Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002308.838ON61461426990.0
Kpol_1068.108.838ON6173557424e-89
ZYRO0G14146g8.838ON5073665887e-68
TDEL0B005908.838ON5413765583e-63
SAKL0D01518g8.838ON5743774744e-51
Kwal_27.102728.838ON5513804506e-48
NDAI0E003008.838ON6644124531e-47
NCAS0B003108.838ON5643294445e-47
TBLA0D032508.838ON6834174391e-45
ABL128W8.838ON4743764123e-43
Ecym_46098.838ON5203774055e-42
KAFR0A028208.838ON4533343991e-41
KLTH0C03916g8.838ON5703793935e-40
Smik_13.208.838ON5103803747e-38
Skud_13.278.838ON5143763722e-37
Suva_13.298.838ON5093723685e-37
YML114C (TAF8)8.838ON5103753678e-37
KLLA0D01617g8.838ON5623973263e-31
CAGL0B02299g8.838ON6432072252e-18
KNAG0G034108.838ON5262831867e-14
NCAS0A006601.94ON222386810.36
NDAI0A068903.123ON36188780.72
CAGL0E03828g4.15ON1896127761.7
Suva_14.801.94ON222390751.9
KAFR0A013003.195ON92258733.0
Kpol_2000.541.94ON221186725.3
NDAI0F041401.94ON225688699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00230
         (614 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...  1044   0.0  
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   290   4e-89
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   231   7e-68
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   219   3e-63
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   187   4e-51
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   177   6e-48
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   179   1e-47
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   175   5e-47
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   173   1e-45
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   163   3e-43
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   160   5e-42
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   158   1e-41
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   155   5e-40
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   148   7e-38
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   147   2e-37
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   146   5e-37
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   145   8e-37
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   130   3e-31
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    91   2e-18
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    76   7e-14
NCAS0A00660 Chr1 (122223..128894) [6672 bp, 2223 aa] {ON} Anc_1....    36   0.36 
NDAI0A06890 Chr1 complement(1576979..1578064) [1086 bp, 361 aa] ...    35   0.72 
CAGL0E03828g Chr5 complement(357552..363242) [5691 bp, 1896 aa] ...    34   1.7  
Suva_14.80 Chr14 (142826..149497) [6672 bp, 2223 aa] {ON} YNL262...    33   1.9  
KAFR0A01300 Chr1 (247849..250617) [2769 bp, 922 aa] {ON} Anc_3.1...    33   3.0  
Kpol_2000.54 s2000 complement(102269..108904) [6636 bp, 2211 aa]...    32   5.3  
NDAI0F04140 Chr6 complement(994996..1001766) [6771 bp, 2256 aa] ...    31   9.8  

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/614 (85%), Positives = 527/614 (85%)

Query: 1   MTAMVTNETIRTSDLLQGSDGDKAVEKFEHQDIGMDKEVTEQKKYVQLTKLPTLTEFKYE 60
           MTAMVTNETIRTSDLLQGSDGDKAVEKFEHQDIGMDKEVTEQKKYVQLTKLPTLTEFKYE
Sbjct: 1   MTAMVTNETIRTSDLLQGSDGDKAVEKFEHQDIGMDKEVTEQKKYVQLTKLPTLTEFKYE 60

Query: 61  DTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRK 120
           DTKGPMEV            MNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRK
Sbjct: 61  DTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRK 120

Query: 121 EVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVXXXXXXXX 180
           EVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEV        
Sbjct: 121 EVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVLTVFKKTD 180

Query: 181 XXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAA 240
                         VPITNTLENIIPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAA
Sbjct: 181 KTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAA 240

Query: 241 EGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDALYSGGSCDRKKRTAFFE 300
           EGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDALYSGGSCDRKKRTAFFE
Sbjct: 241 EGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDALYSGGSCDRKKRTAFFE 300

Query: 301 DEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQ 360
           DEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQ
Sbjct: 301 DEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQ 360

Query: 361 TDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRRHDXXXXXXXX 420
           TDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRRHD        
Sbjct: 361 TDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRRHDEWLKRREE 420

Query: 421 XXXXXXXXXXXXAQAFGAIDLSSFTNIXXXXXXXXXXSSENEQELEIRAKSSQNNSKDIS 480
                       AQAFGAIDLSSFTNI          SSENEQELEIRAKSSQNNSKDIS
Sbjct: 421 KLKKLEQEKNLRAQAFGAIDLSSFTNIDDGGFLDGFDSSENEQELEIRAKSSQNNSKDIS 480

Query: 481 STGPGSWDKEEANPVAIGTSVNTKSLEIKTSGQTNQNMEPVLSNEIESVTSEGLEVEKLE 540
           STGPGSWDKEEANPVAIGTSVNTKSLEIKTSGQTNQNMEPVLSNEIESVTSEGLEVEKLE
Sbjct: 481 STGPGSWDKEEANPVAIGTSVNTKSLEIKTSGQTNQNMEPVLSNEIESVTSEGLEVEKLE 540

