Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0I002008.831ON1049104950530.0
NCAS0B011108.831ON993113310141e-120
Smik_13.258.831ON94910289541e-112
Skud_13.328.831ON94810169421e-110
Suva_13.358.831ON9828148771e-101
Kpol_1069.28.831ON10014405852e-61
KNAG0G033708.831ON10765705674e-59
TDEL0B006608.831ON9594865592e-58
NDAI0E003508.831ON11634165364e-55
ZYRO0G13992g8.831ON12111635062e-51
KAFR0A027708.831ON8842565012e-51
YML109W (ZDS2)8.831ON9421654961e-50
Kwal_27.103188.831ON9254414907e-50
SAKL0D01716g8.831ON9424564881e-49
KLTH0C04048g8.831ON9354364782e-48
KLLA0D01683g8.831ON944994765e-48
Ecym_27108.831ON8961114657e-47
Kpol_541.108.831ON10561074661e-46
AAL185W8.831ON1018994623e-46
Skud_13.4458.831ON8981004604e-46
CAGL0J06688g8.831ON8282274541e-45
Suva_13.4618.831ON931984551e-45
Smik_13.4868.831ON923974515e-45
YMR273C (ZDS1)8.831ON915984505e-45
CAGL0F03421g8.831ON8171684254e-42
KAFR0B038608.831ON8431094211e-41
TPHA0C047208.831ON10722064213e-41
TBLA0B032008.831ON10861254161e-40
TBLA0D031908.831ON16821764127e-40
Kpol_1030.33singletonOFF137967763.1
Kpol_YGOB_1030.337.380ON137667763.1
Suva_8.2518.604ON829128736.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0I00200
         (1049 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...  1951   0.0  
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   395   e-120
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   372   e-112
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   367   e-110
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   342   e-101
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   229   2e-61
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   223   4e-59
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   219   2e-58
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   211   4e-55
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   199   2e-51
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   197   2e-51
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   195   1e-50
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   193   7e-50
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   192   1e-49
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   188   2e-48
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   187   5e-48
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   183   7e-47
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   184   1e-46
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   182   3e-46
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   181   4e-46
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   179   1e-45
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   179   1e-45
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   178   5e-45
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   177   5e-45
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   168   4e-42
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   166   1e-41
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   166   3e-41
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   164   1e-40
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   163   7e-40
Kpol_1030.33 s1030 (68892..73031) [4140 bp, 1379 aa] {OFF} (6889...    34   3.1  
Kpol_YGOB_1030.33 s1030 (68901..73031) [4131 bp, 1376 aa] {ON} A...    34   3.1  
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    33   6.1  

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1049

 Score = 1951 bits (5053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 972/1049 (92%), Positives = 972/1049 (92%)

Query: 1    MSYKNETLRACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGX 60
            MSYKNETLRACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMG 
Sbjct: 1    MSYKNETLRACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGS 60

Query: 61   XXXXXXXXXXXXXXXXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLA 120
                             LRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLA
Sbjct: 61   TNDSNSNTNTNTNTKKNLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLA 120

Query: 121  NDNSFDKTGIEYLHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHS 180
            NDNSFDKTGIEYLHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHS
Sbjct: 121  NDNSFDKTGIEYLHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHS 180

Query: 181  LNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXX 240
            LNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQD          
Sbjct: 181  LNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDTLQNINLNLN 240

Query: 241  XXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHD 300
                 VEDTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHD
Sbjct: 241  ETQNNVEDTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHD 300

Query: 301  ALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAG 360
            ALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAG
Sbjct: 301  ALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAG 360

Query: 361  LSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRN 420
            LSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRN
Sbjct: 361  LSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRN 420

Query: 421  GITMPTRSLRRSKFNTYKIRNPSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDV 480
            GITMPTRSLRRSKFNTYKIRNPSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDV
Sbjct: 421  GITMPTRSLRRSKFNTYKIRNPSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDV 480

Query: 481  LRESAPLTFETISEEQVQDKXXXXXXXXXXXXXXXXXXXXXXHLSFSQGNITQSSDSSND 540
            LRESAPLTFETISEEQVQDK                      HLSFSQGNITQSSDSSND
Sbjct: 481  LRESAPLTFETISEEQVQDKSLDAIDILDKSLDISDKDFDSSHLSFSQGNITQSSDSSND 540

Query: 541  SVLVRPAYSHSIIQEKLDTDRGGDLEFSSNKFSETLFAKESDIQDDPDFVNLSIPERTKS 600
            SVLVRPAYSHSIIQEKLDTDRGGDLEFSSNKFSETLFAKESDIQDDPDFVNLSIPERTKS
Sbjct: 541  SVLVRPAYSHSIIQEKLDTDRGGDLEFSSNKFSETLFAKESDIQDDPDFVNLSIPERTKS 600

Query: 601  QRVRAEKSNHSKHRHSPIITISEETPFKINNKKQLSQPLLNESEINKGDHGSIIPENLXX 660
            QRVRAEKSNHSKHRHSPIITISEETPFKINNKKQLSQPLLNESEINKGDHGSIIPENL  
Sbjct: 601  QRVRAEKSNHSKHRHSPIITISEETPFKINNKKQLSQPLLNESEINKGDHGSIIPENLKH 660

Query: 661  XXXXXXXXXXXXXPSTNKKQRFDKKIVSIFKRKSSKTSNNEIKNEKKTVLSQEDKRIMXX 720
                         PSTNKKQRFDKKIVSIFKRKSSKTSNNEIKNEKKTVLSQEDKRIM  
Sbjct: 661  KASVKEASSKEKEPSTNKKQRFDKKIVSIFKRKSSKTSNNEIKNEKKTVLSQEDKRIMSS 720

Query: 721  XXXXXTKQDISAAELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIA 780
                 TKQDISAAELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIA
Sbjct: 721  SSSKSTKQDISAAELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIA 780

Query: 781  NTSYEDKLNSSYDENAEDSFSYLEESLETQNSLQPAVCITSNRADVVVTETVDELSDGDD 840
            NTSYEDKLNSSYDENAEDSFSYLEESLETQNSLQPAVCITSNRADVVVTETVDELSDGDD
Sbjct: 781  NTSYEDKLNSSYDENAEDSFSYLEESLETQNSLQPAVCITSNRADVVVTETVDELSDGDD 840

Query: 841  SQDITGGEFYTDNTQVNTINTSYETSYNSTRIVEQEANTLPESSLPARKLTFKDVVKPER 900
            SQDITGGEFYTDNTQVNTINTSYETSYNSTRIVEQEANTLPESSLPARKLTFKDVVKPER
Sbjct: 841  SQDITGGEFYTDNTQVNTINTSYETSYNSTRIVEQEANTLPESSLPARKLTFKDVVKPER 900

Query: 901  PNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILL 960
            PNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILL
Sbjct: 901  PNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILL 960

Query: 961  SNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNTGS 1020
            SNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNTGS
Sbjct: 961  SNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNTGS 1020

Query: 1021 DYLNNDVTNDYHTERNAADGSICIPDLSE 1049
            DYLNNDVTNDYHTERNAADGSICIPDLSE
Sbjct: 1021 DYLNNDVTNDYHTERNAADGSICIPDLSE 1049

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
            Anc_8.831 YML109W
          Length = 993

 Score =  395 bits (1014), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 369/1133 (32%), Positives = 538/1133 (47%), Gaps = 255/1133 (22%)

Query: 12   TVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXX 71
            T  +KRKS VLIAAQSLD EVQ+VK LKRLS+GSMDLL+DPE E+ +             
Sbjct: 19   TQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNNDKSNQSTPIGS 78

Query: 72   XXXXXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIE 131
                      R  +N   + E E +EN           D +S ++     D+S + T  E
Sbjct: 79   YE--------RSNENLEQINEPEDNEN-----------DESSVSI-----DDSIELTQTE 114

Query: 132  YLHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRGNSKQLKP 191
            YLH+         + N     EEP        SH       R +SG  SL R  S   K 
Sbjct: 115  YLHD-----ASVPQTNRTVTPEEP--------SH-------RSMSGAGSLKRNGSSISKR 154

Query: 192  KI-----------------------------QNKQTETEDQITQNLLWVPANKHPGVKPE 222
            K+                              N  + + D +T+NLLWVPAN+HP VKPE
Sbjct: 155  KLPFISTGMSAAPTSHLSPSSTSTSSSSSSSSNSASSSPDDLTKNLLWVPANQHPNVKPE 214

Query: 223  NYVELLQDXXXXXXXXXXXXX------------XXVEDTSNKTSDKMVMDREVIRRRRIS 270
            NY+EL+QD                           ++ + +  S++  +DR      +  
Sbjct: 215  NYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISKSNMSEEEPIDRHPQSLDKTF 274

Query: 271  QDLNRNHSSLVRRPTGLRISYSESVEE-FHDALESENSLN----SDKEREPSL--SQNSI 323
             ++   + SLVRRP+ LR SY+E  E+ + ++ ESE   N    S +E +P L   +N +
Sbjct: 275  LEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAKTNESQLSSREEKPFLFNDRNGL 334

