Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002208.837ON37737714470.0
CAGL0M02937g8.837ON37338110431e-140
KAFR0B039008.837ON37938510391e-140
Kpol_1068.118.837ON38138310301e-138
TDEL0B006008.837ON36937910281e-138
SAKL0D01540g8.837ON3653829811e-131
Skud_13.4488.837ON3643859681e-129
Smik_13.4898.837ON3723859661e-129
ZYRO0G14124g8.837ON3693889641e-129
YMR276W (DSK2)8.837ON3733829641e-129
Suva_13.4648.837ON3663839351e-124
NCAS0C004308.837ON3693829261e-123
KLTH0C03938g8.837ON3764039241e-122
KLLA0D01859g8.837ON3713889081e-120
Kwal_27.102758.837ON3794129031e-119
TBLA0D032308.837ON3753818871e-117
ABL129W8.837ON3453788511e-112
KNAG0J002908.837ON3673908311e-109
Ecym_46088.837ON4064148201e-106
NDAI0K004408.837ON4042467272e-92
TBLA0B032408.837ON2842211503e-10
Kpol_1036.628.311ON77711225e-08
TPHA0C008908.311ON77711146e-07
KLLA0F17974g8.311ON77711137e-07
TDEL0G017504.16ON77711111e-06
NDAI0H002704.16ON77711102e-06
CAGL0B01589g8.311ON77711102e-06
ZYRO0D05962g8.311ON77731093e-06
Skud_9.205.701ON125541123e-06
Smik_11.3575.701ON125541123e-06
Smik_9.215.701ON124541123e-06
Kwal_YGOB_Anc_5.7015.701ON128711114e-06
ZYRO0G06622g5.701ON128711114e-06
KAFR0D022305.701ON128711114e-06
KAFR0H002205.701ON128711114e-06
Suva_11.3305.701ON128711114e-06
Skud_11.3335.701ON128711114e-06
YIL148W (RPL40A)5.701ON128711114e-06
YKR094C (RPL40B)5.701ON128711114e-06
KLTH0E01078g5.701ON128711115e-06
SAKL0E14894g5.701ON128711115e-06
KLLA0A00616g5.701ON128711115e-06
TPHA0E002405.701ON128711115e-06
TPHA0D046005.701ON128711115e-06
TBLA0E021105.701ON128711115e-06
CAGL0G02475g5.701ON128711115e-06
Kpol_1043.695.701ON128711105e-06
Ecym_40195.701ON128711105e-06
AFR285C5.701ON128711106e-06
NDAI0E050305.701ON128711106e-06
NCAS0A032105.701ON128711106e-06
NCAS0G002405.701ON128711106e-06
KNAG0L021205.701ON128711106e-06
TDEL0F043808.311ON77731076e-06
TDEL0B022005.701ON128711106e-06
NDAI0G003301.480ON427581168e-06
Suva_10.32singletonON62541048e-06
KNAG0J028804.16ON153711101e-05
TPHA0K022504.16ON153711091e-05
Ecym_84084.16ON153711091e-05
Ecym_41818.386ON152711091e-05
AGL128W8.386ON152711091e-05
Suva_5.321.480ON409581141e-05
TPHA0C023908.386ON150711081e-05
KLTH0F08734g8.386ON150711081e-05
ZYRO0C04026g8.386ON152711082e-05
KLTH0G12540g8.311ON77711032e-05
Suva_10.34singletonON151711082e-05
Kwal_23.33118.386ON150711082e-05
NDAI0G022808.386ON152711082e-05
KNAG0C065805.701ON149711082e-05
SAKL0H15818g8.311ON77711032e-05
KAFR0H020008.386ON152711082e-05
SAKL0H13926g8.386ON154711082e-05
KNAG0A027308.386ON150711072e-05
NCAS0C029408.386ON152711072e-05
YLR167W (RPS31)8.386ON152711072e-05
KLLA0D18304g8.386ON150711072e-05
NCAS0B035208.311ON77711022e-05
Skud_5.531.480ON397581132e-05
CAGL0G08173g8.386ON152711072e-05
YEL037C (RAD23)1.480ON398581122e-05
TBLA0G006704.16ON229711103e-05
NDAI0D049304.16ON229711103e-05
KAFR0I014704.16ON229711103e-05
Kwal_55.206074.16ON231711093e-05
Suva_9.405.701ON144561063e-05
Kpol_1030.58.386ON152711063e-05
Kpol_1024.168.386ON152711063e-05
Suva_10.33singletonON254711103e-05
TDEL0F051008.386ON150711063e-05
KLTH0E05852g4.16ON409711114e-05
SAKL0H25784g4.16ON305711104e-05
Suva_10.2668.386ON152711054e-05
Skud_12.2348.386ON152711054e-05
Smik_12.2298.386ON152711054e-05
TBLA0H031808.386ON152711054e-05
AFR358W1.480ON413691104e-05
Smik_5.561.480ON397581105e-05
Skud_12.294.16ON381711105e-05
YLL039C (UBI4)4.16ON381711105e-05
ACL062C4.16ON382711095e-05
KLLA0E00749g4.16ON381711095e-05
Suva_10.304.16ON381711095e-05
ZYRO0G07854g4.16ON460711105e-05
NCAS0C058504.16ON388711096e-05
CAGL0D05082g4.16ON533711106e-05
Smik_12.184.16ON460711096e-05
Kpol_1070.64.16ON533711096e-05
CAGL0L01309g1.480ON392731087e-05
NDAI0J010708.311ON7771989e-05
NCAS0G041201.480ON392581071e-04
YDR139C (RUB1)8.311ON7771971e-04
NDAI0F003005.701ON187541031e-04
Ecym_35721.480ON443691061e-04
SAKL0D11814g1.480ON400581025e-04
Kwal_27.101521.480ON38153980.001
KLTH0C03410g1.480ON39153980.001
KAFR0C030008.142ON39750940.005
KAFR0E005301.480ON37963920.007
NCAS0B045908.142ON44742890.020
TBLA0D022108.142ON56338880.023
CAGL0L06028g8.142ON50538880.025
TPHA0O004401.480ON36958860.033
KLLA0E22133g1.480ON38358860.037
TDEL0C025901.480ON36867850.045
ZYRO0D08140g6.343ON7345750.11
ZYRO0F05192g1.480ON38458820.11
Kwal_56.238838.311ON5249730.12
Suva_2.3008.311ON8655750.13
NDAI0B01850singletonON40338820.13
Kpol_370.61.480ON40467810.17
Ecym_25016.343ON7351730.17
Smik_7.918.142ON39938800.22
YGL181W (GTS1)8.142ON39638800.22
Ecym_42448.311ON5034700.28
SAKL0H24772g8.142ON41438780.35
KNAG0G005101.480ON37566770.44
TDEL0B046908.142ON44238770.45
Suva_7.818.142ON40138760.72
KLLA0C08470g6.343ON7459680.92
KAFR0B056708.311ON5751651.7
AGL185W8.311ON5049641.7
Smik_4.3838.311ON10049662.9
NCAS0C040908.142ON39647678.2
Skud_7.908.142ON39638669.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00220
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   561   0.0  
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   406   e-140
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   404   e-140
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   401   e-138
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   400   e-138
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   382   e-131
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   377   e-129
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   376   e-129
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   375   e-129
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   375   e-129
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   364   e-124
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   361   e-123
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   360   e-122
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   354   e-120
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   352   e-119
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   346   e-117
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   332   e-112
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   324   e-109
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   320   e-106
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   284   2e-92
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    62   3e-10
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    52   5e-08
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    49   6e-07
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    48   7e-07
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    47   1e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    47   2e-06
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    47   2e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    47   3e-06
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     48   3e-06
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    48   3e-06
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     48   3e-06
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    47   4e-06
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    47   4e-06
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    47   4e-06
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    47   4e-06
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    47   4e-06
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    47   4e-06
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    47   4e-06
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    47   4e-06
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    47   5e-06
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    47   5e-06
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    47   5e-06
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    47   5e-06
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    47   5e-06
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    47   5e-06
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    47   5e-06
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    47   5e-06
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    47   5e-06
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    47   6e-06
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    47   6e-06
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    47   6e-06
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    47   6e-06
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    47   6e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    46   6e-06
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    47   6e-06
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    49   8e-06
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    45   8e-06
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    47   1e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    47   1e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    47   1e-05
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    47   1e-05
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    47   1e-05
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    49   1e-05
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    46   1e-05
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    46   1e-05
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    46   2e-05
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    44   2e-05
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    46   2e-05
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    46   2e-05
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    46   2e-05
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    46   2e-05
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    44   2e-05
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    46   2e-05
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    46   2e-05
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    46   2e-05
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    46   2e-05
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    46   2e-05
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    46   2e-05
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    44   2e-05
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    48   2e-05
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    46   2e-05
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    48   2e-05
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    47   3e-05
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              47   3e-05
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    47   3e-05
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    47   3e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     45   3e-05
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    45   3e-05
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    45   3e-05
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    47   3e-05
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    45   3e-05
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    47   4e-05
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    47   4e-05
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    45   4e-05
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    45   4e-05
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    45   4e-05
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    45   4e-05
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    47   4e-05
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    47   5e-05
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    47   5e-05
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    47   5e-05
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    47   5e-05
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    47   5e-05
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    47   5e-05
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    47   5e-05
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             47   6e-05
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    47   6e-05
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    47   6e-05
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    47   6e-05
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    46   7e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    42   9e-05
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    46   1e-04
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    42   1e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        44   1e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    45   1e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    44   5e-04
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    42   0.001
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    42   0.001
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    41   0.005
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    40   0.007
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    39   0.020
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.023
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.025
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    38   0.033
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    38   0.037
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    37   0.045
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    33   0.11 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    36   0.11 
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    33   0.12 
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    33   0.13 
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    36   0.13 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    36   0.17 
Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON} s...    33   0.17 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    35   0.22 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    35   0.22 
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    32   0.28 
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    35   0.35 
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    34   0.44 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    34   0.45 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.72 
KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly s...    31   0.92 
KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694) [...    30   1.7  
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    29   1.7  
Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 b...    30   2.9  
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     30   8.2  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    30   9.5  

