D    I+ LMPKLK +VF+ C FVFSGLIPL T+I++ADIVLWT MFGAS+T+
Sbjct: 463 QRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTA 522

Query: 532 NITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVA 591
           N+  NTTH+IT+TPGT+KAR+AKSFNP+IK+VHPDW+FECL  W+ V+E  +EL V++  
Sbjct: 523 NLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPV 582

Query: 592 SERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL--VDDE 649
            E  LE FK++L +  K     A +    L               L  G  SWL   DDE
Sbjct: 583 GEEYLENFKRDLAEAQKKVDPPAQDSRSSLL--------------LLDGNGSWLDYDDDE 628

Query: 650 LEDVLDSEDDNEDDSDE--------DEDEYDEFADVISKREEKKRSGEALEESNNKKQHL 701
           +++ L+ E DNE+D+++          + +    +  +  + + +     +ESN K+ + 
Sbjct: 629 MDEFLNEESDNEEDTEQMAPASKAPRPNGFPSGGERPAAVQSQDKPELPEKESNGKRPYQ 688

Query: 702 QDDADAAS 709
            DDA +AS
Sbjct: 689 PDDAVSAS 696

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/664 (57%), Positives = 473/664 (71%), Gaps = 38/664 (5%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TP++ P  +P+PITI+KL    G  + KG RLF YK+W L ++  +P+E         
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------- 51

Query: 61  GEQSKKTIR-ESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICT 119
            E SKK  R + I  FD+P EGT++   V VGDE V    I+ E+++PC H++ Y  +C 
Sbjct: 52  -EASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCV 110

Query: 120 MCGKEVDERDQ-------VSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172
           +CGK VDE D         +  LT++H +TN+KVS ++A +I +T +  L   KKL+LVV
Sbjct: 111 VCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVV 170

Query: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232
           DLDQTVIHCGVDPTI EW NDPSNPNY+ L+NVK+F L+E+ ILPP YMGP+PP  +C Y
Sbjct: 171 DLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQY 230

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292
           YVK+RPGL+EFF+KVAP +E+HIYTMATRAYA EIAKIIDP  +LFG+RILSRDENGSLT
Sbjct: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLT 290

Query: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352
           HKSLERLFP DQSMVVIIDDRGDVW+W  NLIKV PYNFFVG+GDINSNFLPRQQ +ML 
Sbjct: 291 HKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH 350

Query: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRN 412
           MGRR+    K+ E EELLTDI+DTEKKLQEKID+EVK+QE      S     +    +  
Sbjct: 351 MGRRHR---KKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEE--NQPDRSMSK 405

Query: 413 GDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472
            D+TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L EIL  V   +Y+ L
Sbjct: 406 EDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL 465

Query: 473 ELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSN 532
                  D   I+ LMP++K  VF  C+FVFSGLIPLGT+I+ ADIVLWT MFGA ++S+
Sbjct: 466 AKTEVFPD---IKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSD 522

Query: 533 ITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592
           I ENTTHVITKTPGT KAR+AKS+NP IK+VHPDW+FECL  W   DEK +EL ++Q  S
Sbjct: 523 IDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVS 582

Query: 593 ERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL--VDDEL 650
             ELEEF++NL+KR             +     +    T   ++L AG   WL   DDE+
Sbjct: 583 SDELEEFQRNLKKRQ----------MAEKAARESLQQETGEELNLLAGNDMWLDNDDDEM 632

Query: 651 EDVL 654
           ++ L
Sbjct: 633 DEFL 636

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/620 (59%), Positives = 464/620 (74%), Gaps = 30/620 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M TP++ P  +P+P+TI+KL    G  + KG RLF YK+W L +I  +P+E         
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE--------- 51

Query: 61  GEQSKKTIR-ESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICT 119
            E  KK  R + I  FD+P EGT++  N+ +GDE V    ++ EV + C H++ Y G+C 
Sbjct: 52  -EAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCV 110

Query: 120 MCGKEVDERDQ-VSAN------LTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172
           +CGK V+E DQ VS N      LT++H +TN+KVS ++A  I +T +  L   KKL+LVV
Sbjct: 111 VCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVV 170

Query: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232
           DLDQTVIHCGVDPTI EW NDPSNPNY+ L+NVK+F L+E+ ILPP YMGP+PP  KC Y
Sbjct: 171 DLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQY 230

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292
           YVK+RPGL+EFF+K+AP +E+HIYTMATRAYA EIAKIIDP G LFG+RILSRDENGSLT
Sbjct: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLT 290

Query: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352
           HKSLERLFP DQSMVVIIDDRGDVW+W  NLIKV PYNFFVG+GDINSNFLPRQQ +ML 
Sbjct: 291 HKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH 350

Query: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQ--V 410
           +GRRN    K+ E EELLTDI+DTEKKLQEKID+EVK+QE     K   + EE   +  +
Sbjct: 351 LGRRNR---KKAEEEELLTDIMDTEKKLQEKIDQEVKKQE----EKFNKINEENQPERPI 403

Query: 411 RNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYK 470
              D+TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L  IL  V   +Y 
Sbjct: 404 SKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYD 463

Query: 471 ALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASST 530
            L  + G   D  I+ LMP++K  VFK C+FVFSGLIPLGT++++ADIVLWT MFGA+++
Sbjct: 464 KLA-EQGQPPD--IKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTS 520

Query: 531 SNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQV 590
            ++ E TTHVITKTPGT KAR+AK++NP+IKV+HPDW+FECL  W  V+EK +EL  +Q 
Sbjct: 521 VDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQD 580