Query: 324  SMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTD 383
            + +             +   SLKDITEELT ISNKAGL++SDAI+LAR+LS+A S S  D
Sbjct: 335  NQL---------RNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTLSMASSFS--D 383

Query: 384  NSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTRS-LRRSKFNTYKIRN- 441
             +V  NL  +   N+ N+       E+ +ASN+ ++NG+T+P RS LRRSKFNTY+IR+ 
Sbjct: 384  GNV--NLGKSKLQNESNE-------ESEFASNMFMKNGLTIPERSSLRRSKFNTYRIRST 434

Query: 442  --------PSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDVLRESAPLTFETIS 493
                     +  +L+ S  ++ E  + ++  S     SF    +      S+P +   + 
Sbjct: 435  SSSTSTREKTSPLLQSSSFARQEADTDDLQRS---PVSFTNRDSYLATTTSSPGSISDLY 491

Query: 494  EEQVQDKXXXXXXXXXXXXXXXXXXXXXXHLSFSQGNITQSSDSSNDSVLVRPAYSHSII 553
            +   QD                       H S SQ +   S++SSNDS+LV+P  S S+I
Sbjct: 492  D-HYQDNAESKQGNDNDNEARQGDLS---HASISQESSFLSNESSNDSILVKPLGSKSMI 547

Query: 554  QEKLDTDRGGDLEFSSNKFSETLFAKESDIQDDPDFVNLSIPERTKSQRVR---AEKSNH 610
             E LD  +  D +       +  + K S +       N +IP+ ++S+  R   +   N 
Sbjct: 548  HENLDNGQDHDDD-------QPAYQKVSKL-------NPTIPDTSRSKHKRNGWSWSGNR 593

Query: 611  SKHRHSPIITIS----EETPFKINNKKQLSQPLLNESEINKGDHGSIIPENLXXXXXXXX 666
            +       + ++    ++T +     K   +P+L  S     DH  I  E          
Sbjct: 594  ANSEEDATVLVNSQDEDQTGYTDQKSKSRHRPILARSR----DHLKINKE---------- 639

Query: 667  XXXXXXXPSTNKKQRFDKKIVSIFKRKSSKTSNNEIK-----------------NEKKTV 709
                     ++K++  +K+ V +F+RK     N +                   ++K  V
Sbjct: 640  ---AELPKESHKRETIEKRFVKLFRRKGHDNGNKQQVLKKKSSSSTLSKFQKQISKKNQV 696

Query: 710  LSQEDKRIMXXXXXXXTKQDISAAELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQS 769
             ++E K I          ++I     Q  +  D LR      LS  + P  V+  +    
Sbjct: 697  TTEEPKEITVEVQE---PEEILEDTNQGTNRQDPLR------LSTPIIPQPVHSIIS--- 744

Query: 770  NSLDSKPIEIANTSYEDKLNSSYDENAEDSFSYLEESLETQNSLQPAVCITSNR---ADV 826
               D+ PI   + +  +K       + +D      E++E   SLQPAV +TS +      
Sbjct: 745  ---DTTPIADGDHALSNK-------DTDD------EAIEALPSLQPAVSVTSTKNVHLSA 788

Query: 827  VVTETVDELSDGDDSQDITGGEFYT--DNTQV---NTINTSYETSYNSTRIVEQEANTLP 881
             + ETV EL + DDSQDI+GG+  T  DN+ +   N +N+S   S  ++       NT+ 
Sbjct: 789  SIVETVRELGE-DDSQDISGGDLSTEVDNSMLAERNVMNSSDLQSIENSSDDINTGNTI- 846

Query: 882  ESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYR 941
            E  LPARKLTF DV +P+RPN P++FTDSAFGFPLP LT STVIMFDHRL +NVERAIYR
Sbjct: 847  EHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYR 906

Query: 942  LSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEV 1001
            LSHLKLSD KRELR+Q+LLSNFMYAYL+LVNH+LY+EQ  QQ             ++ +V
Sbjct: 907  LSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQE------------TMEDV 954

Query: 1002 AYLDDSFTYSKQTKNNTGSDYLNNDV-------TNDYHTERNAADGSICIPDL 1047
            A               TG+D +++D+       T  Y TE+N A+G+I IP++
Sbjct: 955  AI--------------TGTDVIDSDIHESSSYGTGVYTTEQNNANGTILIPEI 993

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  372 bits (954), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 346/1028 (33%), Positives = 494/1028 (48%), Gaps = 219/1028 (21%)

Query: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXX 74
           EKRKS V IAA+SLD E+QNVK LKRLS+GSMDL++DPE E+ +                
Sbjct: 47  EKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 106

Query: 75  XXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIEYLH 134
                +  +          E ++ Y++        + T+A       D+S D T  EYLH
Sbjct: 107 ESLCEEDVIQPKQEEEKRGEDNDAYEE-------GEATNA-------DDSIDITQTEYLH 152

Query: 135 NEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLR-----RGLSGVHSLNRGNSKQL 189
           +E+            TL +E    +  + +  + S  R     R LSGV +L       +
Sbjct: 153 DEE------------TLEKE----KIFYNAPSSTSSARVTCRNRRLSGVKALAHD---AV 193

Query: 190 KPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDT 249
              + + +++T D  TQNLLWVPAN+HP VKPENY+EL+QD                ED+
Sbjct: 194 LEAMDDHESKTVD-FTQNLLWVPANQHPNVKPENYLELIQDTLQNIQISTD------EDS 246

Query: 250 SNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLN 309
              T +  V +  VI  R+ S        S+VRRP+ L+ SY++  +E   A + E    
Sbjct: 247 GESTLE--VGNNHVILNRKSS-------GSIVRRPSRLKTSYTKFDDEISVADKPEVGQE 297

Query: 310 SDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISL 369
              +R PS    +I  +                 SLK+ITEELTKISN AGL+ S+A++L
Sbjct: 298 QVNKRIPSSEVRTIRSV-----------------SLKEITEELTKISNNAGLTGSNAVTL 340

Query: 370 ARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTRS- 428
           ARSLS++GS +  +N +   L+S    ND           + +ASN+   +G T+P RS 
Sbjct: 341 ARSLSMSGSFT-NENLL---LKSNDAEND-----------SEFASNMFNESGRTIPERSS 385

Query: 429 LRRSKFNTYKIRNPSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDVLRESAPLT 488
           LRRSKFNTYKIR      LE S +    P + N+    N  +S D   T      S+P  
Sbjct: 386 LRRSKFNTYKIR------LEGSGL----PQAANLKNLMNMRTSDDRRST------SSPAC 429

Query: 489 FETISEEQ--------VQDKXXXXXXXXXXXXXXXXXX-----------XXXXHLSFSQG 529
           +  + +EQ        + D                                  H S SQ 
Sbjct: 430 YARLPQEQGSLNDFQEIFDHYRRTSTDWSTDWSTENAKYDDSPNYHSDEEDLTHASISQD 489

Query: 530 NITQSSDSSNDSVLVRPAYSHSIIQEKLDTDRGGDLEFSSNKFSETLFAKES-------- 581
           +   S+DSSN+SVLV+P  + S+I E+LD       E  +N  SE               
Sbjct: 490 SSLLSTDSSNNSVLVKPHNAGSMISERLDQQHVSSREDENNNISEPSHGWSWLNYSNENL 549

Query: 582 -----------DIQDD--------PDFVNLSIPERTKSQRVRAEKSNHSKHRHSPIITI- 621
                      D QDD         DFVNLS+  RTKS +  +E+ NHSK+RHSPI  + 
Sbjct: 550 NNNDNTHEQFIDDQDDDGCVENEKADFVNLSVSRRTKSTKRASERINHSKNRHSPIFQVR 609

Query: 622 SEETPFKINNKKQLSQPLLNESEINKGDHGSIIPENLXXXXXXXXXXXXXXXPSTNKKQR 681
           S+E+   I     ++ P+L+ S     D     P  L                +T+KK+ 
Sbjct: 610 SDESKSPI-----ITPPVLSSSSSQSSD-----PTVLSVTEKKLESPNDDKT-NTHKKKS 658

Query: 682 FDKKIVSIFKRKSSKTSNNEIKNEKKTVLSQEDKRIMXXXXXXXTKQDISAAELQSDHLD 741
            +K++  +FKR+            +++  S+ D +++        K+  S + L      
Sbjct: 659 LEKRLAGLFKRR------------QQSGPSKSDVKVIKKSVRKELKKKASHSGLSK---- 702

Query: 742 DSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSSYDENAEDSFS 801
              R   ++   E+    +VN           S P+E  +T               D+ S
Sbjct: 703 --FRKSPKKKFKEA----KVN-------QECPSPPVETDSTG------------DVDTES 737

Query: 802 YLEESLETQNSLQPAVCITSNR----ADVVVTETVDELSDGDDSQDITGGEFYTDNTQVN 857
            ++ +++  N+      I S+R    +   V ET+ EL DGDDS DI+G +    N +V+
Sbjct: 738 TIQSTIQNPNT----STILSDRNISHSSEFVVETISEL-DGDDSFDISGNDINY-NVEVH 791