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/377 (77%), Positives = 291/377 (77%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KIQDGHSIHLVKSGD                          VPTNITSGQTNGFNPLADL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
           NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMM             DSSFP
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSSFP 240

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXXXXXX 300
           APGETSTES                                GMNPFAGL           
Sbjct: 241 APGETSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGLGNPAAAGSTGA 300

Query: 301 XXXXQYPGFNPSMLASMLQQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRR 360
               QYPGFNPSMLASMLQQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRR
Sbjct: 301 PGTPQYPGFNPSMLASMLQQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRR 360

Query: 361 SGGSVQGALDALLNNDV 377
           SGGSVQGALDALLNNDV
Sbjct: 361 SGGSVQGALDALLNNDV 377

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  406 bits (1043), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 216/381 (56%), Positives = 251/381 (65%), Gaps = 12/381 (3%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSI++ IKSGQNKWDV+++PS TIL  KE I+K S+IP+GNQRLIYSGKILKD +TVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
            I+D H+IH+VKSG                           VP+NI SGQT GFNPLADL
Sbjct: 61  NIKDDHAIHMVKSG-----GNASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADL 115

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           T ARYAGY   +PSADMFGPDGG+ N P+QD+ML M+ENP+FQSQMNEMLSNP+M+++MI
Sbjct: 116 TGARYAGY-ANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMI 174

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
            SNPQLQA+GPQAR+M QSPFFRQMLTNP MIRQSM+ ARMM              S+FP
Sbjct: 175 QSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFP 234

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---GMNPFAGLXXXXXXXX 297
           APG   TE+                                     NPFA +        
Sbjct: 235 APGGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAM--MGNMNN 292

Query: 298 XXXXXXXQYPGFNPSMLASML-QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIA 356
                  Q P F+P++LAS+L  Q   PAQED RPPE RYE QLRQLNDMGFF+FDRN+A
Sbjct: 293 QQGGAGVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVA 352

Query: 357 ALRRSGGSVQGALDALLNNDV 377
           ALRRSGGSVQGALDALLN DV
Sbjct: 353 ALRRSGGSVQGALDALLNGDV 373

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  404 bits (1039), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 249/385 (64%), Gaps = 14/385 (3%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSI++ IKSGQNKWDV    S++I   KE ISK S+IPA NQRLIYSGKILKD +TVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KI++GHSIHLVKSG                           VP+NI SGQT GFNPL DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           TSARYAGY L MPSADMFGPDGG+ + P+QDDML ML+NPVFQSQMNEMLSNPQM+++MI
Sbjct: 121 TSARYAGY-LNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
            SNPQLQA+GPQAR+M QSP FRQML NPDMIRQSM+ ARMM              S+FP
Sbjct: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDP-SAFP 238