Query: 591 ASERELEEFKKNLEKRNKNK 610
            S  ELEEFKK L+K+ +++
Sbjct: 581 VSPEELEEFKKRLDKKKQSE 600

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/684 (55%), Positives = 484/684 (70%), Gaps = 30/684 (4%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           M+TP++ PD +PYPIT+++L    G  + +G RLFAYK+W   +I  SP      G+   
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSP------GDESA 54

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
           G +SK+   + +  FD+P  G ++  N+ +GDE V     V E+K+PC HD+ Y G+C  
Sbjct: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114

Query: 121 CGKEVDERDQVS-------ANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVD 173
           CG+ V E +Q S       A LT+SHT+ N+++S ++A  + ++ + +L  ++KL+LVVD
Sbjct: 115 CGQTV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVD 173

Query: 174 LDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYY 233
           LDQTVIHCGVDPTI EW  DP NPNYE+L++V+SF L EE +LPP YMGPKPP  KC YY
Sbjct: 174 LDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYY 233

Query: 234 VKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTH 293
           VK+RPGL++FF  +AP +E+HIYTMATR YA EIAKIIDPDG+LFG+RILSRDENGSLT 
Sbjct: 234 VKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQ 293

Query: 294 KSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQM 353
           KSLERLFP DQSMVVIIDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ +ML +
Sbjct: 294 KSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHL 353

Query: 354 GRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVA--QVR 411
           GRRN   +K K+ EELLTDI+DTEKKL+ KI +EVKRQE ++      L EE +      
Sbjct: 354 GRRNR--KKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM----QKLSEEKIPDHTTS 407

Query: 412 NGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKA 471
             DI KK+E +ASLEVQQQNRPLAELQKH+HN++LL DDDDEL +L +IL  V S +Y  
Sbjct: 408 KEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQ 467

Query: 472 LELKNGNSDDTS--IQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASS 529
           LE     + + S  I+ L+P LK  VFK CNFVFSGLIPL T+I +ADIVLWT  FGA +
Sbjct: 468 LEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKT 527

Query: 530 TSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQ 589
           T NI  NTTH+ITKTPGT+KAR+A SFN  IK+VHPDW+FEC+  WK VDEK +EL V++
Sbjct: 528 TINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEE 587

Query: 590 VASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDE 649
             S+  LE FKK LE+  K+K       S D N  +    + ++ + L  G  SWL +D+
Sbjct: 588 PVSKEYLENFKKELEETEKSK------NSVDANISSQKYETFNDAMILLGGSDSWLDNDD 641

Query: 650 LEDVLDSEDDNEDDSDEDEDEYDE 673
             D   ++ D+ED  +E E+  D+
Sbjct: 642 EMDEFLNDSDSEDHRNEGENGGDK 665

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/651 (54%), Positives = 454/651 (69%), Gaps = 21/651 (3%)

Query: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60
           + T VK    +PYPIT+++L    G ++ KG RLFAY++W   ++            V+ 
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVL-----------VKY 51

Query: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120
            E++KK   + +  FD+P  GT+  W+  V DE       V  +++ C+HDI Y G+C  
Sbjct: 52  EEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111

Query: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180
           CG  VDE D  S NLTISH +TN+KVS Q+A  + +++ +RL   KKL+LVVDLDQTVIH
Sbjct: 112 CGNTVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170

Query: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240
           CGVDPTI EW  DP NPNY+ L++VKSF LE+E I+P  Y GPKPP  K  YYVK+RPGL
Sbjct: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230

Query: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300
           KEFFE V+P +EMHIYTMATR+YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLF
Sbjct: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290

Query: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360
           P DQSMVV+IDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ ++L +GR +   
Sbjct: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHH--- 347

Query: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420
            +++E E+L++DIID EKKL+EKID+EVKRQE  ++H       +        DI+KK+E
Sbjct: 348 RRKQEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLE 407

Query: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480
            SASLEVQQQNRPLAELQKH+HNQ LL DDDDEL +L +IL  V  E++        N  
Sbjct: 408 HSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPP 467

Query: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540
           D  I+ L+P++K  VF+ C+FVFSGLIPL TD++KADIVLWT MFGA+++S+I   TTH+
Sbjct: 468 D--IKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHI 525

Query: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
           IT T  T KAR+AKSFNP IK+VHPDW+FECL  W+ V E  +EL +     E +++EFK
Sbjct: 526 ITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFK 585

Query: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELE 651
           + L+K+  N  + +VN   D N     +    +   L AG  SWL +D+ E
Sbjct: 586 EKLDKKISNP-SSSVNPFEDGNEDEEVLG---DEFHLLAGNDSWLDNDDDE 632

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 81/177 (45%), Gaps = 45/177 (25%)

Query: 124 EVDERDQVSANLTISHTDTN----------LKVSRQEANNIGQTNKSRLIRSKKL----- 168
           +V++ D V  N+++++ + N          + +S+ +AN +  T    L+  K++     
Sbjct: 263 QVNQNDPVMNNMSLNYAEINENNKMIDGNLIDLSKLQANQVSATGYETLLAPKEIKRFGR 322

Query: 169 --ILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
              L++DLD+T++H       S +K                +V   + ++P         
Sbjct: 323 KKCLILDLDETLVH-------SSFK----------------YVDSADFVIPVTIDNQTHH 359