Query: 858 TINTSYETSYNSTRIVEQEANTL---PESSLP---ARKLTFKDVVKPERPNGPMEFTDSA 911
           + N   +T+  S   +EQ+  ++   PE+  P    RKLTF DVVKP+ PN P++FTDSA
Sbjct: 792 S-NIDRDTAAGSDDSIEQQEESIIPSPETQTPNLIPRKLTFGDVVKPKYPNAPIKFTDSA 850

Query: 912 FGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLV 971
           FGFPLP +T STVIMFDHRL +NVERAIYRLSHLKLSDP RELR+Q+LLSNFMY+YL+LV
Sbjct: 851 FGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLV 910

Query: 972 NHSLYIEQ 979
           NH+LY+EQ
Sbjct: 911 NHTLYMEQ 918

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  367 bits (942), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 342/1016 (33%), Positives = 480/1016 (47%), Gaps = 200/1016 (19%)

Query: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXX 74
           EKRKS VLIAA+SLD E+QNVK LKRLS+GSMDL+ DPE E+ +                
Sbjct: 51  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKL-----SSRNSYSSDSS 105

Query: 75  XXXLRKSRLFDNDNSLMECEVSENY--DDIANLDSTSDLTSANVSDLANDNSFDKTGIEY 132
              L++S L   +   +E E+ E    DD+   D   D T+A       D+S D T  EY
Sbjct: 106 KESLQES-LHGEEIKQLEQEIEERGQDDDVYEED---DATNA-------DDSIDITQTEY 154

Query: 133 LHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLR-RGLSGVHSLNRGNSKQLKP 191
           LH+E+            TL +E    ++   S       R R LSGV S           
Sbjct: 155 LHDEE------------TLEKERISRKASSTSFPARVTSRNRRLSGVKSFPHDEVLD--- 199

Query: 192 KIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSN 251
            + +         TQNLLWVPAN+HP VKPENY+EL+QD                     
Sbjct: 200 -VVDSHDSNAVNFTQNLLWVPANQHPNVKPENYLELIQDTLQNI---------------- 242

Query: 252 KTSDKMVMDREVIRRRRISQDLNRNHS--------SLVRRPTGLRISYSESVEEFHDALE 303
               ++ +D+E    +    +L  NH+        S+VR P+ L+ SYS+  +E   A +
Sbjct: 243 ----QISVDQEFDESKL---ELGNNHAFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQ 295

Query: 304 SENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSN 363
            +      + R PS    S+  +                 SLK+ITEELTKISN AGL++
Sbjct: 296 PQQEQEQVERRIPSSEFKSMRSV-----------------SLKEITEELTKISNNAGLTD 338

Query: 364 SDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGIT 423
           SDA++LARSLS++GS +  +  +S+N        +DN+          +ASN+    G  
Sbjct: 339 SDAVTLARSLSMSGSFTSGNLHLSNN-----NAENDNE----------FASNMFNEIGGG 383

Query: 424 MPTRS-LRRSKFNTYKIRNPSGNILEQSRISK-SEPSSRNVTGSS--NRASSFDIEHTQD 479
           +P RS LRRSKFNTYKIR      LE S +S+ S P+S      S   R++S    + Q 
Sbjct: 384 IPERSSLRRSKFNTYKIR------LEGSGLSQASRPNSLMSIQISEGRRSASLPASYAQL 437

Query: 480 VLRESAPLTFETISEE--QVQDKXXXXXXXXXXXXXXXXXXXXXXHLSFSQGNITQSSDS 537
             ++ +   F+ I +   +   +                      H S SQ +   S+DS
Sbjct: 438 PQQQGSLNDFQEIFDHYRKTSTEWGTENTKYVDNTNYYSDEEDLTHASISQDSSFLSTDS 497

Query: 538 SNDSVLVRPAYSHSIIQEKLDTDRGGDLEFSSNKFSET-------------------LFA 578
           SN+SVL++P  S S+I E+LD D   + E  +   SE                    ++ 
Sbjct: 498 SNNSVLMKPHNSGSMISERLDQDTISN-ENENTGISEPNHGWSWLNSGNENSSNNDHIYE 556

Query: 579 KESDIQDDPD--------FVNLSIPERTKSQRVRAEKSNHSKHRHSPIITI-SEETPFKI 629
              D QD  D        FVNLS+  R KS +  +E+ NHSK+RHSPI+ + S+ +   +
Sbjct: 557 PLMDEQDAEDCLENEEANFVNLSVSRRAKSTKRVSERINHSKNRHSPILQMPSDGSKSVV 616

Query: 630 NNKKQLSQPLLNESEINKGDHGSIIPENLXXXXXXXXXXXXXXXPSTNKKQRFDKKIVSI 689
                 S P L  SE       + IP                  P ++KKQ  +K++  +
Sbjct: 617 ITSSVPSSPPLQSSE-------ATIP----AAAEKEQNCPDDNRPLSHKKQSLEKRLARL 665

Query: 690 FKRKSSKTSNNEIKNEKKTVLSQEDKRIMXXXXXXXTKQDISAAELQSDHLDDSLRTVER 749
           FKRK                 S+ D +++        K+  S + L         +  E 
Sbjct: 666 FKRKQHCDG------------SKSDAKVLKKNVKNELKKKASHSSLSKFRKSPKKKREEE 713

Query: 750 ELLSESVHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSSYDENAEDSFSYLEESLET 809
           E++ +                   S P+E   T  ED           D+ S +E ++E+
Sbjct: 714 EVVHDR-----------------PSSPVETITT--EDF----------DTSSDIEPAVES 744

Query: 810 QNSLQPAVCITSNRADVVVTETVDELSDGDDSQDITGGE------FYTDNTQVNTINTSY 863
            N+        +N +   V ET++EL DGDDS DI+GGE        +D  +  T   + 
Sbjct: 745 PNACNILPDSNTNHSSEFVVETINEL-DGDDSFDISGGENDCNIDVRSDIARDTTAGPNE 803

Query: 864 ETSYNSTRIVEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTST 923
                   +V   A  +  S+L  RKL F+DV+KPE PN P++FTDSAFGFPLP +  ST
Sbjct: 804 SMGEEEESMVPSPAPQI--STLLPRKLIFEDVIKPEYPNAPIKFTDSAFGFPLPMIANST 861

Query: 924 VIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQ 979
           VIMFDHRL +NVERAIYRLSHLKLSDP RELR+Q+LLSNFMY+YL+LVNH+LY+EQ
Sbjct: 862 VIMFDHRLNINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 917

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  342 bits (877), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 286/814 (35%), Positives = 409/814 (50%), Gaps = 145/814 (17%)

Query: 204 ITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMVMDREV 263
           +TQNLLWVPA++HP VKPENY+EL+QD                +D   K SD  + +  V
Sbjct: 245 LTQNLLWVPASQHPNVKPENYLELVQDTLQNIQITTD------QDPDEKNSD--LSNNHV 296

Query: 264 IRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSI 323
              R+ S        S+VRRP+ L+ SY++  +E              ++R  SL   SI
Sbjct: 297 FSNRQRS-------GSIVRRPSHLKTSYTKFDDEPSSVDRQRQGHGQAEKRISSLETKSI 349

Query: 324 SMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTD 383
             +                 SLK+ITEELTKIS+ AGL++SDAI+LARSLS++GS +   
Sbjct: 350 RCV-----------------SLKEITEELTKISDNAGLTDSDAITLARSLSMSGSFTNES 392

Query: 384 NSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTRSLRRSKFNTYKIRNPS 443
             +S N     + + DN+          +ASN+  ++G+T+P RSLRRSKFNTYKIR  +
Sbjct: 393 LHLSSN-----KTDSDNE----------FASNMFNKSGLTIPERSLRRSKFNTYKIRLEN 437

Query: 444 GNILEQSRISKSEPSS-RNV-TGSSNRASSFDIEHTQDVLRESAPLT-FETISEE--QVQ 498
            ++L   R     P+S  NV T    R +S    +TQ   ++  PL  F+ I E   +  
Sbjct: 438 NDLLPTGR-----PNSLMNVQTNDDRRRASSPASYTQPP-QDQTPLNDFQEIFEHYRRTS 491

Query: 499 DKXXXXXXXXXXXXXXXXXXXXXXHLSFSQGNITQSSDSSNDSVLVRPAYSHSIIQEKLD 558
                                   H S SQ +   S+DSSN+SVLV+P  + S+I E+LD
Sbjct: 492 TDWGTENTKYVDNTNYYSDEEDLTHASISQDSSFLSTDSSNNSVLVKPHNAGSMISERLD 551

Query: 559 TD---------------RGGDLEFSSNK-------FSETLFAKESDIQD-----DPDFVN 591
            D                G     S+N+         E +   E DI D       DFVN
Sbjct: 552 QDIASNENEDIDINEPNHGWSWLNSANENLTNYDGAYEQVIDDEEDIGDCVEDEKADFVN 611

Query: 592 LSIPERTKSQRVRAEKSNHSKHRHSPIITI-SEETPFKINNKKQLSQPLLNESEINKGDH 650
           LS+  R KS +  +E+ NHSK+RHSPI  + S+E+   +      S   L+ S+  +   
Sbjct: 612 LSVSRRAKSTKRASERINHSKNRHSPIFQMQSDESKSVVVTSSVTS---LSPSQSTESAA 668