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXX----- 295
           APGE S  +                                  NPF  L           
Sbjct: 239 APGEASAST----NEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAM 294

Query: 296 XXXXXXXXXQYPGFNPSMLASMLQQPRQ---PAQEDTRPPEVRYESQLRQLNDMGFFEFD 352
                    Q P F+P++LASML  P+    PAQ+D RPPE RYE+QLRQLNDMGFF+FD
Sbjct: 295 SSNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFD 354

Query: 353 RNIAALRRSGGSVQGALDALLNNDV 377
           RN+AALRRSGGSVQGALDALLN DV
Sbjct: 355 RNVAALRRSGGSVQGALDALLNGDV 379

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 249/383 (65%), Gaps = 8/383 (2%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I + IKSGQNKW+V V+ SNT+L+ KE I+K S+IP  NQRLIYSGKILKD + +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KIQD HSIHLVKSG                           +P+NI +GQ+ GFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           TSARYAGY L +PSADMFGPDGGM +MPNQDDML MLENPVFQSQMNEMLSNPQM+++MI
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
            SNPQLQA+GP+AR+MFQSPFFRQMLTNP+MIRQSM+MA MM              SSFP
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAA--SSFP 238

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPF-----AGLXXXXXX 295
           APGET T +                                 MNPF              
Sbjct: 239 APGETDTTAAAETNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNNNAAAAAGA 298

Query: 296 XXXXXXXXXQYPGFNPSMLASML-QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRN 354
                      P F+PS+ ASM     +Q  ++D RPPE RYESQLRQLNDMGFF+FDRN
Sbjct: 299 GATGAAGATGTPAFDPSLFASMFQPPQQQQQEQDNRPPEERYESQLRQLNDMGFFDFDRN 358

Query: 355 IAALRRSGGSVQGALDALLNNDV 377
           +AALRRSGGSVQGALDALL+NDV
Sbjct: 359 VAALRRSGGSVQGALDALLSNDV 381

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 254/379 (67%), Gaps = 12/379 (3%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSI+VQ+K GQ+KW+V+V P  T+ EFK+ I+K S+IPA NQRLIYSGKILKD + VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KIQDGH+IHLVKSG                           VP+NI SGQT GFNPL+DL
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSAT-VPSNIASGQTGGFNPLSDL 119

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           TSARYAG+   +PSADMFGPDGG+TNMPNQDDML MLENP+FQSQMNEMLSNPQMV++MI
Sbjct: 120 TSARYAGFT-NLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
            SNPQLQA+GPQAR++ QSPFFRQMLTNP M+RQSM+ + MM              +SFP
Sbjct: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAA----ASFP 234

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXXXXXX 300
           APG+++TE+                                G NP A +           
Sbjct: 235 APGDSTTEASSTEANTDANANTNANANTNAANPFAAMFNP-GSNPLASMFGNQGVGAADN 293

Query: 301 XXXXQYPGFNPSMLASMLQ--QPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAAL 358
               Q   F+PSMLAS+L     +Q A++D RPPE RYE QLRQLNDMGFF+F++N+AAL
Sbjct: 294 Q---QNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAAL 350

Query: 359 RRSGGSVQGALDALLNNDV 377
           RRSGGSVQGALD+LLN DV
Sbjct: 351 RRSGGSVQGALDSLLNGDV 369

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 207/382 (54%), Positives = 248/382 (64%), Gaps = 22/382 (5%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSI++ IKSGQNKWDV++EP+NT++E KE ISK S+IP  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KI D H++HLV+SG                           VP+NI+SGQT GFNPLADL
Sbjct: 61  KIADDHAVHLVRSG---GPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADL 117

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           T ARYAGY   +PSADMFGPDGG+TN PN D++L+ML+NP+ QSQMNEMLSNPQMV++MI
Sbjct: 118 TGARYAGY-ANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMI 176

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
             NPQLQA+GP+ARE+ QS +FRQM+TNPDMIRQSM+ ARM                +FP
Sbjct: 177 QQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAG-----GAFP 231

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXXXXXX 300
           APG T+T++                                  NPFA L           
Sbjct: 232 APG-TATQT-------ASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASM 283

Query: 301 XXXXQYPGFNPSMLASML-----QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNI 355
               + P F+PS+L+S L        +Q   +D RPPE RYE QLRQLNDMGFF+FDRN+
Sbjct: 284 FPNGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNV 343

Query: 356 AALRRSGGSVQGALDALLNNDV 377
           AALRRSGGSVQGALDALLN DV
Sbjct: 344 AALRRSGGSVQGALDALLNGDV 365

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  377 bits (968), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/385 (54%), Positives = 246/385 (63%), Gaps = 29/385 (7%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MS+++ IKSGQ+KW+VAV P  T+L+FKE ISKA+ IP  NQRLIYSGKILKD +TV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  HIQDGHSVHLVKS---QPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTN--MPNQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M+ENP+FQSQMNEMLSNPQM+++
Sbjct: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSS 238
           MI SNPQLQA+GPQAR+M QSP FRQMLTNP+M+RQSM+ ARMM              S+
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAA-----SA 231

Query: 239 FPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXX--X 296
           FPAPG  ++E                                   NPFA L         
Sbjct: 232 FPAPGGDASEE------------GANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFA 279

Query: 297 XXXXXXXXQYPGFNPSMLASMLQQPRQPAQ----EDTRPPEVRYESQLRQLNDMGFFEFD 352
                     P F+P++LASM Q  +  AQ    ED+RPPE RYE QLRQLNDMGFF+FD
Sbjct: 280 NAGNTAPTGMPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFD 339

Query: 353 RNIAALRRSGGSVQGALDALLNNDV 377
           RN+AALRRSGGSVQGALD+LLN DV
Sbjct: 340 RNVAALRRSGGSVQGALDSLLNGDV 364

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  376 bits (966), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/385 (54%), Positives = 245/385 (63%), Gaps = 21/385 (5%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MS+++ IKSGQ+KW+V+V P +T+ +FKE ISKA+ +P  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  HIQDGHSVHLVKS---QPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTN--MPNQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M+ENP+FQSQMNEMLSNPQM+++
Sbjct: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSS 238
           MI SNPQLQA+GPQAR+M QSP FRQMLTNPDMIRQSM+ ARMM              S+
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAA-SA 235