Query: 541 VQEDQMQGETDVVHTTGEEVIQEIKQSETPINFPTMAXXXXXXXXXXXXXXXXXXXXXXX 600
           VQEDQMQGETDVVHTTGEEVIQEIKQSETPINFPTMA                       
Sbjct: 541 VQEDQMQGETDVVHTTGEEVIQEIKQSETPINFPTMATTTITTTETNISTTETTTITETT 600

Query: 601 PNINSGLEESNDTN 614
           PNINSGLEESNDTN
Sbjct: 601 PNINSGLEESNDTN 614

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  290 bits (742), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 211/355 (59%), Gaps = 14/355 (3%)

Query: 41  EQKKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVD 100
           E  KY+QLT+LPTLTE+KYE+T+  +E             MN DT+ITKFAF HL SLV 
Sbjct: 4   EATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVV 63

Query: 101 EQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVT 160
            Q+ DMV ++ +L++LQRR  VAK DI +WLRGFNL P DL   +Q+S+Y+ + Y  +  
Sbjct: 64  GQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYE 123

Query: 161 LLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYTYKF 220
            L ++AT T                         VPI+N L+ +IP WLP FPPDYTYKF
Sbjct: 124 SLTKIATTTTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKF 183

Query: 221 TPQFNKHITDATVIRKKVAAEGKKSEKALLHLLE-SEKITTSKLLNLDKFDSDDMDTAKL 279
           TPQ+N  ITD T+IR+KV  EGK+SEKALL+LL   ++   S+ L   KF S +M+ A  
Sbjct: 184 TPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDL---KFSSSEMELATE 240

Query: 280 EMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYE 339
           E  A YS  +   K  T+FFE E             N  ++E+Y   R+ I R KV  YE
Sbjct: 241 ETLATYSAITLRNKHLTSFFEKE----------PIQNSLNVEEYARTRVEIERKKVLGYE 290

Query: 340 DKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQ 394
           ++QL++Q +PFLK++ L+S   D KVS+ V NT I   LKRS L  I+SIP   Q
Sbjct: 291 ERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  231 bits (588), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 206/366 (56%), Gaps = 12/366 (3%)

Query: 45  YVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQLS 104
           Y+Q+TKLPTL E ++ED +  +              MN    IT+FAF  L  LVD QL+
Sbjct: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLN 61

Query: 105 DMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNR 164
           DM++Q+ +++ LQRR+ +AK DI + + GFN+ PS + +  + SE+  +KY  E   L+ 
Sbjct: 62  DMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS 121

Query: 165 LATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYTYKFTPQF 224
           L  D                          VP TN L++ +P WLP FPPD+TYKFTPQ+
Sbjct: 122 L-RDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQY 180

Query: 225 NKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDAL 284
           +  ITD T IR+++  E K+SE AL HL   +K  T  ++N  ++DS+    A+ E  A+
Sbjct: 181 SHPITDETTIRRQIVEEAKQSELALSHL-SQKKNPTDDIVNRSQYDSE---LAEQETLAI 236

Query: 285 YSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLR 344
           Y  GS  +K++T   +  +    D         F +E+Y H RI + R KV ++E++QL+
Sbjct: 237 Y--GSQLKKRKT---QHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQ 291

Query: 345 LQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAM 404
            Q DPFLK++ +   Q + K +++ ++   +  L+RSF+ L+ SIP L +NK +T E+A 
Sbjct: 292 SQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAK 351

Query: 405 VEKKRR 410
            E+ +R
Sbjct: 352 EERSKR 357

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  219 bits (558), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 194/376 (51%), Gaps = 36/376 (9%)

Query: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDE 101
            ++++QLT LPTL E  +  T+  +              M  D  I+KFAF HL  L+D+
Sbjct: 6   HERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDD 63

Query: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTL 161
           QL+DM+ Q+ + + +QRR+ +AK D+ L+L+G+NL P+DL   HQ S+Y  + YG E   
Sbjct: 64  QLNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDS 123

Query: 162 LNRLA-TDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYTYKF 220
           L+ L  T T+ V                      V   N L   IP W+P+FPPD+TYKF
Sbjct: 124 LHSLKETFTDAVVDEDNGSEDVINEL--------VRPNNPLIRYIPKWMPAFPPDHTYKF 175

Query: 221 TPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKL- 279
           TPQ+N+ ITD T+IR+++  EGK+SE ALLHLL++    T          S D D A   
Sbjct: 176 TPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTP---------SSDADGASYD 226

Query: 280 ------EMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRN 333
                 E  A+Y      RKK  +          D         F IE+Y   R+ I R 
Sbjct: 227 EALVREETAAIYGNEQKKRKKNAS-------SSSDLLSKLPQTNFSIEEYARSRVEIARK 279

Query: 334 KVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLN 393
           KV +YE++Q++LQ +PF+K + +    +  K  R      I ++L+RS   LI SIP L 
Sbjct: 280 KVVEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQ 339

Query: 394 QNKKDTRERAMVEKKR 409
             K+D R +A  E+KR
Sbjct: 340 MTKQDARRKA--EQKR 353

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  187 bits (474), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 194/377 (51%), Gaps = 21/377 (5%)

Query: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQ 102
           +K ++L KLPTL    ++  + PM              MN+D  +++FAF +L  LV E 
Sbjct: 16  RKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSEN 75