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL 283
           V     YV  RPG+ EF ++V+ +YE+ ++T +   Y + +  I+DP  ++  +R+ 
Sbjct: 360 V-----YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

Query: 493 RSVFKDCNFVFSGLIPLGTDIQKADIVLWTKM---FGASSTSNITENTTHVITKTPG--T 547
           R + KDC    S  +       + + +L++++    G S +  I+  TTH+I+  P    
Sbjct: 120 RHILKDCTIYVSRTV-----FNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPA 174

Query: 548 LKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFEL 585
           L A +A   +  IK V+P W+ +C    K+VDEK+F L
Sbjct: 175 LIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFIL 212

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 32/126 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                 +++ LR    FV+       P+ +  +  
Sbjct: 229 KKCLVLDLDETLVHS----------------SFKYLRTA-DFVI-------PVEIDDQ-- 262

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS----LFGNRI 282
           VH    YV  RPG+ EF E+V  +YE+ ++T +   Y + +  I+DP G+    LF +  
Sbjct: 263 VHNV--YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSC 320

Query: 283 LSRDEN 288
            + D N
Sbjct: 321 YNYDGN 326

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K            +   FVL       P+ +  + 
Sbjct: 221 QKKCLILDLDETLVH-------SSFK----------YMHTADFVL-------PVEIDDQ- 255

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V  +YE+ ++T +   YA  +   +DP+G++
Sbjct: 256 -VHNV--YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 32/122 (26%)

Query: 166 KKLI----LVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYM 221
           KKLI    LV+DLD+T++H                  ++ L+    FVL       P+ +
Sbjct: 297 KKLIGKKCLVLDLDETLVHSS----------------FKYLQTA-DFVL-------PVNI 332

Query: 222 GPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281
             +  +H    YV  RPG++EF ++V  ++E+ ++T +   Y + +  I+DP   L  +R
Sbjct: 333 DEQ--IHNV--YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHR 388

Query: 282 IL 283
           + 
Sbjct: 389 LF 390

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL 283
           YV  RPG+ EF EKV  ++E+ I+T +   Y + +   +DP G    +R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K            +   FVL  E            
Sbjct: 226 QKKCLILDLDETLVH-------SSFK----------YMHSADFVLPVEI---------DD 259

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V+ +YE+ ++T +   YA  +   +DP+G++
Sbjct: 260 QVHNV--YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K                FVL  E            
Sbjct: 221 QKKCLILDLDETLVH-------SSFK----------YMQTADFVLPVEI---------DD 254

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V+ +YE+ ++T +   YA  +   +DP+G++
Sbjct: 255 QVHNV--YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 143 NLKVSRQEANNIGQTNKSRLIRSKKLI------------LVVDLDQTVIHCGVDPTISEW 190
           N  V    +N IG  N  R +  KKLI            L++DLD+T+IH     ++S  
Sbjct: 156 NKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIH-----SMSRN 210

Query: 191 KNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPI 250
            +  +  NY  L  VK F     A  P    GP  P+    YYV  RP    F   V+  
Sbjct: 211 ISSSTISNYH-LIEVK-FPTPTSA--PTSAPGPSLPLSSL-YYVYKRPYCDHFLNLVSDW 265

Query: 251 YEMHIYTMATRAYAEEI 267
           Y++ I+T + + YA+ +
Sbjct: 266 YDLIIFTASMKEYADPV 282

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 28/108 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H                 +++ LR+   FVL  E             
Sbjct: 257 KKCLILDLDETLVHS----------------SFKYLRSA-DFVLSVEI---------DDQ 290

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPD 274
           VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D D
Sbjct: 291 VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 28/108 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H                 +++ LR+   FVL  E             
Sbjct: 244 KKCLILDLDETLVHS----------------SFKYLRSA-DFVLPVEI---------DDQ 277

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPD 274
           VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D D
Sbjct: 278 VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD 323

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 29/112 (25%)

Query: 163 IRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG 222
           I+ KK  L++DLD+T++H                 +++ LR+   FVL  E         
Sbjct: 242 IKDKKC-LILDLDETLVHS----------------SFKYLRSA-DFVLPVEI-------- 275

Query: 223 PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPD 274
               VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D D
Sbjct: 276 -DDQVHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 324

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 27/117 (23%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H       S +K                F+   + ILP      +  
Sbjct: 312 KKCLILDLDETLVH-------SSFK----------------FINNPDFILPIEIEDGQ-- 346

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL 283
           +H    YV  RPG+  F  +V   YE+ I+T +   YA  +  ++D D +L  +R+ 
Sbjct: 347 IHNV--YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 28/113 (24%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S +  LV+DLD+T++H       S +K                ++   + +LP   +   
Sbjct: 309 SHRKCLVLDLDETLVH-------SSFK----------------YLKSADFVLP---VDID 342

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +H    YV  RPG+ EF  +V  +YE+ ++T +   Y + +  I+D D S+
Sbjct: 343 DQIHNV--YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 28/113 (24%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S K  LV+DLD+T++H                  ++ +R    FVL  E          +
Sbjct: 226 SNKKCLVLDLDETLVHSS----------------FKYVR-TADFVLPVEI---------E 259

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +H    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  I+D   S+
Sbjct: 260 DQIHNV--YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 509 LGTDIQKADIVLWTKM---FGASSTSNITENTTHVITKTPGTLKARIAK-SFNPSIKVVH 564
           L    + ++ +L+T++    G +   NI   TTH+IT  P      I K +   SIK ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 565 PDWVFECLSTWKHVDEKSFEL 585
           P W+  C+   + +DE   E+
Sbjct: 193 PTWLIHCVKESQLIDESEHEI 213