Query: 239 FPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXX--X 296
           FPAPG  + E                                   NPFA L         
Sbjct: 236 FPAPGGDAPEE--------SANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFA 287

Query: 297 XXXXXXXXQYPGFNPSMLASMLQQPRQPAQ----EDTRPPEVRYESQLRQLNDMGFFEFD 352
                     P F+P++LASM Q  +  AQ    EDTRPPE RYE QLRQLNDMGFF+FD
Sbjct: 288 SAGNATGTGMPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFD 347

Query: 353 RNIAALRRSGGSVQGALDALLNNDV 377
           RN+AALRRSGGSVQGALD+LLN DV
Sbjct: 348 RNVAALRRSGGSVQGALDSLLNGDV 372

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  375 bits (964), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/388 (53%), Positives = 248/388 (63%), Gaps = 33/388 (8%)

Query: 2   SISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61
           +I+VQIKSGQNKW+V V+P +T+  FKE ISK S+IPA +QRLIYSGKILKD +T++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IQDGHSIHLVKSGDXXXXXXXXXXXXXXX-----------XXXXXXXXXXXVPTNITSGQ 110
           +QDGHS+HLVKS                                        P+N+++GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 111 TNGFNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEML 170
           + GFNPLADLTSARYAG+   +PSADMFGPDGG TNMPNQ+D+L+ML+NP+FQSQMNEML
Sbjct: 123 SGGFNPLADLTSARYAGFT-SLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEML 181

Query: 171 SNPQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXX 230
           SNPQMV++MI SNPQLQA+GPQAR+MFQSPFFRQMLTNP MIRQSM+ ARMM        
Sbjct: 182 SNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEND 241

Query: 231 XXXXXDSSFPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLX 290
                 ++FPAPG  +TE                                   NPFA L 
Sbjct: 242 AA----NAFPAPGNENTEGESAAGANDGGNPAAAATNAGAPPAG---------NPFAALL 288

Query: 291 XXXXXXXXXXXXXXQYPGFNPSMLASMLQQPRQPAQ-EDTRPPEVRYESQLRQLNDMGFF 349
                              +P +LASML  P Q  Q +D RPPE RYE+QLRQLN+MGFF
Sbjct: 289 GGGGPLQQPGGL-------DPQLLASMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFF 341

Query: 350 EFDRNIAALRRSGGSVQGALDALLNNDV 377
           +FDRN+AALRRSGGSVQGALD+LLN DV
Sbjct: 342 DFDRNVAALRRSGGSVQGALDSLLNGDV 369

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  375 bits (964), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/382 (55%), Positives = 246/382 (64%), Gaps = 14/382 (3%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MS+++ IKSGQ+KW+V V P +T+L+FKE I+KA+ IP  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  HIQDGHSVHLVKS---QPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTN--MPNQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M+ENP+FQSQMNEMLSNPQM+++
Sbjct: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSS 238
           MI SNPQLQA+GPQAR+M QSP FRQMLTNPDMIRQSM+ ARMM              S+
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAA-SA 235

Query: 239 FPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXX--X 296
           FPAPG  + E                                   NPFA L         
Sbjct: 236 FPAPGGDAPEE----GSNTNTTSSSNTGNNAGTNAGTNAGANTAANPFASLLNPALNPFA 291

Query: 297 XXXXXXXXQYPGFNPSMLASMLQQPRQPAQ-EDTRPPEVRYESQLRQLNDMGFFEFDRNI 355
                     P F+P++LASM Q P Q +Q EDTRPPE RYE QLRQLNDMGFF+FDRN+
Sbjct: 292 NAGNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNV 351

Query: 356 AALRRSGGSVQGALDALLNNDV 377
           AALRRSGGSVQGALD+LLN DV
Sbjct: 352 AALRRSGGSVQGALDSLLNGDV 373

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  364 bits (935), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 207/383 (54%), Positives = 244/383 (63%), Gaps = 23/383 (6%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MS++V +KSGQ+KW+V+V P +T+L+FKE IS+A+ IP  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  HIQDGHSVHLVKS--QPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADL 118

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMP--NQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M++NP+FQSQMNEMLSNPQM+++
Sbjct: 119 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDF 177

Query: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSS 238
           MI SNPQLQA+GPQAR+M QSP FRQMLTNPDMIRQSM+ ARMM              S+
Sbjct: 178 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAA-SA 236

Query: 239 FPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXXXX 298
           FPAPG  + E                                  +NPFA           
Sbjct: 237 FPAPGGDAPEE-----TTDTDAAPSSNAGANAAANPFASLLNPALNPFANAGNSAAATG- 290

Query: 299 XXXXXXQYPGFNPSMLASML----QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRN 354
                   P F+P++LASM        + P  EDTRPPE RYE QLRQLNDMGFF+FDRN
Sbjct: 291 -------MPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRN 343

Query: 355 IAALRRSGGSVQGALDALLNNDV 377
           +AALRRSGGSVQGALD+LLN DV
Sbjct: 344 VAALRRSGGSVQGALDSLLNGDV 366

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  361 bits (926), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 203/382 (53%), Positives = 243/382 (63%), Gaps = 18/382 (4%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSIS+ +KSGQN W V+++P++TIL+ KE I+K S++PA NQRLI+SGKILKD +TVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KI DG SIH+VKSG                           V  N+ +G+T GFNPL+DL
Sbjct: 61  KILDGLSIHMVKSG-------GGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDL 113

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNM-PNQDDMLSMLENPVFQSQMNEMLSNPQMVEYM 179
           TSARYAGY L +PSAD FGPDGG+ N  PNQD+ML ML+NPVFQSQMNEMLSNPQM++++
Sbjct: 114 TSARYAGY-LNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFI 172

Query: 180 INSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSS- 238
           I +NPQLQA+GPQAR++ Q+P FRQMLTNPDMIRQSM+MAR M              SS 
Sbjct: 173 IQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSD 232

Query: 239 FPAPG--ETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXX 296
           FPAPG  + +T S                                 MNPFA         
Sbjct: 233 FPAPGGDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAA-----GMA 287