Query: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLL 162
           LS M+  + +   +QRR+E++KKD+ L L+G++L  S+L    + S+YI   +  +V   
Sbjct: 76  LSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKV--- 132

Query: 163 NRLATDTNEVXXXXXXXXXXXXXXXXXXXX---------XXVPITNTLENIIPDWLPSFP 213
           N++A  + E+                               VP TN     IP WLP FP
Sbjct: 133 NKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFP 192

Query: 214 PDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDD 273
           PD+TY+FT Q+NK + D   +R+K+  EGK+SE+AL++LL+    T   L N ++ +   
Sbjct: 193 PDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRS 252

Query: 274 MDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRN 333
           +     E   L  G     +K++   E+  + +           F +E+Y   R+ I R 
Sbjct: 253 LYEETQEETFLIFGPE---RKKSHTTENSHELL----RTLPLKNFSVEEYARNRVEIARR 305

Query: 334 KVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLN 393
           KV +YE  QLRLQ +PF+K   L S      +SR+ I+  ++++L+RS++ L+ S+P LN
Sbjct: 306 KVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLN 365

Query: 394 QNKKDTRERAMVEKKRR 410
           + K   RER +  ++RR
Sbjct: 366 EVK--ARERELANERRR 380

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  177 bits (450), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 192/380 (50%), Gaps = 30/380 (7%)

Query: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQ 102
           ++ VQL  LPTL E    D   P++             +N D +I++ AF +L  LV+E 
Sbjct: 16  QRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEM 75

Query: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLL 162
           LS+M+  + K+A +QRR  ++KKD+ L + G+NL  SDL +  ++S Y++ ++  ++   
Sbjct: 76  LSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQI--- 132

Query: 163 NRLATDTNEVXXXXXXXXXXXXXXXXXXXX---------XXVPITNTLENIIPDWLPSFP 213
            ++  D+  V                               VP +      +P WLP FP
Sbjct: 133 KKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFP 192

Query: 214 PDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHL--LESEKITTSKLLNLDKFDS 271
           PD+TY+FT Q+NK ITD  ++++K+A E   SEKAL+HL  L  E+ ++  +      DS
Sbjct: 193 PDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPI------DS 246

Query: 272 DDM-DTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINI 330
           D + + A+ E   L+  G   +KK  A  E     + D         F +E+Y   R+ I
Sbjct: 247 DTIYEEAQQETQLLF--GPVKKKKTAAINE-----VNDLLRTLPQQNFSVEEYARNRVEI 299

Query: 331 VRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIP 390
            R +V +YE  QL+LQ   F+K   LLS  + K+ S + +   I  +L RS + L+ S P
Sbjct: 300 ARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAP 359

Query: 391 TLNQNKKDTRERAMVEKKRR 410
           +L + +K  RE A+ E+ RR
Sbjct: 360 SLKERRK--REIALAEENRR 377

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  179 bits (453), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 198/412 (48%), Gaps = 94/412 (22%)

Query: 87  ITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQ 146
            +K AF  LT LVD+QL+ ++ ++ +L+ LQRR  +AK D++LW+RGFN+ PSDL   ++
Sbjct: 49  FSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYE 108

Query: 147 QSEYIKEKYGGEVTLLNRLATDTNEVXXXXXXXXXXXXXX---------------XXXXX 191
            S+YI+EK  G+     R+  D NE                                   
Sbjct: 109 SSKYIQEKLSGKEY---RILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSS 165

Query: 192 XXXVPITNTLENI-IPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALL 250
              +  TN  + I I  WLPSFPPD+TYKFTPQFN  ITD  +I++K+  EG KSEKALL
Sbjct: 166 NILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALL 225

Query: 251 HLLE----SEKITTSKLLNLDK----------FDSD------------------------ 272
           + L+    ++K T+   + +             D+D                        
Sbjct: 226 NFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDEEEKQAKNEKEKEQEDTVIIPKDI 285

Query: 273 DMDTAKLEMDALYSGGSC------DRKKRTAFFEDEEDRMVDEHGNSTSN-KFDIEKYVH 325
           DM+ A  E  A+Y   S       D   +       ++++V+  G+S+S+ KFD+ KY H
Sbjct: 286 DMNLANEETLAIYGTKSQSYEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSH 345

Query: 326 KRINIVRNKVKQYEDKQLRLQNDPFLKMTALLS-------------------------EQ 360
            R+ +VR KV+ +E+K+LRL+ +PFLK++ L+                            
Sbjct: 346 HRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNND 405

Query: 361 TDKKVS----REVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKK 408
            D ++S    R  IN  I + LKRSF  ++N+ P L + KK  R +  +EK+
Sbjct: 406 NDNRLSPIRKRAQINNEIISNLKRSFYSILNNYPKLKKAKKQ-RVKLAIEKR 456

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  175 bits (444), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 182/329 (55%), Gaps = 19/329 (5%)

Query: 87  ITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQ 146
           +++ AF  L+ LV++QL  +++++ +++ +QRR   AK DI+L LRG NL  S+L    Q
Sbjct: 67  LSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQ 126