Query: 651 GSIIPENLXXXXXXXXXXXXXXXPSTNKKQRFDKKIVSIFKRKSSKTSNNEIKNEKKTVL 710
            +++                   P  +KK   +K++  +FKRK  + +NN          
Sbjct: 669 PAVV--------EKEQGSPNDNKPPAHKKHSLEKRLARLFKRK--QHNNN---------- 708

Query: 711 SQEDKRIMXXXXXXXTKQDISAAELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSN 770
           S+ D +++        K+  S + L         ++ + E++ +       + PV T S 
Sbjct: 709 SKSDAKVIKKNVKQELKKKTSHSSLSKFRKSPKKKSQQVEVVQD-----RSSSPVETVST 763

Query: 771 SLDSKPIEIANTSYEDKLNSSYDENAEDSFSYLEESLETQNSLQPAVCITSNRADVVVTE 830
            +   PIEI     E+  NS+        FS                   +N +  +V E
Sbjct: 764 RILDTPIEIEPI-VENPTNSNI-------FS----------------GGNTNHSSELVVE 799

Query: 831 TVDELSDGDDSQDITGGEFYTDNTQVNTINTSYETSYNSTRIVEQEANTLPE-----SSL 885
           T++EL DGDDS DI+GG+    N +V     +  T+  + R+ E++ +T+P      S L
Sbjct: 800 TINEL-DGDDSFDISGGDINY-NVEVTANMDTDTTAEPNERVGEEDEDTVPTLTPQLSIL 857

Query: 886 PARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHL 945
             +KLTF+DV+ PE PN P++FTDSAFGFPLP +T STVIMFDHRL +NVERAIYRLSHL
Sbjct: 858 LPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHL 917

Query: 946 KLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQ 979
           KLSDP RELR+Q+LLSNFMY+YL+LVNH+LY+EQ
Sbjct: 918 KLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 951

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (88%)

Query: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58
          EKRKS VLIAA+SLD E+Q+VK LKRLS+GSMDL++DPE E+ +
Sbjct: 51 EKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFKV 94

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  229 bits (585), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 175/440 (39%), Positives = 245/440 (55%), Gaps = 76/440 (17%)

Query: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXX 74
           +KRKSAVLIAAQSLD EVQNVK LKRLS+GSMDLL+DPE EYT+                
Sbjct: 21  DKRKSAVLIAAQSLDQEVQNVKNLKRLSIGSMDLLIDPELEYTVNNPSSPPSSVNSQKSY 80

Query: 75  XXXLRKSRLFDNDNSLMECEVSENYDDIANL-DSTSDLTSANVSDLANDNSFDKTGIEYL 133
                      N+ +    E S +  + + L DS  D ++++++D +  +SFD TG+EYL
Sbjct: 81  SS---------NETTYETAETSLDKKEGSYLEDSVVDASNSSIADAS--DSFDTTGVEYL 129

Query: 134 HNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRG--------- 184
           H+ + E V +NE  +          +++ ++  +  Q +R LSG+  L R          
Sbjct: 130 HDGN-EPVSSNEQLDSI--------KTVKENELSQPQSKRNLSGIGGLRRSSRNVTSKPE 180

Query: 185 NSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXX 244
           N  Q+ PK   ++ E +   T NLLWVPAN+HP VKP+N+VEL+ D              
Sbjct: 181 NETQVLPK---RKLENKKAFTNNLLWVPANQHPSVKPQNFVELVHD---------TLQNM 228

Query: 245 XVEDT-SNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALE 303
            ++D  +N++  K  + ++++     S+D+N  + SLVRRP+ LR SY+E  EE  + + 
Sbjct: 229 SLDDVQTNESESKNEVSKDLL--NTFSRDMNMRNKSLVRRPSRLRKSYTEFEEETEEEV- 285

Query: 304 SENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSN 363
                      +P+ S N+I+       NK   Q GK   SLKDI +ELT ISN  GLSN
Sbjct: 286 -----------KPTTSSNNINE-----SNKKNVQ-GKRAVSLKDIADELTVISNNVGLSN 328

Query: 364 SDAISLARSLSIAGSVSKTDNSVSDN--LQSATQGNDDNKPRSSEVSEAGYASNILVRNG 421
           SDAISLARSLSIAGS+  T     ++  L +++ G           SE  +ASNIL +NG
Sbjct: 329 SDAISLARSLSIAGSIGSTSEEEEEDKVLNTSSIGQ----------SEEVFASNILAKNG 378

Query: 422 ITMPTR-SLRRSKFNTYKIR 440
           I++P R SLRRSKFNTYKIR
Sbjct: 379 ISIPARSSLRRSKFNTYKIR 398

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  223 bits (567), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 191/570 (33%), Positives = 268/570 (47%), Gaps = 131/570 (22%)

Query: 534  SSDSSNDSVLVRPAYSHSIIQEKLDTDRGGDLEFSSNKFSE---------------TLFA 578
            S++SSNDSVL RP     +I E  D     D E  S   +E               +  A
Sbjct: 583  SNESSNDSVLYRPTNIKPMISENFDAVEQEDEETISTAVAEPTKNDNNNNTNSMPWSWLA 642

Query: 579  KE-SDIQDDP------------------DFVNLSIPERTKSQRVRAEKSNHSKHRHSPII 619
            K+ +DI D P                  DFV+++        +   ++ NHSK+RH PI 
Sbjct: 643  KDGTDIDDQPMDLKGEIVQEGEANTHTNDFVSVN----AAPSKHPIDRGNHSKNRHMPIF 698

Query: 620  TIS------EETPFKINNKKQLSQPLLNESEINKGDHGSIIPENLXXXXXXXXXXXXXXX 673
            T++      ++TP     +K+  +P +++ E + G                         
Sbjct: 699  TLNSASTNQDDTPQM--EQKEKKEPYVSKKEPSAGP------------------------ 732

Query: 674  PSTNKKQRFDKKIVSIFKRK--SSKTSNNEIKNEKKTVLSQEDKRIMXXXXXXXTKQDIS 731
                KK+  ++K V +FKRK  S+   +   KNE K     E K+ +        K  +S
Sbjct: 733  ----KKKTLEEKFVKLFKRKHHSANAKSPVNKNEHKLQHQDELKKKISKFRSKTAKAPVS 788

Query: 732  AAELQSDHLDDSLRTVERELLSESVH-----PTEVNIPVGTQSNSLDSKPIEIANTSYED 786
                       S R V++   + S         E ++P             +    + E+
Sbjct: 789  -----------STRNVQQTRETRSTENRNSAKKEQDVP-------------KEGKLTTEE 824

Query: 787  KLNSSYDENAEDSFSYLEESLETQN--SLQPAVCITS---NRADVVVTETVDELSDGDDS 841
            K     DE     FS    +LE      LQPAV +TS    R +  V ETV EL DGDDS
Sbjct: 825  KYRDRSDETQTIGFSDGTVTLEKDELPGLQPAVSVTSAKNTRDNGDVVETVREL-DGDDS 883

Query: 842  QDITGGEFYTDNTQVNTINTSYETSYNSTRIVEQEANTLPE---SSLPARKLTFKDVVKP 898
            QDI+GG+       ++        + + T+ V   A +      S+LP RKLT+ DV +P
Sbjct: 884  QDISGGDIQYQMQPIDEPVDGEVATVDDTQTVTAAAASALPAVISTLPPRKLTYADVKRP 943

Query: 899  ERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQI 958
            E+PN P++FTDSAFGFPLP LT STVIMFDHRL +NVERAIYRLSHLKLSD KRELR+Q+
Sbjct: 944  EKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQV 1003

Query: 959  LLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNT 1018
            LLSNFMYAYL+LVNH+LY+EQ       S+ +T+  D+        + S     Q  +N+
Sbjct: 1004 LLSNFMYAYLNLVNHTLYMEQV------SSTETAPKDSVPGGNGVQNGSCNNVDQMSSNS 1057

Query: 1019 GSDYLNNDVTNDYHTERNAADGSICIPDLS 1048
                        + T +N +DG+I IPD+S
Sbjct: 1058 A-----------FATNQNKSDGTILIPDIS 1076

 Score =  133 bits (334), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 150/287 (52%), Gaps = 29/287 (10%)

Query: 173 RGLSGVHSLNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXX 232
           R LSG   L RG+S     +   K + T D +  NLLWVPAN+HP VKPENY+EL+ D  
Sbjct: 203 RKLSGAGFLRRGSSAV--SQTARKLSGTAD-LKSNLLWVPANQHPNVKPENYLELVHDTL 259

Query: 233 XX-----XXXXXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGL 287
                               DT          D+E    R   +  N   SSLVRRP+ L
Sbjct: 260 QTINGEGDGDGDGHTIDTSADTGTAADSVDESDKENNNTRLRVRYRNGKASSLVRRPSRL 319

Query: 288 RISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKD 347
           R SY E+ +E  D+  S   ++  +E   SL +   +    D          +   SL+D
Sbjct: 320 RRSYIET-DEDEDSNTSNAKIDDIEEGGRSLDERKPTRTNGD----------RKSVSLRD 368