Query: 297 XXXXXXXXQYPGFNPSMLASML-QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNI 355
                     P F+PS  ASM      Q  QEDTRPPE RYE QLRQLNDMGFF+FDRN+
Sbjct: 288 NTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNV 347

Query: 356 AALRRSGGSVQGALDALLNNDV 377
           AALRRSGG+V+ AL+ALLN DV
Sbjct: 348 AALRRSGGNVESALNALLNGDV 369

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  360 bits (924), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 206/403 (51%), Positives = 243/403 (60%), Gaps = 53/403 (13%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSI+V IKSGQNKWDVA++PS+TI +FK  I+  S+I   NQRLIYSGKILKD +TVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXX-------XVPTNITSGQTNG 113
           KI D HS+HLVKSG                                   P N+++GQ NG
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 114 FNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNP 173
           FNPL+DLTSARYAG+ L +PSAD FGPDGGMT+ PN DD+L MLENPV QSQMNEMLSNP
Sbjct: 121 FNPLSDLTSARYAGF-LNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNP 179

Query: 174 QMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXX 233
           QM++++I  +PQLQ++GPQAR + QSPFFRQM+TNPDMIRQSM+ + M+           
Sbjct: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGGDSAAGGG-- 237

Query: 234 XXDSSFPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXX 293
              SSFPAPG T  E+                                  NPFA L    
Sbjct: 238 ---SSFPAPG-TPAEADAPSQPAANPSAAPSAGTA---------------NPFASLLGGQ 278

Query: 294 XXXXXXXXXXXQY------------PGFNPSMLASML-------QQPRQPAQEDTRPPEV 334
                       +            P  +P +L+S+L       QQP     +DTRPPE 
Sbjct: 279 AGASGASPAANPFLSMLGGGSAGTPPALDPMVLSSILGGAGAANQQP-----QDTRPPEE 333

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377
           RYE QLRQLNDMGFFEFDRN+AALRRSGGSVQGALDALLN DV
Sbjct: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/388 (52%), Positives = 232/388 (59%), Gaps = 33/388 (8%)

Query: 3   ISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKI 62
           ISV +KSGQN W V +E + TI  FKE IS  S +PA NQRLIYSGKILKD ETVESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADLTS 122
           QDGHS+H+VKS                             P+NI++GQT GFNPLADLT 
Sbjct: 64  QDGHSVHMVKS---GGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTG 120

Query: 123 ARYAGYNLPMPSADMFGPDGGM--TNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           ARYAG    +PSADMFGPDGG+  +N  N + ML MLENP+FQSQMNEMLSNPQMV+++I
Sbjct: 121 ARYAGL-ANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
             NPQLQALGP+AR+M QSPFFRQM+T+P MIRQSM+MA  M              S+FP
Sbjct: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPDGAA------SAFP 233

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXXXXXX 300
           APG  S                                     NPFAGL           
Sbjct: 234 APGSASGAGGANETSTNDADSAATGAAASSTGQA---------NPFAGLFGATPGNAAAA 284

Query: 301 X------XXXQYPGFNPSMLASML-----QQPRQPAQEDTRPPEVRYESQLRQLNDMGFF 349
                     Q P FN  +LASM           PA  D RPPE RYESQLRQLNDMGFF
Sbjct: 285 NPFAGLFPGGQQPQFNQELLASMFGGNSNATGAAPA-VDNRPPEERYESQLRQLNDMGFF 343

Query: 350 EFDRNIAALRRSGGSVQGALDALLNNDV 377
           +FDRN+AALRR+GGSVQGALDALLN DV
Sbjct: 344 DFDRNVAALRRAGGSVQGALDALLNGDV 371

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  352 bits (903), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/412 (48%), Positives = 244/412 (59%), Gaps = 68/412 (16%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSI+V +KSGQ+KWDV+V+  +T+ +FK  I++ S I   NQRLIYSGKILKD +T+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITS------------ 108
           KI DGH++HLVKSG                            PTN  S            
Sbjct: 61  KILDGHAVHLVKSG-----------TKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSS 109

Query: 109 GQTNGFNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNE 168
           GQ  GFNPL+DLTSARYAGY L +PSAD FGPDGGMT+ PN DDML MLENPV QSQMNE
Sbjct: 110 GQAGGFNPLSDLTSARYAGY-LNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNE 168

Query: 169 MLSNPQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXX 228
           MLSNPQM++++I  +PQLQ++GPQAR+M QSPFFRQM+TNP+MIRQSM+ + ++      
Sbjct: 169 MLSNPQMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDP 228

Query: 229 XXXXXXXDSSFPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAG 288
                   ++FPAPG   +++                                  NPFA 
Sbjct: 229 SAAGA---NAFPAPGTADSDASAQPASTNTSTADAAQSATNA-------------NPFAS 272

Query: 289 LXXXXXXXXXXXXXX---------XQYPG------FNPSMLASML--------QQPRQPA 325
           L                        Q PG      F+P+ML+++L        QQP    
Sbjct: 273 LLAGQAAAPGGASAPANPFLSMLGQQAPGAGGLPAFDPAMLSALLGGAGNNASQQP---- 328

Query: 326 QEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377
            +DTRPPE RYE QLRQLNDMGFFEFDRN+AALRRSGGSVQGALDALLN DV
Sbjct: 329 -QDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  346 bits (887), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 235/381 (61%), Gaps = 17/381 (4%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M+ISV IKSGQN WDV +E S+TI +FK+ I+  S+IPA NQRLIYSGKILKD +T+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KIQDGHSIH+VKSG                             + +++G+ +GFNPL+DL
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGS---SGMSTGRGSGFNPLSDL 117

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           TSARYAGY   +PSADMFGPDGG     +QDDML MLENPVFQSQMNEMLSNP++V+++I
Sbjct: 118 TSARYAGYT-NLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLI 176

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
           NSNPQLQ+LGPQAR MFQSP FRQMLTNPDMIRQSM MA+MM              SSFP
Sbjct: 177 NSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASA-----SSFP 231

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXGMNPFAGLXXXXXXX 296
           APG+++T +                                      NPFA L       
Sbjct: 232 APGDSTTTTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSMNP 291