Query: 147 QSEYIKEKYGGEVTLLNRLATDTNEV-XXXXXXXXXXXXXXXXXXXXXXVPITNTLENII 205
            S ++K K G +    + L  D++ +                       +   N  E  I
Sbjct: 127 VSNFMKSKNGKDY---DTLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFEISI 183

Query: 206 PDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLN 265
           P+WLP+FPPD+TYKFTPQFNK ITD  +I++K+  EGKKSEK+LL+LL    IT    + 
Sbjct: 184 PNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLND--ITEQSSIE 241

Query: 266 LDKFDSDDMDTAKLEMDALYSGGSCDRKKR-----TAFFEDEEDRMVDEHGNSTSNKFDI 320
            ++  + D + A+ E  A+Y   +  RKKR      +  + E++      G   S  F++
Sbjct: 242 NEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQG---SKHFNV 298

Query: 321 EKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKR 380
             Y H R+ + R +V+++E +QL+ + +PFL+++ +++   DKKVSR  +   I+N L+R
Sbjct: 299 GNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMIN---DKKVSRSDLKLEIKNSLQR 355

Query: 381 SFLQLINSIPTLNQNKKDTRERAMVEKKR 409
           S+  +  + P L Q +   R   +  +KR
Sbjct: 356 SYKSIFRNYPKLKQERD--RRLELARQKR 382

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  173 bits (439), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/417 (29%), Positives = 194/417 (46%), Gaps = 94/417 (22%)

Query: 81  MNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSD 140
           MN +T+I+  AF  L +LVD QL+DM+ Q+ +L+  QRR  +A  D+ LWLR FNL PSD
Sbjct: 75  MNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSD 134

Query: 141 LTITHQQSEYIKEKYGGEVTLLNRLATDTNEVXXXX------XXXXXXXXXXXXXXXXXX 194
           LT+  ++S +IK K+  +  LL  L  D N                              
Sbjct: 135 LTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTSDLLNNKSSESSSSRI 194

Query: 195 VPITNTLENIIPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLE 254
           VP +NT+   +P+WLPS PPD+TYKFTP +N+ ITD TV++K +  EGK +E AL+ LLE
Sbjct: 195 VPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLE 254

Query: 255 SEKITTSKLLNLDKFDSD---------DMDT----------------------------- 276
           +   TTS++ +L   ++D         ++DT                             
Sbjct: 255 AS--TTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELL 312

Query: 277 AKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNST-------SNKFDIEKYVHKRIN 329
           A+ E  A+Y      RK +  F     + M+D    +         + F++E+Y  K++ 
Sbjct: 313 AQDETKAIYGSALQVRKIKKRF-----ELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQ 367

Query: 330 IVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTD--------------------------- 362
            +R +V  YE+KQL+ Q +PF K + ++   +                            
Sbjct: 368 KIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQFHHGPHHHHHHHHHHHRRYSNSSTSSV 427

Query: 363 ---------KKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRR 410
                      VS++ IN +I+ +  RS   LINS+P L + K   RE A  E++++
Sbjct: 428 SSSPSPGLFGGVSKKQINHDIQQMFNRSLNNLINSLPNLAKEKASAREIAENEREKK 484

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  163 bits (412), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 109/376 (28%), Positives = 184/376 (48%), Gaps = 34/376 (9%)

Query: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQ 102
           K+ +QL KLP LTE    +   PM+             M  D  IT+  F +L   V+ Q
Sbjct: 16  KEGIQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQ 72

Query: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEV--- 159
           L DM+  + + A +QRR EV+ KD+ L+L G  ++   L   + +S+Y+++++ G V   
Sbjct: 73  LDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSI 132

Query: 160 -----TLLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPP 214
                +L+       +E                       VP TN   + +P WLP FPP
Sbjct: 133 EEQSASLMGHWHQPMSE--EELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPP 190

Query: 215 DYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDM 274
           D+TYKFT  +N+ ITD   +++K+  E K SEKALLH+L     T +K     K  +DD 
Sbjct: 191 DHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLG----TATK-----KPRADDA 241

Query: 275 DTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNK 334
              ++  D         +++    +  E  R+  E   + +  F+IE Y   R+ + R +
Sbjct: 242 QLPQIISDG--------QQENLLIYGPERRRLAPE--PAPTRGFNIEDYARCRVELARRR 291

Query: 335 VKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQ 394
           V+++E ++L++Q +PF++  A  S     ++SR+ I      +L RS++ ++++IP L +
Sbjct: 292 VEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRR 351

Query: 395 NKKDTRERAMVEKKRR 410
            K   RE A   ++ R
Sbjct: 352 TK--ARELAAAYERER 365

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  160 bits (405), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 192/377 (50%), Gaps = 17/377 (4%)

Query: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQ 102
           K+++QL KLP L E    +   PM++            M  D +IT+  F ++   ++ Q
Sbjct: 16  KEFIQLKKLPGLQEVAKHN---PMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQ 72

Query: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLL 162
           ++DM   + + A +QRR E++ KD+ L+L+G  ++   L    ++S YIK+ Y  E   +
Sbjct: 73  MNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNI 132