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 29/119 (24%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           K+ + + KK  LV+DLD+T++H                 +++ LR    FV+       P
Sbjct: 237 KADMFKGKK-CLVLDLDETLVHS----------------SFKYLRTAD-FVI-------P 271

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
           + +  +  VH    YV  RPG+ EF  ++  +YE+ ++T +   Y + +  I+D D ++
Sbjct: 272 VEIDNQ--VHNV--YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 98/237 (41%), Gaps = 31/237 (13%)

Query: 487 LMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPG 546
           L+  L+  +F     + S    LG   Q+  I    +  G +ST+ +++  THV++  P 
Sbjct: 332 LLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKKNTHVLSCMPY 389

Query: 547 TLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELK-------VDQVASERELEEF 599
             K + A  ++ + KVV+  W+ EC    K +D  +   +       +  V  +  LE++
Sbjct: 390 GQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRYREIPVRGGLKNVLGQLSLEDY 449

Query: 600 KKNL-------EKRNKNKLTDAV-NFSGDLNNGTATMSSTDNVV---DLFAGGSSWLVDD 648
           ++N        EK   + +TD   NF    +N  + M   +  +   ++ +G SS  V  
Sbjct: 450 EENTGKQELHEEKEQLSTITDTQENFDTVTSNAVSDMEKKEVAISEKEVQSGISS--VGH 507

Query: 649 ELEDVLDSEDDNEDDSDEDEDEYDEFADVISKREEKKRSGEALEESNNKKQHLQDDA 705
             E + D+E    +D     DE           EEK+R  ++  ES       Q  A
Sbjct: 508 LFEGLSDNEQSRSEDQPVKRDEL---------LEEKRRRQQSTIESTTPAASRQSSA 555

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 28/108 (25%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S K  LV+DLD+T++H                 +++ L+    FVL       P+ +  +
Sbjct: 310 SGKKCLVLDLDETLVHS----------------SFKYLKGAD-FVL-------PVDIDDQ 345

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
             +H    YV  RPG+ EF +KV  ++E+ I+T +   Y + +  I+D
Sbjct: 346 --IHNV--YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 28/112 (25%)

Query: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225
           +K  L++DLD+T++H       S +K            +   FVL       P+ +  + 
Sbjct: 214 QKKCLILDLDETLVH-------SSFK----------YLHTADFVL-------PVEIDDQ- 248

Query: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
            VH    YV  RPG+ EF  +V+ +YE+ ++T +   YA  +   +DP+ ++
Sbjct: 249 -VHNV--YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 28/104 (26%)

Query: 170 LVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHK 229
           LV+DLD+T++H       S +K            N+  FVL       P+ +  +     
Sbjct: 285 LVLDLDETLVH-------SSFK----------YLNIADFVL-------PVDIDNQVQ--- 317

Query: 230 CSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP 273
            + YV  RPG+ EF + V  +YE+ ++T +   Y   +  I+DP
Sbjct: 318 -NVYVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 28/111 (25%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                  ++ LR    FVL       P+ +  +  
Sbjct: 240 KKCLVLDLDETLVHSS----------------FKYLR-TADFVL-------PVNIDDQ-- 273

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
           VH    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  I+D   S+
Sbjct: 274 VHNV--YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
           YV  RPG+ EF  +VA +YE+ ++T +   Y + +  I+D   S+
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  L++DLD+T++H                 +++ LR+   FVL  E             
Sbjct: 245 KKCLILDLDETLVHS----------------SFKYLRSA-DFVLPVEI---------DDQ 278

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           VH    YV  RPG++EF E+V  ++E+ ++T +   Y + +  I+D
Sbjct: 279 VHNV--YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 71/183 (38%), Gaps = 40/183 (21%)

Query: 127 ERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLI------------LVVDL 174
           +RD V  +L  +    +   SR     +G     R +  KKLI            LVVDL
Sbjct: 116 QRDAVKGSLAPAKYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDL 175

Query: 175 DQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYV 234
           D+T+IH     T        SN     +  ++ F +   + L               YYV
Sbjct: 176 DETLIHSASRTT------SHSNSAQGHMVEIR-FAISGVSTL---------------YYV 213

Query: 235 KVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS------LFGNRILSRDEN 288
             RP    F  KV+  Y++ ++T + R YA+ +   ++   S      L+ N  + RD  
Sbjct: 214 HKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGV 273

Query: 289 GSL 291
           G +
Sbjct: 274 GYI 276

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                 +++ LR    FVL       P+ +  +  
Sbjct: 283 KKCLVLDLDETLVHS----------------SFKYLRTA-DFVL-------PVDIDDQ-- 316

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           +H    YV  RPG+ EF ++V  +YE+ ++T +   Y + +  I+D
Sbjct: 317 IHNV--YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 51/110 (46%), Gaps = 28/110 (25%)

Query: 163 IRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG 222
           I S K  L++DLD+T++H       S +K                ++   + ++P   + 
Sbjct: 514 IFSGKKCLILDLDETLVH-------SSFK----------------YLTSADFVIP---VD 547

Query: 223 PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
               +H    YV  RPG+ +F E V+ I+E+ ++T +   Y + +  ++D
Sbjct: 548 IDEQIHNV--YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 53/113 (46%), Gaps = 28/113 (24%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S+K  LV+DLD+T++H       S +K                ++   + +LP   +   
Sbjct: 311 SRKKCLVLDLDETLVH-------SSFK----------------YLKSADFVLP---VDID 344