Query: 297 XXXXXXXXQYPG--FNP--SMLASMLQQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFD 352
                         FNP     A     P     ED RPPE RYE QLRQLNDMGFF+FD
Sbjct: 292 YAALGGGNGNANNMFNPAAFAQALQAAAPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFD 351

Query: 353 RNIAALRRSGGSVQGALDALL 373
           +N+AALRRSGGSVQGA++ALL
Sbjct: 352 KNVAALRRSGGSVQGAVNALL 372

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  332 bits (851), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 233/378 (61%), Gaps = 34/378 (8%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M+I +Q+KSGQN+W+V+VE S ++ E K+ I+K S+IPA NQRLIYSGKILKD +TVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADL 120
           KI DGH+IHLVKS                            VP++I++GQ+ GFNPLADL
Sbjct: 61  KIADGHAIHLVKS---GGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADL 117

Query: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           T ARYAGY   +PS DMFGPDGG+ +   Q++++ MLENP+FQSQMNEML+NPQM++++I
Sbjct: 118 TGARYAGYT-NLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLI 176

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXDSSFP 240
             +P LQA+GP AREM QSPFFRQMLTNPD+IRQ   M+R+               + FP
Sbjct: 177 QQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ---MSRL---QMGMGGAGAEQGTDFP 230

Query: 241 APGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXXXXXXXXXXX 300
           APG  +T                                  G+ P A             
Sbjct: 231 APGSAATPD-------------------AAAPAPNPLAAILGLQPGAA----NPLGAAPA 267

Query: 301 XXXXQYPGFNPSMLASML-QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALR 359
                 P  +P+ML+S+       PA  D RPPE RYE QLRQLNDMGFF+FDRN+AALR
Sbjct: 268 DRGLAMPPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALR 327

Query: 360 RSGGSVQGALDALLNNDV 377
           R+GGSVQGALDALLN DV
Sbjct: 328 RAGGSVQGALDALLNGDV 345

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  324 bits (831), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/390 (49%), Positives = 237/390 (60%), Gaps = 36/390 (9%)

Query: 1   MSISVQIKSGQNKWDVAV--EPS-NTILEFKEIISKASDIPAGNQRLIYSGKILKDAETV 57
           M I+V +K GQN+WDVAV  EP   T+ +FKE+++  + +P  NQRLIYSGKILKDA+T+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPL 117
           E YKI DGH++HLVKSG                              ++ +GQ  GFNPL
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAG-ASMAAGQQPGFNPL 119

Query: 118 ADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQ------DDMLSMLENPVFQSQMNEMLS 171
           ADLTSARYAGYNLPMPSADMFGPDGG+T+          +++LSMLENP+FQSQMNEM S
Sbjct: 120 ADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFS 179

Query: 172 NPQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXX 231
           NPQMV+++I SNPQLQA+GPQAREM QSP FRQMLTNPDM+RQSM+ ++MM         
Sbjct: 180 NPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGG 239

Query: 232 XXXXDSSFPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPFAGLXX 291
                ++FPAPG   T +                                G NPF+ L  
Sbjct: 240 ADP--NAFPAPGGDDTGA------------------PTNTSTNASAAGPAGANPFSSLFG 279

Query: 292 XXXXXXXXXXXXXQYPGFNPSMLASMLQQ----PRQPAQEDTRPPEVRYESQLRQLNDMG 347
                          PGF+ +     + +        A +DTRPPE RYE QLRQLNDMG
Sbjct: 280 GAPAPAAQPFQSA--PGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMG 337

Query: 348 FFEFDRNIAALRRSGGSVQGALDALLNNDV 377
           F +FDRN+AALRR+GGS+QGALDALLN DV
Sbjct: 338 FSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 231/414 (55%), Gaps = 45/414 (10%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           MSIS+ +KSGQNKW V+ +PS++I   K+ I++ S IPA NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHLVKSGD--------XXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTN 112
           KI DGHSIHLV+SG                                   VP NIT+GQ  
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 113 GFNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSN 172
           GFNPLADLT ARYAGY   +PS DMFGPDGG+ +   Q+++L ML+NP+FQSQ+NEML+N
Sbjct: 121 GFNPLADLTGARYAGY-ANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLAN 179

Query: 173 PQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXX 232
           PQM++++I  +P LQA+GP AREM QSPFFRQM+TNPD+IRQ       M          
Sbjct: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQST-- 237

Query: 233 XXXDSSFPAPGETSTESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNPF------ 286
               + FPAPG  +  +                                  NPF      
Sbjct: 238 ----NDFPAPGSANNSATTSGDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPFAAMFAP 293

Query: 287 -----------AGLXXXXXXXXXXXXXXXQYP--GF-----NPSMLASMLQ-----QPRQ 323
                      AG                Q P  GF     +P+ML+++L        RQ
Sbjct: 294 PANSGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQ 353

Query: 324 PAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377
              ED RPPE RY+ QL QLN+MGF +FDRN+AALRRSGGSVQGAL+ALLN DV
Sbjct: 354 -QTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  284 bits (727), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 175/246 (71%), Gaps = 11/246 (4%)

Query: 2   SISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61
           +IS+ IKSGQN W V+++ + +I   K+ I+K S+IPA NQRLIYSGKILKD + V+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IQDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADLT 121
           IQDGHS+HLV+SG                           VP+NI++GQT GFNPLADLT
Sbjct: 63  IQDGHSVHLVRSG-------KKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLT 115

Query: 122 SARYAGYNLPMPSADMFGPDGGMT-NMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180
           SARYAGYNL +PSAD FGPDGGM  +  N D+ LSML+NP+ QSQMNEMLSNPQM+++MI
Sbjct: 116 SARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI 175

Query: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMXXXXXXXXXXXXXD---S 237
            SNPQLQA+GPQAR+MFQSP FRQMLTNPDMIRQSM++A MM             D   S
Sbjct: 176 QSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAAS 235

Query: 238 SFPAPG 243
           SFPAPG
Sbjct: 236 SFPAPG 241

 Score =  103 bits (257), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 50/75 (66%), Positives = 60/75 (80%), Gaps = 4/75 (5%)

Query: 307 PGFNPSMLASMLQQPRQPA----QEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSG 362
           P F+PSM AS+      P+    Q+DTRPPE RYE+QLRQLNDMGFF+FDRNIAALRR+G
Sbjct: 330 PPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTG 389