Query: 163 NRLATDTNEVXXXXXXXXXXXXXXXXXXXXX------XVPITNTLENIIPDWLPSFPPDY 216
            R + D  E                             VP TN   + +P WLP FPPD+
Sbjct: 133 ERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDH 192

Query: 217 TYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFD--SDDM 274
           TYKFT  +NK I+D   +++ +  EGK SEKALL++L S +   +K+L ++  +  +   
Sbjct: 193 TYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQ---AKMLKVEDEETIAQTY 249

Query: 275 DTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNK-FDIEKYVHKRINIVRN 333
             ++ E   +Y       ++  A+         D   NS+ +K F+I++Y   RI + R 
Sbjct: 250 KESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARR 309

Query: 334 KVKQYEDKQLRLQNDPFLKMTALLSEQTD-KKVSREVINTNIENVLKRSFLQLINSIPTL 392
           KV+++E+ +L+ Q +PF++ +++ S   + +K +R+        +L+RS++ ++ SIP L
Sbjct: 310 KVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKL 369

Query: 393 NQNKKDTRERAMVEKKR 409
            Q K +    A +E++R
Sbjct: 370 RQLKANEMA-AAIERER 385

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 175/334 (52%), Gaps = 40/334 (11%)

Query: 81  MNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVA-KKDIDLWLRGFNLQPS 139
           +N  T +   AF +L  L+D QL+D++ Q+ +L+ LQRR   A K DI L L+GFNL  S
Sbjct: 41  VNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDILLLLKGFNLSES 100

Query: 140 DLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITN 199
           +L    + S +IK  Y  +   L+  +   N+                       +  TN
Sbjct: 101 ELNTELEISNHIKRLYSEDEKKLSEDSIHYNQ--------HTDFVGPVETSSFQLLNPTN 152

Query: 200 TLENIIPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKIT 259
            L++ IP W PS PPD+TYKFTP++N  I D  +I++K   E K  + AL +L+   KI 
Sbjct: 153 PLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNLI--NKIE 210

Query: 260 TSKLLNLDKFDSDDMDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNST---SN 316
           +++  N   +D      AKLE  AL+  G+ + K  T       ++ V +  NS      
Sbjct: 211 SNEERNDLHYDE---TLAKLESQALF--GTVEEKMNT-------NKKVYKSLNSIIVPIT 258

Query: 317 KFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIEN 376
           KFDIE+Y HKR+NI RNKV ++E+K L L+ +PF+    L+++QTD           +++
Sbjct: 259 KFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFIN---LINDQTD-----------VKS 304

Query: 377 VLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRR 410
            L RSF  +INSIP L   KK    +A +E+  R
Sbjct: 305 YLNRSFQLMINSIPELTLEKKKAIRQAEIERDER 338

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  155 bits (393), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 181/379 (47%), Gaps = 31/379 (8%)

Query: 44  KYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQL 103
           K VQL  LP L E        P+              +N + +I++FAF +L  LV++ L
Sbjct: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76

Query: 104 SDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLN 163
           S+M+  + K+  +QRR  ++KKD+ L + G+NL  +DL +  ++S+Y++      V    
Sbjct: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERV---- 132

Query: 164 RLATDTNEVXXXXXXXXXXXXXXXXXXXX----------XXVPITNTLENIIPDWLPSFP 213
           R   + +EV                                VP T      +P WLP FP
Sbjct: 133 RKVREESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFP 192

Query: 214 PDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHL--LESEKITTSKLLNLDKFDS 271
           PD+TY+FT QFN+ ITD  ++++K+A E   SEKAL+HL  L  E+  +      +  DS
Sbjct: 193 PDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPS------EGADS 246

Query: 272 DDMDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIV 331
           D++     +   L  G +  +K + A      D +           +++E+Y   R+ I 
Sbjct: 247 DEIFKESQQDTQLIFGPA--KKTKIAAINGASDLL----RTLPQQNYNVEEYARNRVEIA 300

Query: 332 RNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPT 391
           R KV++YE  QL LQ   F+K   LLS    K+  ++V    +  +L RS++ L+ S P 
Sbjct: 301 RRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQV-EKEVRTLLHRSYIGLLKSAPL 359

Query: 392 LNQNKKDTRERAMVEKKRR 410
           L + +K  RE  + E+ RR
Sbjct: 360 LREQRK--REVELAEENRR 376

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  148 bits (374), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 111/380 (29%), Positives = 174/380 (45%), Gaps = 41/380 (10%)

Query: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDE 101
           Q   VQL +LP LTE  + +   P+              +N    I+ FA   L +LV  
Sbjct: 13  QHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAV 70

Query: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTL 161
           Q+  M   +  L  LQRR E ++ D+ L  R FN+  + L    Q SE+IK  +  E   
Sbjct: 71  QMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGK 130

Query: 162 LNRL----ATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYT 217
           L RL    A   NE                       +P +N LE +IP WLP+FPPD+T
Sbjct: 131 LVRLSSFPALAHNE---EDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLPNFPPDHT 187

Query: 218 YKFTPQFNKHITDATVIRKKVAAEGKKSEKALL-------HLLESEKITTSKLLNLDKFD 270
           YKFTP+FN  ITD   I+K++  E ++SEKALL       HL  +   +   +L      
Sbjct: 188 YKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVL------ 241