Query: 348 ITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGN-----DDNKP 402
           ITEELTK+SN  GL++ DA++LAR+L++  + + TD+   DNL++ ++        +N P
Sbjct: 369 ITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTDSEGLDNLRTDSKEQLRAEESENPP 428

Query: 403 RSSEVS----EAGYASNILVRNGITMPTR-SLRRSKFNTYKIRNPSG 444
            ++       E  +ASN+ ++NG+++PTR SLRRSKFNTY+IR  S 
Sbjct: 429 GTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTYRIRTTSA 475

 Score = 74.7 bits (182), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/41 (82%), Positives = 38/41 (92%)

Query: 16 KRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEY 56
          KRKS VLIAAQSLD+EVQNVK LKRLS+GSMDLL+DPE E+
Sbjct: 26 KRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEF 66

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
            YMR273C
          Length = 959

 Score =  219 bits (559), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 171/486 (35%), Positives = 234/486 (48%), Gaps = 125/486 (25%)

Query: 576  LFAKESDIQDDPDFVNLSIPERTKSQRVRAEKSNHSKHRHSPIITISEETPFKINNKKQL 635
            L  + SD   D DF   S P  T+ QR     SNHSK+RH PI   +E +      K   
Sbjct: 585  LHREPSDSHIDEDFEKTSTPVTTEIQR-----SNHSKNRHLPIFPANESS----KRKDTT 635

Query: 636  SQPLLNESEINKGDHGSIIPENLXXXXXXXXXXXXXXXPSTNKKQRFDKKIVSIFKRKSS 695
             +P ++      G   S    NL                    +Q F+KKI ++F+RK  
Sbjct: 636  EEPAVS---TKMGRSSSSDSSNLT-------------------RQMFEKKIANLFRRKGK 673

Query: 696  KTSNNEIKNEKKTVLSQEDKRIMXXXXXXXTKQDISAAELQSDHLDDSLRTVERELLSES 755
            K                             T +D + AEL+S    D+L    +      
Sbjct: 674  K-----------------------KLPDYGTSRDHTGAELKSKRSSDNLSKFAKT----- 705

Query: 756  VHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSSYDENA-EDSFSYLEESLETQN--- 811
                    PV  +S S             E+ L +S  ++   D+     E + +++   
Sbjct: 706  -----SKTPVKLRSES-----------RVEEHLRNSVSKDVVPDTAIVAGEVIPSKSKAE 749

Query: 812  ---SLQPAVCITSNR------ADVVVTETVDELSDGDDSQDITGGEFYTDNTQVNTINTS 862
               +LQPAV +TS +      A  VV E+V EL DGDDSQD++  +    +  ++T   S
Sbjct: 750  DLPALQPAVSVTSTKSAHVPLASSVVIESVKEL-DGDDSQDVSMDQNAQTSIDISTETLS 808

Query: 863  YETSYNSTRI-VEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTT 921
             +   +  +  V+Q A+      +P RKLTF DV + E+ N PM+FTDSAFGFPLP LT 
Sbjct: 809  MKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTV 868

Query: 922  STVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAE 981
            STVIMFDHRLP+NVERAIYRLSHLKLSDPKRELR+Q++LSNFMYAYL+LVNH+LY+EQ  
Sbjct: 869  STVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQV- 927

Query: 982  QQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNTGSDYLNNDVTNDYHTERNAADGS 1041
              A+E+++ T                     +T   T            + TE N+A+GS
Sbjct: 928  --AQENDLTT---------------------ETSGGTA-----------FKTEHNSANGS 953

Query: 1042 ICIPDL 1047
            ICIPD+
Sbjct: 954  ICIPDM 959

 Score =  218 bits (556), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 172/447 (38%), Positives = 243/447 (54%), Gaps = 81/447 (18%)

Query: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXX 74
           EKRKS VLIAAQS+D EVQNVK LKR+S+GS+DLL+DPE EY +                
Sbjct: 30  EKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNT--------- 80

Query: 75  XXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIEYLH 134
               RKS   ++ +S  E +V+  Y      D   D   A+VSD A D+SFD TG +YL 
Sbjct: 81  ----RKSWSSNSSSSEEEHDVAPCY------DKGEDEGEASVSDGA-DDSFDTTGADYLQ 129

Query: 135 NEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRGN----SKQLK 190
             +    H++ N+  T    PN+  +  Q       ++R L+GV SL RG     +++L 
Sbjct: 130 TTN----HSSANHQST----PNVKPTSPQ-----ISVKRTLTGVGSLRRGGVNIPTRKLS 176

Query: 191 PKIQNKQTETED--QITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVE- 247
               N   +  +   IT+ LLWVPA +HP VKPEN++EL+QD                + 
Sbjct: 177 SASDNGSEDGSNSSSITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDN 236

Query: 248 DTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENS 307
           D SNK + K   DR  I       D+ R   SLVRRP+ LR SY+E  EE+ +    E S
Sbjct: 237 DESNKENAK-AYDRLPI-------DITRKRDSLVRRPSRLRKSYTE-FEEYDETESLEGS 287

Query: 308 LNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAI 367
           +   KE   S  ++SI+  +    +++         SLKDITEEL KISN AGL++SDAI
Sbjct: 288 VAVGKESRNSFERSSIAPCSSGRSSRT--------VSLKDITEELNKISNNAGLTSSDAI 339

Query: 368 SLARSLSIAGSVSKTD----------NSV---SDNLQSATQGNDDNKPRSSEVSEAGYAS 414
           +LAR+LS+AGS + ++          N +   +D++Q+     DDN+          +AS
Sbjct: 340 TLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNE----------FAS 389

Query: 415 NILVRNGITMPTR-SLRRSKFNTYKIR 440
           N+L+++G+ +P R SLRRSKFNTY++R
Sbjct: 390 NMLMKHGVVIPARSSLRRSKFNTYRVR 416

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  211 bits (536), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 214/416 (51%), Gaps = 83/416 (19%)

Query: 678  KKQRFDKKIVSIFKRKS--------SKTSNNEIKNEKKTVLSQEDKRIMXXXXXXXTKQD 729
            KK+ FDKK   +FKRKS        +K+SN+ +   +K    + D R++       T   
Sbjct: 785  KKETFDKKFAKLFKRKSHENKNILKTKSSNSSLSKFRKHA-KKSDTRLLSNTNKVGT--- 840

Query: 730  ISAAELQSDHLDDSLRTVERELLSE--SVHPTEVNIPVGTQSNSLDSK--PIEIANTSYE 785
             S     S ++ D  RT+  +  SE  S+ PT        +S SL SK  P+ I   +  
Sbjct: 841  -SPPPPSSSNITDPDRTMNHQSNSEKTSLTPT-------PKSKSLISKVAPVSIPTPTIT 892

Query: 786  DKLNSSYDENAED--SFSYLEESLETQNSLQPAVC--------------ITSNRADVVVT 829
               +S +   +ED        E L    +LQPAV               I SN++     
Sbjct: 893  ISPSSDFVTQSEDINDERNKNEDLFDLPALQPAVSFSSTKTTTSTSNNEIDSNKSSKEFV 952

Query: 830  ETVDELSDGDDSQDITGGEF-YTDNTQVNTINTS---------YETSYNSTRIVEQ---- 875
            ETV E+ +GDDSQ+++GG+  Y DN   N +            +E S  S    +Q    
Sbjct: 953  ETVREI-EGDDSQELSGGDISYEDNNIKNQLQEDESVVSPEDHFELSQESIEAEDQTQSF 1011

Query: 876  -EANTLP---ESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRL 931
             ++ T P   +  LP RKLTF DV +PERPN P+EFTDSAFGFPLP LT STVIMFDHRL
Sbjct: 1012 NDSATQPLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIMFDHRL 1071

Query: 932  PVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDT 991
             +NVERAIYRLSHLKLSD KRELREQ+LLSNFMYAYL+LVNH+LY+EQ  QQ     +D 
Sbjct: 1072 GINVERAIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQQE---TIDN 1128

Query: 992  SEYDNSVVEVAYLDDSFTYSKQTKNNTGSDYLNNDVTNDYHTERNAADGSICIPDL 1047
             E+          DD+  +        G  Y             N ++GSI IPD+
Sbjct: 1129 VEFTG--------DDANDHQMNMVTGNGGIY-------------NDSNGSILIPDI 1163

 Score =  152 bits (384), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 192/370 (51%), Gaps = 71/370 (19%)

Query: 122 DNSFDKTGIEYLHNE-DFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHS 180
           ++S D T  EYLH+E   +    N+ N  T  ++PN   SL +S        R +SGV S
Sbjct: 164 EDSIDVTQSEYLHDEATLKKKTQNDMNIETSNDQPN---SLQRSS------HRSMSGVGS 214

Query: 181 LNRG--NSKQL--------------KPKIQNKQTETEDQIT----------QNLLWVPAN 214
           L R   N ++L              K  I + Q+E +   T          QNLLWVPAN
Sbjct: 215 LKRNGLNRRKLPFLSSSYASTSSTSKQSILSSQSEKDPTFTSSSSSDNLTPQNLLWVPAN 274