Query: 363 GSVQGALDALLNNDV 377
           GSV+ A++ALLN DV
Sbjct: 390 GSVEAAVNALLNGDV 404

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 96/221 (43%), Gaps = 16/221 (7%)

Query: 3   ISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKI 62
           ISV IK  + K+ +  E    I +    I    DIP  NQRLIYSG+IL   +T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDGHSIHLVKSGDXXXXXXXXXXXXXXXXXXXXXXXXXXVPTNITSGQTNGFNPLADLTS 122
           +DGH I ++   +                           P N  S    G   +  +T+
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPIN--SPTPFGEGNIITITT 119

Query: 123 ARYAGYNLPMPSADMFGPDGGMTNMPN-QDDMLSMLENPVFQSQMNEMLSNPQ-MVEYMI 180
                      S D +G      + P  + ++L +L++P    Q NEML N Q ++ ++I
Sbjct: 120 T----------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLI 168

Query: 181 NSNPQLQALGPQ-AREMFQSPFFRQMLTNPDMIRQSMEMAR 220
            +NP L+ +    AR++ + P  ++   + + + Q + + R
Sbjct: 169 QTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M + V+  +G+ +  V ++ S+ +   KE++ +   IP   QRLI+ GK + D +TV+S 
Sbjct: 1  MYVKVKTLTGK-EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSA 59

Query: 61 KIQDGHSIHLV 71
          K+ DG  +HLV
Sbjct: 60 KLTDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+ +  + V+ S+ +   K+++ +   IP   QRLI+ GK + D +TVES 
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KIQDGHSIHLV 71
           + DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 48.1 bits (113), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M + V+  +G+ +  V V+ S T+   KE++ +   IP   Q+LI+ GK + D  T+ S 
Sbjct: 1  MQLKVKTLTGK-EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 KIQDGHSIHLV 71
           +QDG  +HLV
Sbjct: 60 DLQDGSLLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+ +  V V   + +   KE++ +   IPA  QRLI+ GK + + +T+ + 
Sbjct: 1  MIIKVKTLTGK-EIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTA 59

Query: 61 KIQDGHSIHLV 71
          K+ DG  +HLV
Sbjct: 60 KLSDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 1  MSISVQIKSGQNKWDVAVEPS--NTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVE 58
          M I V+  +G+   ++AVE +  + I   KE++ +   IP   QRLI+ GK + D +TV 
Sbjct: 1  MIIKVKTLTGK---EIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVS 57

Query: 59 SYKIQDGHSIHLV 71
          S K+ DG  +HLV
Sbjct: 58 SAKLVDGMQLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 18 VEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHLV 71
          VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y IQ   ++HLV
Sbjct: 14 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 18 VEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHLV 71
          VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y IQ   ++HLV
Sbjct: 14 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 18 VEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHLV 71
          VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y IQ   ++HLV
Sbjct: 13 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNT--ILEFKEIISKASDIPAGNQRLIYSGKILKDAETVE 58
          M I V+  +G+   ++AVE  +   I   K+++ +   IP   QRLI+ GK + D +T+E
Sbjct: 1  MIIKVKTLTGK---EIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLE 57

Query: 59 SYKIQDGHSIHLV 71
          + K+ DG  +HLV
Sbjct: 58 AAKLVDGMVLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +EPSNTIL+ K  +++A        ++IYSGK+L+D +TVE  ++++G  I
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 44.7 bits (104), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 18 VEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHLV 71
          VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y IQ   ++HLV
Sbjct: 3  VEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +EPSNTI E K  ++++S       +LIYSGK+L+D++TV    ++DG  +
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M ++V+  +G+ +  V V+P + +   KE + +   IP   QRLI+ GK + D ++V S 
Sbjct: 1  MKLTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KIQDGHSIHLV 71
           +  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M + V+  +G+ +  +++E    +   KE++ +   IP   QRLI+ GK ++D +TV+S 
Sbjct: 1  MELKVKTLTGK-EIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSA 59

Query: 61 KIQDGHSIHLV 71
           +  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+ +  V ++ ++ +   KE++ +   IP   QRLI+ GK + D +TV S 
Sbjct: 1  MIIKVKTLTGK-EIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSA 59

Query: 61 KIQDGHSIHLV 71
           + DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +EPSNTI E K  +++++       +LIYSGK+L+D++TV    ++DG  +
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +EPSNTILE K  ++++        +LIYSGK+L+D++TV    ++DG  +
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 16 VAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHLV 71
          + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y IQ   ++HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 105 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 164 NIQKESTLHLV 174

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 181 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 240 NIQKESTLHLV 250

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 257 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 316 NIQKESTLHLV 326

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 333 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 392 NIQKESTLHLV 402

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 1  MSISVQIKS-GQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVES 59
          M+I++  K   + +  + + PS TI E K+++++A        ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIQDGHSI 68
           K++DG  +
Sbjct: 61 CKLKDGDQV 69

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +EPSNTI E K  ++++        +LIYSGK+L+D++TV    ++DG  +
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++ K L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 440 NIQKESTLHLV 450

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 516 NIQKESTLHLV 526

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 214 NIQKESTLHLV 224

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 290 NIQKESTLHLV 300

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 368 NIQKESTLHLV 378

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 444 NIQKESTLHLV 454

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHLV 71
           IQ   ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDGHSIHLV 71
            IQ   ++HLV
Sbjct: 516 NIQKESTLHLV 526

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 3  ISVQIKS-GQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61
          +SV  K+  + K+ + +E S +I+  KE +S+         +LI+SGK+LKD ++VES  
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 62 IQDGHSIHLVKSG 74
           +DG+ +  + S 
Sbjct: 62 FKDGNEVIFMVSA 74

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M I V+  +G+ +  V +  +  +   KE++ +   IP   QRLI+ GK + D ++V S 
Sbjct: 1  MIIKVKTLTGK-EIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSA 59

Query: 61 KIQDGHSIHLV 71
           + DG  +HLV
Sbjct: 60 NLVDGMQLHLV 70

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 37/58 (63%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  +A+E +NT+L+ K  +++         +LIYSGK+L+DA+T+E   ++DG  +
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60
          M + V+  +G+ +  V ++ S+ +   KE++ +   IP   QRLI+ GK + D  TV   
Sbjct: 1  MIVKVKTLTGK-EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDA 59