Query: 271 SDDMDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINI 330
            DD D  + +++    G +   +K T                ++ N+ +IE+Y   R+ +
Sbjct: 242 -DDADATEQQLEIW--GNALQERKPTI-------------TATSLNESNIEQYAKYRVEL 285

Query: 331 VRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIP 390
            R +V ++E  QL+   +PFLK++  L        S + I + I+   ++S    ++++P
Sbjct: 286 ARERVAKFELNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLP 345

Query: 391 TLNQNKKDTRERAMVEKKRR 410
            + + KK   ER  + K+ R
Sbjct: 346 KVQKLKK---ERIRMAKEER 362

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 172/376 (45%), Gaps = 32/376 (8%)

Query: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDE 101
           ++  VQL  LP LTE  +     P  V             + D  I+ FA   L +LV  
Sbjct: 13  RRTLVQLKNLPDLTEISHLKIDAP--VVEILRKTVLFQLNSLDICISNFALDELVNLVAV 70

Query: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEV-T 160
           Q+  M   +  LA LQRR    + D+ L  + FNL P+ L    Q SE+IK  +  E   
Sbjct: 71  QMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEK 130

Query: 161 LLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYTYKF 220
           L++  +   +                        +P +N LE ++P WLP+FPPD+TY+F
Sbjct: 131 LVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYRF 190

Query: 221 TPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFD-------SDD 273
           TP+FN  ITD   I++++  E K+SEKALL+L         +LL++            DD
Sbjct: 191 TPEFNHPITDLKTIKREIVKESKESEKALLNL-------NKRLLHISLASHAPPPRLPDD 243

Query: 274 MDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRN 333
            D  + +++    G +   +KRTA              + + N+ +IE+Y   R+ + R 
Sbjct: 244 ADAGEQQLEIW--GNALQEEKRTAI-------------SKSFNENNIEQYAKYRVELARE 288

Query: 334 KVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLN 393
           +V ++E  QL+   +PFL+++  L            I   I+   ++S +   +++P + 
Sbjct: 289 RVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQ 348

Query: 394 QNKKDTRERAMVEKKR 409
           + KK+    A+ E+ R
Sbjct: 349 KLKKEKIRMAIEERSR 364

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  146 bits (368), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 181/372 (48%), Gaps = 33/372 (8%)

Query: 46  VQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDEQLSD 105
           VQLT LP LTE  + +   P+              +N    I+ FA   + +LV  Q+  
Sbjct: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQMDG 74

Query: 106 MVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRL 165
           M   +  LA LQRR +V++ D+ L  R FNL  + L    Q SE+IK K+  E   L + 
Sbjct: 75  MFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKS 134

Query: 166 ATDTNEVXXXXXXXXXXXXXXXXXXXXXXV--PITNTLENIIPDWLPSFPPDYTYKFTPQ 223
           ++ T  V                      V  P +N LE +IP WLP+FPPD+TYKFTP+
Sbjct: 135 SSFT-AVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPE 193

Query: 224 FNKHITDATVIRKKVAAEGKKSEKALLHL------LESEKITTSKLLNLDKFDSDDMDTA 277
           FN  ITD   I++++  E  +SE+ALL+L      + S   T S  L     D+ D  + 
Sbjct: 194 FNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLP----DASDA-SE 248

Query: 278 KLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQ 337
           +LE+      G+   +++ A                + N+ +IE+Y   RI + R +V +
Sbjct: 249 RLEI-----WGNTLHERKPAIIAK------------SFNEKNIEQYAKYRIELARERVSK 291

Query: 338 YEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKK 397
           +E  QL+   +PFLK++  L    +   S +VI  +I+  L++S    ++++P + + KK
Sbjct: 292 FEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKK 351

Query: 398 DTRERAMVEKKR 409
           +  + A  E+++
Sbjct: 352 EKIQLAKEERQK 363

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  145 bits (367), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 110/375 (29%), Positives = 172/375 (45%), Gaps = 23/375 (6%)

Query: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHLTSLVDE 101
           Q   VQL  LP LTE  + +   P+              +N    I+ FA   L +LV  
Sbjct: 13  QSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTV 70

Query: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEV-T 160
           Q+  M   +  L  LQRR + ++ D+ L LR FNL    L    Q SE+IK K+  E   
Sbjct: 71  QMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEK 130

Query: 161 LLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDYTYKF 220
           L++  +                            +P +N LE  IP WLP+FPPD+TYKF
Sbjct: 131 LMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLPNFPPDHTYKF 190

Query: 221 TPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLE 280
           TP+FN  ITD   I+K++  E ++SEKALL+L +S    +S          DD D  + +
Sbjct: 191 TPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQ 250

Query: 281 MDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYED 340
           ++    G + + +K T                 + N+ +IE+Y   R+ + R +V ++E 
Sbjct: 251 LEIW--GNALEERKPTI-------------TEKSFNENNIEQYAKYRVELARERVTKFEV 295

Query: 341 KQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKD-- 398
            QL+   +PFLK++  L        S + I   IE   ++S    ++++P + + KK+  
Sbjct: 296 NQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKI 355