Query: 215 KHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMV-MD------REVIRRR 267
           +HP +KPE+Y+EL+QD                   S  T D +  MD      +E +   
Sbjct: 275 QHPNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVS--TDDDLYSMDGTDETNKENLNID 332

Query: 268 RISQ----DLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLS---- 319
            +++    +L R + SLVRRP+GLR SY+E  EEF+ + E + +  SD E E  LS    
Sbjct: 333 YLTKPSTSELRRKNKSLVRRPSGLRKSYTE-FEEFNTSDEEDET--SDCEEEQQLSTDNS 389

Query: 320 -QNSISMITIDLQNKSTYQM-------GKNYASLKDITEELTKISNKAGLSNSDAISLAR 371
             N+     I + NK+   +          + SLKDITEELTKISN AGL++SDAI+LAR
Sbjct: 390 TNNANHHQDIIINNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAITLAR 449

Query: 372 SLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTR-SLR 430
           +LS+AGS     N+  ++     + N  N P   E     YASN+ ++NG+T+PTR SLR
Sbjct: 450 TLSMAGSFQDNSNNNHNSDNFNEEQN-GNTPEDDE-----YASNMFMKNGLTIPTRSSLR 503

Query: 431 RSKFNTYKIR 440
           RS+FNTY+IR
Sbjct: 504 RSRFNTYRIR 513

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (76%), Gaps = 5/60 (8%)

Query: 2  SYKNETLR-ACTVE----EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEY 56
          SY N+ +  A +++    EKRKS + IAA+SLD E+Q+V+ LKRLS+GSMDLL+DPE E+
Sbjct: 18 SYGNDNINNAASIQQARKEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEF 77

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
            {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
            YML109W ZDS2 Protein that interacts with silencing
            proteins at the telomere involved in transcriptional
            silencing paralog of Zds1p
          Length = 1211

 Score =  199 bits (506), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/163 (57%), Positives = 116/163 (71%), Gaps = 23/163 (14%)

Query: 885  LPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSH 944
            LPARKLTF DV + +RPN PM+FTDSAFGFPLP LT STV+MFDHRLP+NVERAIYRLSH
Sbjct: 1070 LPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPINVERAIYRLSH 1129

Query: 945  LKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYL 1004
            LKLSDPKRELR+Q++LSNFMYAYL+LVNH+LY+EQ  Q+  +     S+  N+       
Sbjct: 1130 LKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQEGGQEIPTASKTTNAA------ 1183

Query: 1005 DDSFTYSKQTKNNTGSDYLNNDVTNDYHTERNAADGSICIPDL 1047
                     +  +TGS          Y T++N A+G+ICIPD+
Sbjct: 1184 ---------STAHTGS--------GSYTTDQNDANGAICIPDI 1209

 Score =  199 bits (506), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 165/462 (35%), Positives = 239/462 (51%), Gaps = 61/462 (13%)

Query: 12  TVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXX 71
           T++EKRKS V+IAAQSLD EVQ+VK LKR+S+GSMD+LLDPE EY +             
Sbjct: 53  TMKEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRVSSNAGKQEN---- 108

Query: 72  XXXXXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIE 131
                  RKS       S +    +E  +++ N  +      +   +   D SF+     
Sbjct: 109 -------RKSW-----TSGVPARPAEEVENMQNRATVRYTYPSRAVEGEPDESFESE--- 153

Query: 132 YLHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLR-----------RGLSGVHS 180
            L    F+      N+ Y  G +PN + S+ +S  + + LR           R +SGV +
Sbjct: 154 -LSEISFDVT----NSEYLEGLDPNDDSSIQKSENDTTDLRGSQKSQVSSSGRSISGVGT 208

Query: 181 LNRGNSKQLKPKIQNKQTETEDQ---ITQNLLWVPANKHPGVKPENYVELLQDXXXXXXX 237
           L RG S     K       +      +T+NLLWVPAN+HP VKPENY+EL+QD       
Sbjct: 209 LKRGASNIPLRKTSTSSDASSGSNGSLTKNLLWVPANQHPNVKPENYLELVQDTLHNIRL 268

Query: 238 XXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEE 297
                     D +  T+    ++    +       L R ++SLVR+P+ LR SY+E  EE
Sbjct: 269 EGNEDEQTGNDMNTTTAK---VEHGTNKENEDKGYLPRKNNSLVRKPSRLRKSYTEFDEE 325

Query: 298 FHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISN 357
             D L++        ++  S      S +TI   N S         SL+DIT+ELTKISN
Sbjct: 326 NDDYLDTSGF----SKKRSSEDVEDASNLTISSTNSS------RAVSLRDITDELTKISN 375

Query: 358 KAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQS--ATQGND---DNKPRSSEVSE--A 410
            AGL++SDAI+LAR+LS+AGS   T +   D +++   TQG+D    N+  + E  E  A
Sbjct: 376 NAGLTDSDAITLARTLSMAGSF--TSDEPDDIIENSRGTQGDDLQYYNEADAMEKKEDDA 433

Query: 411 GYASNILVRNGITMPTR-SLRRSKFNTYKIRNPSGNILEQSR 451
            +ASN+ ++NG  +P R SLRRSKFNTY++R+ S   L++++
Sbjct: 434 EFASNMFMKNGFVIPARSSLRRSKFNTYRVRSASDENLDENK 475

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 8/52 (15%)

Query: 584 QDDPDFVNLSIPERTKSQRVRAEKSNHSKHRHSPIITISEETPFKINNKKQL 635
           +++ DF+  S   RT  +RV A++SNHSK+RHSPI        F  NNKK++
Sbjct: 762 KENADFIKTSTHMRTDYERVAADRSNHSKNRHSPI--------FTENNKKEI 805

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
            Anc_8.831 YMR273C
          Length = 884

 Score =  197 bits (501), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 150/256 (58%), Gaps = 54/256 (21%)

Query: 812  SLQPAVCITSNRADV-------------------VVTETVDELSDGDDSQDITGGEFYTD 852
            SLQPAV + S + +                     V +TV EL +GD+SQD++      +
Sbjct: 663  SLQPAVSVVSTKKESNASAPPSSASSSSLSSSSSTVIQTV-EL-EGDESQDVSYEALKGE 720

Query: 853  NTQVNTINTSYETSYNSTRIVEQEANTLPE-SSLPARKLTFKDVVKPERPNGPMEFTDSA 911
            + +   +++S  T+       EQE       SSLP RKLTF DV +PE+PN P+ F+DSA
Sbjct: 721  DFRNPELSSSETTA-------EQEKELKSAISSLPPRKLTFDDVKRPEKPNAPIHFSDSA 773

Query: 912  FGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLV 971
            FGFPLP LTTSTVIMFDHRL +NVERAIYRLSHLKLSDPKRELR+Q+LLSNFMYAYL+LV
Sbjct: 774  FGFPLPMLTTSTVIMFDHRLGINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLV 833

Query: 972  NHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNTGSDYLNNDVTNDY 1031
            NH+LY+EQA   + ES                  D     ++ +  TG           Y
Sbjct: 834  NHTLYMEQAAVSSNES------------------DYEEDLEEVEQETGG-------VGRY 868

Query: 1032 HTERNAADGSICIPDL 1047
             T  NA+DG+I IPD+
Sbjct: 869  TTAHNASDGTIVIPDM 884

 Score =  168 bits (426), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 170/556 (30%), Positives = 265/556 (47%), Gaps = 116/556 (20%)

Query: 173 RGLSGVHSLNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXX 232
           R LSG++S     S+Q   K+ N +T+ ED++  NLLWVPA+KHP VKP+NY+EL+QD  
Sbjct: 162 RNLSGINS-----SRQSSRKLSNDRTDNEDKLKNNLLWVPASKHPNVKPQNYIELVQD-- 214

Query: 233 XXXXXXXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYS 292
                        ++D+ +  +D +  + +    +         + SLVRRP+ LR SY+
Sbjct: 215 -------TLQHIHIDDSKSNDNDNINKENDAHSSK---------NGSLVRRPSRLRKSYT 258

Query: 293 ESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEEL 352
           E  EE +   +  N  NS+ E  P++             N  +   G++  SLKDITEEL
Sbjct: 259 EYEEENYQ--DDYNRNNSNDEENPNIG------------NFRSSNKGRS-VSLKDITEEL 303

Query: 353 TKISNKAGLSNSDAISLARSLSIAGSVSK-TDNSVSDNLQSATQGNDDNKPRSSEVSEAG 411
           TKISNKAGL++SDAI+LAR+LS+ GS S  TD+    +  S  Q N+ N       ++  
Sbjct: 304 TKISNKAGLTDSDAITLARTLSMTGSFSNGTDDMELLSNYSDQQDNNFNNDEHYNKNDDE 363

Query: 412 YASNILVRNGITMPTR-SLRRSKFNTYKIRNPSG--NILEQSRISKSEPSSRNVTGSSNR 468
           +ASN+L++NG+T+P R SLRRSKFNTY++R+ S   NI        S+P + N+      
Sbjct: 364 FASNMLMKNGLTIPQRSSLRRSKFNTYRVRSSSAPSNI-------HSKPINSNIK----E 412