Query: 61 KIQDGHSIHLV 71
           + +G  +HLV
Sbjct: 60 HLVEGMQLHLV 70

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 18  VEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHLV 71
           VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y IQ   ++HLV
Sbjct: 76  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 129

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 1  MSISVQIKS-GQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVES 59
          M I++  K   + K  + + P+ TI E K++++K         ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIQDGHSI 68
           K++DG  +
Sbjct: 61 CKLKDGDQV 69

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 37/58 (63%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + ++P++T+L+ K+ ++          +LI+SGK+L+D +T+E  K++DG  +
Sbjct: 11 KEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQV 68

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 16 VAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + +E S+T+ E K+ +++  +      +LIYSGKIL+D  T+  YK++DG  +
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 16 VAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + ++  +TI E K+ +++  D      +LIYSGKIL+D  T+  YK+ DG  +
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 323 QPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           Q   +D R  E  Y  Q+RQL +MGF + ++N+ AL++S G++  A+D L
Sbjct: 178 QEVSDDDRY-ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHL 70
          + K  V +E S+TIL+ K  ++          +LI+SGK+LKD +TV S  ++D   + +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 VKS 73
          + S
Sbjct: 70 MIS 72

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNND 376
           +Y  QLR L DMGF + D N+ AL    G++   ++ L +N+
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           +Y  QL++LNDMGF   D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           +Y  +LRQL ++GF    +NI A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +  S+T+L  K+ +++  +      +LIYSGK+L+D+ ++E   ++DG  +
Sbjct: 11 KQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + +    TI   KE+I++     A   +LIY+GKIL+D +TV    +++G  +
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 3  ISVQIKS-GQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61
          +S+  K   + K  + ++ S+++L+ K  +++  +   G  +LIYSGK+L+D+++++   
Sbjct: 2  VSITFKDFKKEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESG 61

Query: 62 IQDGHSI 68
          ++DG  +
Sbjct: 62 LKDGDQV 68

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 33.5 bits (75), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 26 EFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHL 70
          +FK+I+S     PA   +L+  G ILKD  +++ Y+I D   + L
Sbjct: 26 DFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHDNTFLEL 70

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%)

Query: 11 QNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSI 68
          + K  + ++PS+++ + K  ++          +LIYSGK+L+DA+ ++   ++DG  +
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 32.7 bits (73), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGK 49
          M ++V+  +G+ +  V V+PS+ +   KE + +   IP   Q+LI+ GK
Sbjct: 1  MKLTVKTLTGK-EIAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261
          bp, 86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 33.5 bits (75), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAE 55
          M + V+  +G+ +  V ++ S+ +   KE++ +   IP   QRLI+ GK + DA+
Sbjct: 1  MIVKVKTLTGK-EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVDAK 54

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           +Y  +LR+L +MGF + D N  AL  + G + GA+D L
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDIL 203

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 3  ISVQIKS-GQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61
          +S+  K   + K  + +E S T+L+ K+ I+   D      +LIYSGK+L++  T+    
Sbjct: 2  VSITFKDFKKEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCG 61

Query: 62 IQDGHSI 68
          ++DG  +
Sbjct: 62 LKDGDQV 68

>Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON}
          similar to Ashbya gossypii AER266C
          Length = 73

 Score = 32.7 bits (73), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 20 PSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHL 70
          P++TI +FK+++S           L   G  LKD  T+E Y+I DG ++ L
Sbjct: 20 PTDTIGDFKKVLSIQLGSSHNKLVLQKGGSSLKDLITLEDYEIHDGTNLEL 70

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           RY  QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           RY  QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 31.6 bits (70), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 16 VAVEPSNTILEFKEIISKASDIPAGNQRLIYSGK 49
          + VEP + +   KE++ +   IP   QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           R+  QLR L ++G+ + D N+ AL  + G +  ALD L
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALDIL 221

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 7  IKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAET-VESYKIQDG 65
           K  +   DV +E   ++ + KE ++ A D  A   +LI+SGK+L+DA+   E+   ++ 
Sbjct: 9  FKKNKETLDVDLE-HESVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAETGLKEND 67

Query: 66 HSIHLV 71
          H I +V
Sbjct: 68 HVIMMV 73

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           RY  +LR L +MG+ + D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           RY  QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1 Ubiquitin-like protein modifier
          Length = 74

 Score = 30.8 bits (68), Expect = 0.92,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 13 KWDVAVEPSNTILEFKEIIS-KASDIPAGNQRLIYSGKILKDAETVESYKIQDGHSIHL 70
          K +V     +T+ +FK+++S +     A    L   G +LKD  T+E Y++ DG ++ L
Sbjct: 13 KVNVKCLSEDTVGDFKKVLSVQLGTASASKIVLQKGGSVLKDHITLEDYEVHDGTNLEL 71

>KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694)
          [174 bp, 57 aa] {ON} Anc_8.311 YDR139C
          Length = 57

 Score = 29.6 bits (65), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 1  MSISVQIKSGQNKWDVAVE--PSNTILEFKEIISKASDIPAGNQRLIYSGK 49
          M I V+  +G+   ++AVE   ++ I   KE++ +   IP   QRLI+ GK
Sbjct: 1  MFIKVKTLTGK---EIAVELDENDRIYHIKELLEEKEGIPPSQQRLIFQGK 48

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 29.3 bits (64), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGK 49
          M + V+  +G+ +  + V P + +   KE++ +   IP   QRLI+ GK
Sbjct: 1  MLLKVKTLTGK-EIQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300
          bp, 100 aa] {ON} YDR139C (REAL)
          Length = 100

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGK 49
          M + V+  +G+ +  V +  S+ +   KE++ +   IP   QRLI+ GK
Sbjct: 1  MIVKVKTLTGK-EISVELRESDLVYHIKELLEEKEGIPPSQQRLIFQGK 48

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 327 EDTRPPEVRYESQLRQLNDMGFFEFDRNIA-ALRRSGGSVQGALDAL 372
            D+R    +Y  QL +L DMG+    + I  AL R+ G +  +LD +
Sbjct: 190 HDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDAL 372
           RY  QL +L DMG+ +  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,266,667
Number of extensions: 1079128
Number of successful extensions: 2732
Number of sequences better than 10.0: 164
Number of HSP's gapped: 2743
Number of HSP's successfully gapped: 254
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)