Query: 399 ---TRERAMVEKKRR 410
                ERA   K+R+
Sbjct: 356 RMAKEERAKSLKRRQ 370

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 107/397 (26%), Positives = 188/397 (47%), Gaps = 37/397 (9%)

Query: 36  DKEVTEQKKYVQLTKLPTLTEFKYEDTKGPMEVXXXXXXXXXXXXMNRDTTITKFAFTHL 95
           D ++   ++ V+L KLP L E  + +   PME             +N++  I++ AF  L
Sbjct: 11  DAKIETDQRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDL 67

Query: 96  TSLVDEQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKY 155
             +   QL D++  ++K+  +QRR +++K D++L+ +G  +   DL    + S ++  K+
Sbjct: 68  CYVSLLQLDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKF 127

Query: 156 GGEVTLLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLEN------IIPDWL 209
             E   LN       +                       V I N L +       +P WL
Sbjct: 128 KDEANALNETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWL 187

Query: 210 PSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKF 269
           P  PPD+TYKFT  + + ITD  +++KK+  EG+ SEKALL++L S+ +    L+ L+K 
Sbjct: 188 PELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNML-SQVVNQDPLVALNK- 245

Query: 270 DSDD----------MDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSN--- 316
           DSD           +  ++LE D ++         +T   + E       HG  + N   
Sbjct: 246 DSDQSANNAALSEHIKESQLETDLIFD------PHKTIPTDKEWGTTTVLHGIESFNLSP 299

Query: 317 --KFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKV-SREVINTN 373
              F++ +Y  KR  IV+ + ++ E++    + +PF++   + S        SR+ +   
Sbjct: 300 VKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQ 359

Query: 374 IENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRR 410
           ++ +L+RS+L LI+SIP +    K+ RERA  E + R
Sbjct: 360 LKTMLRRSYLGLIDSIPRV----KEVRERARKEAEER 392

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 104/207 (50%), Gaps = 25/207 (12%)

Query: 81  MNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSD 140
           +++D T+T+ A   L    ++QL+ +V+ + +++ LQRR+ +A  D+++W+RG+NL PSD
Sbjct: 49  IDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSD 108

Query: 141 LTITHQQSEYIKEKYG--------------------GEVTLLNRLATDTNEVXXXXXXXX 180
           L +T ++S++I+E Y                     G + + N+   +  +         
Sbjct: 109 LYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDD 168

Query: 181 XXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDY----TYKFTPQFNKHITDATVIRK 236
                         +  T+T       + P + PD+    TYK+TP +   +   T IR+
Sbjct: 169 DYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQ 228

Query: 237 KVAAEGKKSEKALLHLLES-EKITTSK 262
           K+  EG+ SEKAL+ L+ + + I+T+K
Sbjct: 229 KLVEEGRLSEKALVKLMSNLDSISTTK 255

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 10/104 (9%)

Query: 307 VDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALL---SEQTDK 363
           +D +  S    FD+E Y  +RI I R KV  +E +QL L+ +P L++  +    +E++D 
Sbjct: 387 LDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESD- 445

Query: 364 KVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEK 407
                   T  +  +KR+  +   +IP + + +K  R+ ++  K
Sbjct: 446 ------FETEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESIKRK 483

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 120/283 (42%), Gaps = 45/283 (15%)

Query: 104 SDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYG------- 156
           S MV ++ ++A +QRR+     D+ L L+GF L P D+    ++  Y+ +K G       
Sbjct: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIGYNRMQVP 134

Query: 157 GEVTLLNRLATDTNEVXXXXXXXXXXXXXXXXXXXXXXVPITNTLENIIPDWLPSFPPDY 216
            E T+  + AT + +                       +PI       IP WLP  PP++
Sbjct: 135 REQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEK----IPAWLPKLPPNH 190

Query: 217 TYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDT 276
           TYKFT ++NK + D  V+++K+  E  + E +L +L+           N D+    D DT
Sbjct: 191 TYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVR----------NCDR----DADT 236

Query: 277 AKLEMDALYSGGSCDRKKR-----TAFFEDEEDRMVDEHGNSTSNK--------FDIEKY 323
              ++D        +  KR      A +   E+      G  T  +        FD++ Y
Sbjct: 237 ---KVDERARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAY 293

Query: 324 VHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVS 366
              R+ + RN V+++E +      +PFL     + E + K  S
Sbjct: 294 SLGRVKLARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYS 336

>NCAS0A00660 Chr1 (122223..128894) [6672 bp, 2223 aa] {ON} Anc_1.94
            YNL262W
          Length = 2223

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 312  NSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALL--SEQTDKKVSREV 369
            N  SN F  + +    ++++RN +K++ D+ L+  +   L + + +  S+    K+    
Sbjct: 1774 NKNSNAFVEDAFSGAALSVLRNMLKEWWDQALKENSTADLLVNSFVNWSQNPTSKLFDGS 1833

Query: 370  INTNIENVLKRSFLQLINSIPTLNQN 395
            +  +I+N+ K+S LQL+N   TL  N
Sbjct: 1834 LRYHIQNLTKKSLLQLMNEFNTLGSN 1859