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +H    YV  RPG+ EF ++V  I+E+ ++T +   Y + +  ++D   S+
Sbjct: 345 DQIHNV--YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI 395

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 29/119 (24%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           K  + ++KK  LV+DLD+T++H       S +K                ++   + +LP 
Sbjct: 300 KDPVFKNKKC-LVLDLDETLVH-------SSFK----------------YIDTADFVLP- 334

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSL 277
             +      H+   YV  RPG+ EF ++V  I+E+ ++T +   Y + +  I+D   S+
Sbjct: 335 --VTIDDQTHQV--YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 53/114 (46%), Gaps = 13/114 (11%)

Query: 487 LMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPG 546
           L    K+ +FK    + +     G   Q++ I   T+M G  ST+ +++  TH++++ P 
Sbjct: 348 LFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHLVSRMPV 405

Query: 547 TLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600
             K   AK +    +V++  W+           E++++  + Q  +  E ++FK
Sbjct: 406 GKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDFK 448

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 525 FGASSTSNITENTTHVITKT---PGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581
            G + T  I   TTH+I      P  +  +     N  IK V+P W+ +C    K++DE 
Sbjct: 160 LGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYIDES 219

Query: 582 SFELKVDQVASER 594
              +  DQ  SE 
Sbjct: 220 PHLITEDQNNSEH 232

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           YV  RPG+ EF ++V  +YE+ ++T +   Y + +  ++D
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRIL---SRDENG 289
           YV  RPG+  F +  + ++E+ I+T +   Y   +  I+D    L  +R+      + NG
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLFRDACYNYNG 276

Query: 290 SLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPN 322
           +   K+L +L     S ++I+D+    + + PN
Sbjct: 277 NYI-KNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           YV  RPG+ EF  +V  +YE+ ++T +   Y + +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 164 RSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP 223
           R KKL+L  DLD+T+IH     +IS      S PN     N ++ ++E            
Sbjct: 191 RKKKLVL--DLDETLIH-----SISR-----STPNSN---NAQAHLVEV----------- 224

Query: 224 KPPVHKCS--YYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
           K P+   S  YYV  RP    F  KV   Y++ I+T + + YA+ +
Sbjct: 225 KFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPV 270

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           +S L   +K  LVVDLD+T+IH              S+ N      V       E   PP
Sbjct: 145 QSILFAERKKRLVVDLDETLIHSATRSV--------SHSNSAQGHMV-------EVRFPP 189

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
             +          YYV  RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 190 SSIS-------TLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPV 231

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 515 KADIVLWTKM---FGASSTSNITENTTHVITKTPG--TLKARIAKSFNPSIKVVHPDWVF 569
           K +++ ++++    G ++  +I+  TTH+IT  P    + A IA     +I  V+P W+ 
Sbjct: 134 KTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLC 193

Query: 570 ECLSTWKHVDEKSFELKVDQVA 591
           +C  +   V+E    + +   A
Sbjct: 194 QCFKSMTLVNESDHLINIQSSA 215

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK  +    + +P 
Sbjct: 243 KSILNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVKFGI----SGIPT 292

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
           +Y      +HK       RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 293 LYF-----IHK-------RPYCDFFLTKVSRWYDLIIFTASMKEYADPV 329

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 167 KLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPP 226
           K  LV+DLD+T++H                 +++ LR    FV+       P+ +  +  
Sbjct: 240 KKCLVLDLDETLVHS----------------SFKFLRTA-DFVI-------PVEIDNQ-- 273

Query: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           +H    YV  RPG+ EF + V  +YE+ ++T +   Y + +  ++D
Sbjct: 274 IHNV--YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLD 317

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 492 KRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKAR 551
           K+SVF     + +     G   Q+  I   T   G  +T+ ++     ++   P  +K +
Sbjct: 340 KKSVFNKDELILTYTNLFGP--QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYK 397

Query: 552 IAKSFNPSIKVVHPDWVFECLSTWKHVDEKSF 583
            A+ +   + +V P+W+ EC    K +D K F
Sbjct: 398 TAEKWGDKLIIVGPNWLEECYKANKKLDPKLF 429

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 10/87 (11%)

Query: 275 GSLFGNRILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP---NLIKVTPYNF 331
           G L   R LS+ +   L H  LER      S+V + D R +++N+ P   N+IK+  +NF
Sbjct: 90  GGLTSLRGLSKSKPNRLAH-GLERCLFEPMSIVPLKDRRSNIYNFKPFLENIIKLKDFNF 148

Query: 332 FVGIGDINSNFLPRQ-QATMLQMGRRN 357
                D  + F+P    + +L++ R++
Sbjct: 149 -----DAITGFVPPSLDSRLLELARKH 170

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
           YV  RPG+ EF ++V  ++E+ ++T +   Y + +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 83/209 (39%), Gaps = 8/209 (3%)

Query: 524 MFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSF 583
           + G SST+ ++   TH+I+  P   K   A  +N  I V H  W+ +C    K +D  + 
Sbjct: 364 LLGGSSTTELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYKLRKKLDPNAP 422

Query: 584 ELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSS 643
           E     V  E      +  LE   +N ++     S D+      M ++   V L    + 
Sbjct: 423 EFTRIPVPDELSNAIGQMALETTARNMVSPRKAVSPDI-----VMHNSQTDVALVVSTTD 477