Query: 469 ASSFDIEHTQDVLRESAPLTFETISEEQVQDKXXXXXXXXXXXXXXXXXXXXXXHLSFSQ 528
             +F   +      + +P+       E V +                         +  +
Sbjct: 413 PKTFKYPYNSKTSIKKSPVNRSNNYTEPVTESPGSISDLYDHYAYSSVDEETSNATNLQE 472

Query: 529 ----GNITQSSDSSNDSVLVRPAYSHSIIQEKLD-------TDRGGDLEFSSNKFSETLF 577
               G+I  S++SSNDSVLV+P++S S+I E  D       TD   ++   +N+ +  L 
Sbjct: 473 TSNDGSI-DSNESSNDSVLVKPSHSESMIHENFDALASDTVTDGWSNV---NNENAHFLQ 528

Query: 578 AKESDIQDDPDFVNLSIPERTKSQRVRAEKSNHSKHRHSPIITISEETPFKINNKKQLSQ 637
              ++ + + + V+    E T   + R   SNHSK+RH P+ T S  TP     K     
Sbjct: 529 RNNNNGRLNDELVSKGNQESTHYNKTR---SNHSKNRHKPLFT-STNTPMTAKTKN---- 580

Query: 638 PLLNESEINKGDHGSIIPENLXXXXXXXXXXXXXXXPSTNKKQRFDKKIVSIFKRKSSKT 697
                                                 + KKQ  ++KIV +FKRK+ + 
Sbjct: 581 -------------------------------------VSKKKQTLEEKIVKLFKRKAHRR 603

Query: 698 SNNEIKNEKKTVLSQE 713
           +++  +N+   +  QE
Sbjct: 604 TSSSSENQ---IFGQE 616

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%)

Query: 12 TVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58
          ++  KRKS VLIAA+S+D EV+NVK LKRLS+GSMDLL+DPE EY +
Sbjct: 27 SLRNKRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPELEYKV 73

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  195 bits (496), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/165 (60%), Positives = 123/165 (74%), Gaps = 6/165 (3%)

Query: 820 TSNRADVVVTETVDELSDGDDSQDITGGEFYTDNTQVNTINTSYETSYNSTRIVEQEANT 879
           TS+ ++ VV ET+ EL DGDDS DI+GG+   D    ++I+             E+E NT
Sbjct: 750 TSHSSEFVV-ETISEL-DGDDSFDISGGDVNYDVEVHSSISRDTTAGLEEDIGAEREDNT 807

Query: 880 LPE----SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNV 935
            P     S+LP RKLTF+DVVKP+  N P++FTDSAFGFPLP +T STVIMFDHRL +NV
Sbjct: 808 SPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINV 867

Query: 936 ERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQA 980
           ERAIYRLSHLKLSDP RELR+Q+LLSNFMY+YL+LVNH+LY+EQ 
Sbjct: 868 ERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  193 bits (490), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 170/441 (38%), Positives = 225/441 (51%), Gaps = 87/441 (19%)

Query: 9   RACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXX 68
           R     EKRKS VLIAAQSLD E+Q+VK LKR+S GSMDL LDPE E+ M          
Sbjct: 25  RRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHSQRSSS 84

Query: 69  XXXXXXXXXLRKSRLFDNDNSLMECEVSE-NYDDIANLDSTSDLTSANVSDLANDNSFDK 127
                            +D   +E +  E N DD    DS  +L+  N       +S + 
Sbjct: 85  -----------------SDAVSLESQAEEPNQDD----DSDDNLSYLN-------DSIEL 116

Query: 128 TGIEYLHN-EDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRGNS 186
           T  EYL    DF            L E  ++++S       +S   R LSGV    RG  
Sbjct: 117 TAHEYLEEPRDF------------LVERSSVSKS------EDSHNGRNLSGVR---RGGM 155

Query: 187 KQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXV 246
            +   ++ N     +D +TQNL WVPAN+HP VKPENY+EL+QD               V
Sbjct: 156 SKKPRELSNG---GDDNVTQNLFWVPANQHPNVKPENYLELVQD-----TLHTLSIDSEV 207

Query: 247 EDTSNKT--SDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALES 304
           E  ++KT   +   +     +    SQ L    +SLVRRP+GLR SY+    E  D L+ 
Sbjct: 208 EPPTDKTVEGNNPYLASANTKASPSSQ-LRSGQNSLVRRPSGLRKSYT----ELEDLLQH 262

Query: 305 ENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNS 364
           E   +SD+  E     N+ S +   ++N+   +   + +SLKDITEELT+ISNKAG ++ 
Sbjct: 263 EIQ-DSDENNE-----NAQSELNNIIKNRP--RATSSGSSLKDITEELTRISNKAGFTDG 314

Query: 365 DAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITM 424
           DA+ LAR+LS+A S    D   S   QSA   N D+ P S       YAS IL +NG+ +
Sbjct: 315 DAVCLARTLSMASSY---DGEQSQANQSA---NTDHTPDSE------YASTILTKNGLAI 362

Query: 425 PTR-SLRRSKFNTYKIRNPSG 444
           P R SLRRSKFNTY+IR P+G
Sbjct: 363 PARSSLRRSKFNTYRIRTPNG 383

 Score =  181 bits (458), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/116 (69%), Positives = 98/116 (84%), Gaps = 3/116 (2%)

Query: 884 SLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLS 943
           +LP RKLTF DVVKPERPN PM+F+DS+FGFPLP LT STV+M DHRL +NVERAIYRLS
Sbjct: 810 TLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLS 869

Query: 944 HLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVV 999
           HLKL DPKRELR+Q++LSNFMYAYL+LVNHSLY++Q E+   ++  D++  DN  V
Sbjct: 870 HLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEE---DNPADSASNDNQGV 922

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  192 bits (488), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 161/456 (35%), Positives = 231/456 (50%), Gaps = 90/456 (19%)

Query: 3   YKNETLR-ACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXX 61
           Y+   +R + T +EKRKS VLIAAQSLD E+QNVK LKRLS+GSMDLL+DPE E+ +   
Sbjct: 21  YQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINSS 80

Query: 62  XXXXXXXXXXXXXXXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLAN 121
                                  +ND        +E YDD        D + +       
Sbjct: 81  LSSSPTKSLSSEEE---------ENDKE----GYAEEYDD--------DYSYS------- 112

Query: 122 DNSFDKTGIEYLH---NEDFEHVHTNENNNYTLGEEPNINESLFQSH---KNNSQLRRGL 175
           ++S D T  EYLH   N+D+   +   N   ++G    ++E  +++     + +  RR L
Sbjct: 113 EDSMDITKTEYLHDNSNDDYGE-YNRGNRTGSVG----VSEDAWKTTLEIADGTSPRRAL 167

Query: 176 SGVHSLNRGNSKQLKPKIQNKQ---TETEDQITQNLLWVPANKHPGVKPENYVELLQDXX 232
           SG  S+ RG     + ++   +      E+ +TQNLLWVPAN+HP VKPENY+EL+QD  
Sbjct: 168 SGTGSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQD-- 225

Query: 233 XXXXXXXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQ-DLNRNHSSLVRRPTGLRISY 291
                        V D SNK +   ++         +SQ  + +  +SLVRRP+ LR SY
Sbjct: 226 ---TLQNLQLENGVRDESNKENTVKLIHG---LNSNVSQLPIQQGKNSLVRRPSRLRKSY 279

Query: 292 S--ESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDIT 349
           +  E  EE++  +   +S        P                           SL++IT
Sbjct: 280 TEFEDTEEYNLPISGNSSSLPSSVPTP------------------------RSVSLREIT 315

Query: 350 EELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSE 409
           +ELTK+SN AGL++SDAI+LAR+LS+A +  +  NS  +N QS T+          +  E
Sbjct: 316 DELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKEN-QSNTE----------KAEE 364

Query: 410 AGYASNILVRNGITMPTR-SLRRSKFNTYKIRNPSG 444
             +ASN+L +N + +P R SLRRSKFNTY+IR PSG
Sbjct: 365 DEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSG 400

 Score =  186 bits (473), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 80/99 (80%), Positives = 91/99 (91%)

Query: 885 LPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSH 944
           LP RKL F+DV +PE PN PM+FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRLSH
Sbjct: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867

Query: 945 LKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQ 983
           LKLSDPKRELR+Q+LLSNFMYAYL+LVNHSLY++Q E++
Sbjct: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEE 906

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  188 bits (478), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 154/436 (35%), Positives = 216/436 (49%), Gaps = 84/436 (19%)

Query: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXX 74
           EKRKS VLIAAQSLD E+Q+VK LKR+S+GSMD+L+DPE E+ +                
Sbjct: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTS-- 91

Query: 75  XXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIEYLH 134
                      +D  L        Y+  ++ DS  DL+  N       +S D T  EYL 
Sbjct: 92  -----------HDQQL--------YNSHSDHDSDDDLSYVN-------DSIDITSTEYLQ 125

Query: 135 NEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRGNSKQLKPKIQ 194
                    +E   +         ESL  S  +    +R LSGV    RG          
Sbjct: 126 E--------SEGTGF---------ESLGSSSNDADCGKRTLSGVR---RGGLSGKTRMNN 165