>NDAI0A06890 Chr1 complement(1576979..1578064) [1086 bp, 361 aa]
           {ON} Anc_3.123 YBR141C
          Length = 361

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 8/88 (9%)

Query: 232 TVIRKKVAAEGK--KSEKAL-----LHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDAL 284
           T+  KK+  +GK  K  KA       H L   + +  KL N++ FD+D+M   K  M  L
Sbjct: 9   TISGKKIIKDGKRIKPHKARRIIRRFHFLIERRKSLCKLFNVEMFDNDEMRNYKNVMSFL 68

Query: 285 YSGGSCDRKKRTAFFEDEEDRMVDEHGN 312
            SG    R  RT     ++ +  DE  N
Sbjct: 69  -SGSFSSRNNRTVMMISDKKQCYDEGWN 95

>CAGL0E03828g Chr5 complement(357552..363242) [5691 bp, 1896 aa]
           {ON} similar to uniprot|P38737 Saccharomyces cerevisiae
           YHL030w ECM29 involved in cell wall biogenesis and
           architecture
          Length = 1896

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 64/127 (50%), Gaps = 26/127 (20%)

Query: 282 DALYSGGSCDRK-KRTAF-FEDEEDRMVDEHGNSTSNKFDI----EKYVHK---RINIVR 332
           DAL S      K   +AF F+DEE RM++  G ST N+ DI    +K +H    RIN  +
Sbjct: 518 DALMSARYMAIKFTNSAFSFDDEEARMLNIFGTSTENRLDITEEAKKGLHPYWFRINYFK 577

Query: 333 ------NKVKQYEDKQLRLQ----NDPFLK-MTALLSEQT----DKKVSREVINTNIENV 377
                 N V +  D+QL  Q      P LK M++LL E+     + + S+ VI+  + N 
Sbjct: 578 SFKTSANAVVESLDQQLGSQITKTKLPTLKTMSSLLLEEVHLLKEDRNSQRVIDKCLNNA 637

Query: 378 LKRSFLQ 384
           +  SFL+
Sbjct: 638 V--SFLR 642

>Suva_14.80 Chr14 (142826..149497) [6672 bp, 2223 aa] {ON} YNL262W
            (REAL)
          Length = 2223

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 306  MVDEHGNSTSNK-FDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLS--EQTD 362
            M D++ NS S   F  + + +  +N++R  +K++ D+ L+      L + +L S  +  +
Sbjct: 1766 MDDKNANSNSTSDFVQDAFSNDALNVLRGMLKEWWDEALKDNATADLLVNSLASWVQNPN 1825

Query: 363  KKVSREVINTNIENVLKRSFLQLINSIPTL 392
             K+   ++  ++ N+ K+S LQL+N   TL
Sbjct: 1826 AKLFDGLLRYHVHNLTKKSLLQLVNEFSTL 1855

>KAFR0A01300 Chr1 (247849..250617) [2769 bp, 922 aa] {ON} Anc_3.195
           YDR006C
          Length = 922

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 306 MVDEHGNS--TSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQT 361
           + DEHGN   T N   I  ++ K IN ++N+ K   ++ L L ND        LS+QT
Sbjct: 740 ITDEHGNCRWTKNTLSISVHLCKVINDLKNEYKNTTNEPLNLNNDKITFAKTWLSKQT 797

>Kpol_2000.54 s2000 complement(102269..108904) [6636 bp, 2211 aa] {ON}
            complement(102269..108904) [6636 nt, 2212 aa]
          Length = 2211

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 309  EHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLS--EQTDKKVS 366
            E G ++S+ F  + +    + ++RN +K + D  L+  +   L + + +S  + +D K+ 
Sbjct: 1758 ESGETSSSLFIQDSFSSTSLIVLRNLLKTWWDHALKENSTADLLVNSFVSWVQNSDSKLF 1817

Query: 367  REVINTNIENVLKRSFLQLINSIPTL 392
               +  ++ N+ K+S LQL+N   +L
Sbjct: 1818 DGSLRYHVYNLTKKSLLQLMNEFTSL 1843

>NDAI0F04140 Chr6 complement(994996..1001766) [6771 bp, 2256 aa] {ON}
            Anc_1.94 YNL262W
          Length = 2256

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 312  NSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQN----DPFLKMTALLSEQTDKKVSR 367
            N  S+ F  + +    + ++RN +K++ D  L LQ+    D  +      ++    K+  
Sbjct: 1801 NGGSSAFVEDSFSGAALTVLRNMLKEWWD--LALQDNSVADILVNSFVGWTQNPTCKLFD 1858

Query: 368  EVINTNIENVLKRSFLQLINSIPTLNQN 395
              +  +I+N+ K+S LQLIN   TL  N
Sbjct: 1859 GSLRYHIQNLTKKSLLQLINEFNTLGSN 1886

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,237,441
Number of extensions: 2379737
Number of successful extensions: 9707
Number of sequences better than 10.0: 122
Number of HSP's gapped: 10168
Number of HSP's successfully gapped: 131
Length of query: 614
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 498
Effective length of database: 40,180,143
Effective search space: 20009711214
Effective search space used: 20009711214
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)