Query: 644 WLVDDELEDVLDSEDDNEDDSDEDEDEYDEFADVISKREEKKRSGEALEE--SNNKKQHL 701
             + D  E   D+   +E     + D+        +++E+      AL+E  S  KK  L
Sbjct: 478 IDLKDNNESTNDTSVVHEPGKVMNSDDLTAVHSTKTRQEDANEMFSALDEAVSKGKKSCL 537

Query: 702 QDDADAASAKSESESDLDLELLNALDDSD 730
                AAS  + + +++     +  D SD
Sbjct: 538 PKKHIAASVAASTSNEISASAKSNKDSSD 566

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK F +     L  
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGISGIRTL-- 293

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
                        Y++  RP    F  KV+  YE+ I+T + + YA+ +
Sbjct: 294 -------------YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPV 329

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 28/108 (25%)

Query: 165 SKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPK 224
           S K  LV+DLD+T++H                 +++ LR    FV+       P+ +  +
Sbjct: 237 SGKKCLVLDLDETLVHS----------------SFKFLRTAD-FVI-------PVEIDNQ 272

Query: 225 PPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIID 272
             VH    YV  RPG+ +F   V  +YE+ ++T +   Y + +  ++D
Sbjct: 273 --VHNV--YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLD 316

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK F L     L  
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGLSGIRTL-- 293

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267
                        Y++  RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 294 -------------YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPV 329

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG + F   ++  YE+ +++     Y+E+ A+ +DP       +LF    
Sbjct: 212 QKYGWRTAKRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHC 271

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 272 VYKD---GVHIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7.153
           YIR002C
          Length = 994

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 354 GRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKR----QEADLTHKSAALGEEAVAQ 409
           GR+  +  K KE EE+L  I    KK QEK+++E +R    ++A +   S    +E + Q
Sbjct: 505 GRKKGDKLKRKEEEEIL-QIAKKRKKEQEKLEREGRRTGSSEDAQINGMSQKQQKEVIQQ 563

Query: 410 VRNGDI 415
            +NGD 
Sbjct: 564 FKNGDF 569

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 490 KLKRSVFKDCNFVFSGLIPL--GTDIQKADIVLWTKMFGASS-TSNITENTTHVITKTPG 546
           K++     D + +   L PL    D+ K  + +  K  GA      ++ +TTH +     
Sbjct: 161 KVRTHKMTDMSGITVCLGPLVKSGDVTKEHMEVSLKAIGAKPLQKRVSLDTTHFVCNDAQ 220

Query: 547 TLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVD 588
           +    +A++ N +I VV P+W+  C    + V  + F L VD
Sbjct: 221 SDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVD 262

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG   F   ++  +E+ +++     Y+E+IA+ +DP       +LF    
Sbjct: 214 QKYGWRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHC 273

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 274 VYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG   F   ++  YE+ +++     Y+++IA+ +DP       +LF    
Sbjct: 209 QKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHC 268

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 269 VYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 43/118 (36%), Gaps = 14/118 (11%)

Query: 492 KRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMF---GASSTSNITENTTHVITKTPGTL 548
           K    KDC    S           A+  L+T M    G      ++   TH+IT  P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 549 KARIAKSFNP-SIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEK 605
              + K FN   +  V   W+ EC    ++V E ++      V SE   EE     EK
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY-----LVGSEMSNEEVTALAEK 222

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG+  F   ++  YE+ +++     Y E+IA+ +DP       +LF    
Sbjct: 220 QKYGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEHC 279

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D + V+IID   + +   P N I V P++
Sbjct: 280 VYKD---GVHIKDLSKL-NRDVNKVLIIDTEPNNYKLQPENAIPVKPWD 324

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRILSRDENGSL 291
           RPG+  F   ++  YE+ +++     YAE+IA+ +DP       +LF    L +D    +
Sbjct: 221 RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYKD---GV 277

Query: 292 THKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
             K L +L   D   V+IID   + +   P N I + P++
Sbjct: 278 HIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG   F   ++  +E+ +++     Y+++IA+ +DP       +LF    
Sbjct: 209 QKYGWRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHC 268

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           + +D    +  K L +L   D S V+IID   + +   P N I + P+N
Sbjct: 269 VYKD---GVHIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG+  F   ++  YE+ +++     Y E+IA+ +DP       SLF    
Sbjct: 228 QKYGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYSLFKEHC 287

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPY 329
           + +D    +  K L +L   D + V+IID   + +   P N I + P+
Sbjct: 288 VYKD---GVHIKDLSKL-NRDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 491 LKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKA 550
           LK+SV +    + S     G  +Q++ I   T+  G  ST+++T+  TH++++     K 
Sbjct: 344 LKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVSTTSLTKRNTHLVSRMAIGKKF 401

Query: 551 RIAKSFNPS-IKVVHPDWVFEC 571
            +AK +     +VV+  W+ EC
Sbjct: 402 ELAKQWGGQRCRVVNHLWLEEC 423

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 524 MFGASSTSNITENTTHVITKTPGTLKARIAKSFNP-SIKVVHPDWVFECLSTWKHVDEKS 582
           +FG +    ++   TH+IT     +  +  + F+  ++  + P+W+ +CL   +++ E  
Sbjct: 148 VFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKEDE 207

Query: 583 FELKVDQVASERELEEFKKNLEKRNKNKLTD 613
           + + V++   +  L+E  + L  R  N + D
Sbjct: 208 YLINVNE--DDLALKEKSQKLWDRTLNSIDD 236

>ZYRO0D13706g Chr4 complement(1148881..1149444) [564 bp, 187 aa]
           {ON} highly similar to uniprot|P15454 Saccharomyces
           cerevisiae YDR454C GUK1 Guanylate kinase converts GMP to
           GDP required for growth and mannose outer chain
           elongation of cell wall N-linked glycoproteins
          Length = 187

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 78/192 (40%), Gaps = 33/192 (17%)

Query: 1   MATPVKF--PDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVE-IAKSPDELDVNG- 56
           M+ P+ F  P G      + KL A            F  KF + V    +SP   +VNG 
Sbjct: 1   MSRPIVFSGPSGTGKSTLLKKLFAE-----------FPDKFGFSVSSTTRSPRPGEVNGR 49

Query: 57  --NVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVY 114
             N    EQ +K I+E      A F G   G  VD   +++E G++       C  DI  
Sbjct: 50  EYNFVQVEQFQKMIQEGKFIEWAQFSGNYYGTAVDSVKKVIESGKV-------CLLDIDM 102

Query: 115 AGICTMCGKEVDER---------DQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRS 165
            G+  +   +++ R         + + + L    T+T   +S++ A   G+ + +     
Sbjct: 103 QGVKAVKSSDLNARFLFIAPPSVEDLESRLRGRGTETEESISKRLAAAKGEMDFASTGVH 162

Query: 166 KKLILVVDLDQT 177
            K+I+  DL++ 
Sbjct: 163 DKIIVNDDLNRA 174

>Smik_4.430 Chr4 complement(781942..783402) [1461 bp, 486 aa] {ON}
           YDR181C (REAL)
          Length = 486

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 309 IIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQA--TMLQ----MGRRNHNAEK 362
           +I DR D+ NW+  L KVT  N F    ++ +     +Q   +ML     M ++ HN  +
Sbjct: 167 LISDRLDMLNWATTLQKVTKINDFTDENEMETKRYQTKQLIDSMLHKFESMKKKGHNLAR 226

Query: 363 EKESEELLTDIIDTE--KKLQEKIDK 386
              S + L  ++ ++   KL  +ID+
Sbjct: 227 RPASSDSLLKMVSSKDWPKLYSRIDR 252

>TBLA0E01220 Chr5 complement(270455..272359) [1905 bp, 634 aa] {ON}
           Anc_4.149 YGR013W
          Length = 634

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 682 EEKKRSGEALEESNNKKQHLQDDADAASAKSESESDLDLELLNALDDSDSE 732
           E++KRS E LEES  ++QH+    D      E+E++  +   N   DSDSE
Sbjct: 306 EKEKRSKEVLEESRRRRQHVTSVLDQIKKTRETETNEFVTSHNDYSDSDSE 356

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 514 QKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFN-PSIKVVHPDWVFECL 572
           Q++ I    ++ G  ST+  ++  TH+I+++    K + A  +   S+ VV+  W+ EC 
Sbjct: 364 QRSYIQRLVELLGGVSTTEFSKRNTHLISRSNVGKKFKTAMKWGESSVIVVNHLWLEECY 423

Query: 573 STWKHVDEKSFELK 586
              K +D K+ E +
Sbjct: 424 KLNKKLDPKTNEFR 437

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 10/109 (9%)

Query: 228 HKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDP-----DGSLFGNRI 282
            K  +    RPG+  F   ++  YE+ +++     Y++ IA+ +DP       +LF    
Sbjct: 213 QKHGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFVSYNLFKEHC 272

Query: 283 LSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
           L +D    +  K L +L   D+  V+IID   + +   P N I + P++
Sbjct: 273 LYKD---GVHIKDLSKL-NRDEKKVLIIDVDPNSYKLQPENAIPMKPWD 317

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRD---ENGSLTH 293
           RPG   F   ++  YE+ +++     Y+E+IA+ +DP  +     +       + G  TH
Sbjct: 218 RPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLYKEHCVYKEG--TH 275

Query: 294 -KSLERLFPTDQSMVVIIDDRGDVWNWSP-NLIKVTPYN 330
            K L +L   D   V+IID   + + + P N I V P+N
Sbjct: 276 IKDLSKL-NRDLDKVLIIDCDPNNYKFQPENAIPVKPWN 313

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 525 FGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFE 584
            G  ST  +++  TH+I   P   K   A+S    I VV+  W+ +C+     V E  FE
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON}
           Anc_8.865 YML091C
          Length = 1395

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 11/74 (14%)

Query: 505 GLIPLGTDIQKADIVLWTKMF--GASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKV 562
            LI LG  + K DI   T++F    +  S++T N   +          ++ K+F  S+ +
Sbjct: 514 SLIILGNILIKGDINYATQIFETKLNEISSLTSNKNEIF---------QLVKNFILSVSI 564

Query: 563 VHPDWVFECLSTWK 576
           V+P+  +E LST+K
Sbjct: 565 VNPNHGYELLSTFK 578

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218
           +S L   KK ILV+DLD+T+IH     T              +  + +  ++E +  +  
Sbjct: 192 QSVLNNEKKKILVLDLDETLIHSMSRGT-------------SSSNSSQGHMVEVKFAVSG 238

Query: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS-L 277
           +            Y+V  RP    F  KVA  Y + ++T + + YA+ +   ++   S  
Sbjct: 239 I---------SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGS 289

Query: 278 FGNRILSRD 286
           F  R+  +D
Sbjct: 290 FSQRLYRQD 298

>CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154w
          Length = 828

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/144 (18%), Positives = 59/144 (40%), Gaps = 25/144 (17%)

Query: 453 ELSYLKEILATVQSEFYKALELKNGNSDDTSIQELMPKLK------RSVFKDCNFVFSGL 506
           +L++L  +        YK +E K           ++P++       R + + C    S  
Sbjct: 83  QLAFLYMVPVVTPEWLYKCIEEK----------RVIPQVHKYSPDARHILRYCQLYISPF 132

Query: 507 IPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKAR-------IAKSFNPS 559
               ++ Q  + +  T+  G  + + I++ TTH++ KT      +       + +  NP+
Sbjct: 133 TIDSSERQFLEDI--TQTLGGITQNFISDKTTHIVIKTFDDPLVKEMDDNVILKEVLNPT 190

Query: 560 IKVVHPDWVFECLSTWKHVDEKSF 583
           +K+V   W+ +C  T    +E  +
Sbjct: 191 MKIVSYQWLLDCFKTVSWANEIKY 214

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 9/120 (7%)

Query: 485 QELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKT 544
           +EL  K +R VF+ C    +G      +  + +IVL    F    T     + TH++ + 
Sbjct: 81  EELGEKFRR-VFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKK--SDVTHIVAQN 137

Query: 545 PGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLE 604
               K    ++F    KVV P W+  C+   K +  + + + V   + ++   E  +N+E
Sbjct: 138 LSAAKCIEFRNF----KVVQPGWIGACVRIGKMLSWREYSVIVR--SGDQPFLELPRNIE 191

>Kpol_2002.93 s2002 complement(218908..225030) [6123 bp, 2040 aa] {ON}
            complement(218908..225030) [6123 nt, 2041 aa]
          Length = 2040

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 50/129 (38%), Gaps = 28/129 (21%)

Query: 6    KFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQDGEQSK 65
            +F   MP+   I KL++     I   +  + Y+  +L+  A   DE       Q   +SK
Sbjct: 1065 QFSKTMPFTRFIYKLLSAA---IEMSEGSYLYELLHLIH-AIFKDE-------QILMESK 1113

Query: 66   KTIRES----------IDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYA 115
            K I +S          +  FD+ FE           D IV     + E    CDHD VY 
Sbjct: 1114 KIIPDSYLEVPICELLVKIFDSQFENKF-------SDSIVTKANFLFEEMVSCDHDRVYE 1166

Query: 116  GICTMCGKE 124
             +    GK+
Sbjct: 1167 TLTNTLGKD 1175

>TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.46
           YOR346W
          Length = 923

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 72/168 (42%), Gaps = 21/168 (12%)

Query: 415 ITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALEL 474
           I  KI+   +L   ++N+ +A++++ +H+     DD    S + +     + ++++  E 
Sbjct: 53  IDDKIKNVTNLNFSEKNK-IAKVEEQVHS-----DDRSSNSNIVKTAHYGRGQYFRDKEF 106

Query: 475 KNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNIT 534
           K    D   +QE   K+K  +FK+C    +G       +    IV+    F    TS   
Sbjct: 107 KQLQQDQKLVQENQDKIK--IFKNCVIYINGYTDPDRLVLHKLIVIHGGKFLHHMTSK-- 162

Query: 535 ENTTHVI-TKTPGTLKARIAKSFNPSIKVVHPDWVF-----ECLSTWK 576
              TH++ T  P   +   AK      KV+ P+W+      E L  W+
Sbjct: 163 GRVTHIVATNLPLKKRVEFAK-----YKVITPEWILDSVKAEVLQPWQ 205

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 639 AGGSSWLVDDELEDVLDSEDDNEDDSDEDEDEYDEFA 675
           AGG  +L D+   ++L S DDN ++S+ D + +DE A
Sbjct: 422 AGGMIYLEDENSPNLLLSGDDNSEESEHDSEIFDELA 458

>TDEL0D02950 Chr4 complement(556701..558692) [1992 bp, 663 aa] {ON}
           Anc_4.156 YLR330W
          Length = 663

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 62/164 (37%), Gaps = 21/164 (12%)

Query: 490 KLKRSVFKDCNFVFSGLIPLGT--DIQKADIVLWTKMFGASS-TSNITENTTHVITKT-- 544
           K+      D + +   L PL    +I  A I       GA      +  +TTH +T    
Sbjct: 162 KMHTHKMTDMSGITVCLGPLDPLLNISGAQIAQSLSQMGARPLQRRVAIDTTHFVTNDAE 221

Query: 545 ----PGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQ-----VASERE 595
               P  +KA+     N +I +V P+WV       + +  + F L  DQ           
Sbjct: 222 NDDDPELMKAK-----NSNIPIVRPEWVRASEMERRIIGVRGFYLDADQGILKSYQFPPA 276

Query: 596 LEEFKKNLEKRNKNKLTDAVNFSGDLN--NGTATMSSTDNVVDL 637
            +EFK    K    + TD+VN    L   +G+      D+V D+
Sbjct: 277 TDEFKAKFAKLKSGETTDSVNLEKKLPTIDGSQPAPKEDDVEDV 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,309,795
Number of extensions: 4385919
Number of successful extensions: 69224
Number of sequences better than 10.0: 2509
Number of HSP's gapped: 55473
Number of HSP's successfully gapped: 3882
Length of query: 732
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 615
Effective length of database: 40,065,477
Effective search space: 24640268355
Effective search space used: 24640268355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)