Query: 195 NKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTS 254
           N   + E+ +T NLLWVPAN+HP +KPENY+EL+QD                E +    +
Sbjct: 166 NLSAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDN-----EGSVEGGN 220

Query: 255 DKMVMDREVIRRRRI--SQDLNRNHSSLVRRPTGLRISYSESVEEFHDAL--ESENSLNS 310
           D+ ++         +  S  L    +SLVRRP+GLR S++    E  D L  E++++   
Sbjct: 221 DEKIVHAPAAASANLPPSNQLRSGLNSLVRRPSGLRKSFT----ELEDLLLQEAQDTSGG 276

Query: 311 DKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLA 370
           D+  E         + + D       ++G   +SLKDITEELT+ISN+AG ++ DA+SLA
Sbjct: 277 DENAE---------LPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLA 327

Query: 371 RSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTR-SL 429
           R+LS+A S    ++  S        G+ + KP      E  YAS++L +NG+ +P R SL
Sbjct: 328 RTLSMASSYYTDEDGES-------VGSPEKKP------EKEYASSMLTKNGLAIPARSSL 374

Query: 430 RRSKFNTYKIRNPSGN 445
           RRSKFNTY+IRN SG 
Sbjct: 375 RRSKFNTYRIRNTSGG 390

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  187 bits (476), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 80/99 (80%), Positives = 92/99 (92%)

Query: 885 LPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSH 944
           LP RKLTF DV+KP+RPN PM+FTDSAFGFPLP LT STVIMFDHRLP++VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 945 LKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQ 983
           LKLSDPKR LR+Q+LLSNFMYAYL+LVNHSLY++Q E++
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922

 Score = 72.0 bits (175), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/42 (78%), Positives = 38/42 (90%)

Query: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEY 56
          +KRKS VLIAAQSLD EV++VK LKRLS+GSMDLL+DPE EY
Sbjct: 7  DKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEY 48

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  183 bits (465), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 81/111 (72%), Positives = 97/111 (87%), Gaps = 1/111 (0%)

Query: 881 PESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIY 940
           PE +LP R+LTF DV++PE+PN PM+FT SAFGFPLP LT STVIMFDHRLP+  ERAIY
Sbjct: 787 PEYALPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIY 846

Query: 941 RLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDT 991
           RLSHLKLSDPKRELR+Q+LLSNFMY+YL+LVNHSLY++Q E++ K   M+T
Sbjct: 847 RLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEE-KNMGMNT 896

 Score =  117 bits (294), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 142/279 (50%), Gaps = 79/279 (28%)

Query: 187 KQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXV 246
           K LK      + +  +  + NLLWVPA++HP VK ENY+EL+ D                
Sbjct: 108 KSLKDSPPTSENDENEPFSSNLLWVPADQHPNVKLENYLELVTD---------------- 151

Query: 247 EDTSNKTSDKMVMDREVIRRRRISQDLNRNH-----------------SSLVRRPTGLRI 289
                      + + +++ R ++ ++ N N+                 +SLVR+P+ LR 
Sbjct: 152 ----------TLHNLQLVGREQLEKNPNSNYQLSQTNSTSAHEAIPSKNSLVRKPSRLRK 201

Query: 290 SYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDIT 349
           S++E+        E+ +  NSD+                DL  ++     K  +SLK+IT
Sbjct: 202 SFTEA--------ENIDDPNSDE----------------DLNTETPISKRKRVSSLKEIT 237

Query: 350 EELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSE 409
           EELT+ISN AGL++SDAI+LAR+L I G+ + TD     N   A+  ND       E+ E
Sbjct: 238 EELTRISNNAGLTDSDAITLARTLGI-GTPAATDRRNFTNTDVAS--ND-------EIDE 287

Query: 410 AGYASNILVRNGITMP-TRSLRRSKFNTYKIRNPSGNIL 447
             YASNIL +NG+++    SLRRSKF TY+IR+PSG+ L
Sbjct: 288 E-YASNILTKNGLSISQGSSLRRSKFATYRIRSPSGDSL 325

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
            complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 82/107 (76%), Positives = 92/107 (85%)

Query: 876  EANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNV 935
            E   + +S LP RKL F DV K + PNGP++FTDSAFGFPLP LT STVIMFDHRLPVNV
Sbjct: 921  EQGNIIQSVLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNV 980

Query: 936  ERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQ 982
            ERAIYRLSHLKLS+PKR LR+Q+LLSNFMYAYLHLVNH+LY+EQ EQ
Sbjct: 981  ERAIYRLSHLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQHEQ 1027

 Score =  127 bits (318), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 144/281 (51%), Gaps = 46/281 (16%)

Query: 172 RRGLSGVHSLN------RGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYV 225
           RR LSG  SLN        NSK    K             +NLLWVPA+KHP V P+NY+
Sbjct: 138 RRKLSGSRSLNTIPDSMAYNSKASTTK-------------KNLLWVPADKHPNVMPDNYI 184

Query: 226 ELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMVMDRE-----VIRRRRISQDLNRNHSSL 280
           +++Q+               +E   +   D  V+ +E        R R+S    R + SL
Sbjct: 185 QMIQNSLNNLS---------LESNEDVDKDSKVLPQENKENIYEDRERLSVAYKRRNRSL 235

Query: 281 VRRPTGLRISYSESVEEFHDALESENSL--NSDKEREPSLSQNSISMITIDLQNKSTYQM 338
           VRRP+ LR SY+E    F+++ + E++   N+  +     ++NS +     ++   ++  
Sbjct: 236 VRRPSQLRKSYTE----FNNSDDEEDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDN 291

Query: 339 GKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGND 398
            +   SLKDIT ELTKISN  GLS+SDA+SLARSLSI G     D + SD        N 
Sbjct: 292 KRYSISLKDITAELTKISNSVGLSDSDAVSLARSLSITGPYQ--DETESDGAGDIMLDN- 348

Query: 399 DNKPRSSEVSEAGYASNILVRNGITMPTR-SLRRSKFNTYK 438
              P   E     + SN+++RNG+ +PTR SLRRSKF TY+
Sbjct: 349 ---PSDEESLNDEFVSNMVLRNGLMIPTRSSLRRSKFTTYR 386

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 42/47 (89%)

Query: 10 ACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEY 56
          A ++++KRKSAVLIAA+SLD E++++K LKR S+GSMD+L+DPE EY
Sbjct: 27 ATSMDDKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDPELEY 73

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
           (ZDS1)
          Length = 1018

 Score =  182 bits (462), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 78/99 (78%), Positives = 90/99 (90%)

Query: 884 SLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLS 943
           SLP RKL F DV++PE+PN PM+FT SAFGFPLP LT STVIMFDHRLP+ VERAIYRLS
Sbjct: 895 SLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLS 954

Query: 944 HLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQ 982
           HLKLSDPKRELR+Q+LLSNFMY+YL+LVNHSLY++Q E+
Sbjct: 955 HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEE 993

 Score =  110 bits (275), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 124/249 (49%), Gaps = 61/249 (24%)

Query: 200 TEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMVM 259
           T +  + NLLWV A++HP VKPENY+EL+ D                 D+  + S+  V 
Sbjct: 224 TGEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRIGARHGRG---DSPVQQSNTPVA 280

Query: 260 DREVIRRRRISQDLNRNHSSLVRRPTGLRISYSE--SVEE--FHDALESENSLNSDKERE 315
           + E             +  SLVR+ + LR S++E  ++EE  F D++ SE          
Sbjct: 281 NGE---------SSTASARSLVRKQSRLRKSFTEVEAIEESQFTDSIGSE---------- 321

Query: 316 PSLSQNSISMITIDLQNKSTYQMGKNY--ASLKDITEELTKISNKAGLSNSDAISLARSL 373
                                 +GK    +SLK+ITEELT+ISN AGL++SDAI+LAR+L
Sbjct: 322 --------------------IPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLARTL 361

Query: 374 SIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTR-SLRRS 432
            I    +    + S+ + SA            E  E  YAS+IL +NG+ +P R SLRRS
Sbjct: 362 GIGSQSADEHATFSECVPSA------------EAEENEYASSILAKNGLAIPARSSLRRS 409

Query: 433 KFNTYKIRN 441
           KF TY+IR+
Sbjct: 410 KFTTYRIRS 418

 Score = 78.2 bits (191), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/53 (71%), Positives = 44/53 (83%), Gaps = 2/53 (3%)

Query: 8   LRACT--VEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58
           LRA T   +EKRKS VLIAAQSLD E+QNVK LKR+S+GSMDLL+DPE E+ M
Sbjct: 62  LRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRM 114

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  181 bits (460), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%)

Query: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942
           S LP RKLTF DV KPE+PN P++F+DSAFGFPLP LT STVIMFDHRLP+NVERAIYRL
Sbjct: 783 SVLPPRKLTFADVKKPEKPNAPVQFSDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 842

Query: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQ 982
           SHLKLS+ KR LREQ+LLSNFMYAYL+LVNH+LY+EQA Q
Sbjct: 843 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQAAQ 882

 Score =  167 bits (422), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 150/458 (32%), Positives = 213/458 (46%), Gaps = 120/458 (26%)

Query: 5   NETLRACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXX 64
           N  + AC   +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +         
Sbjct: 15  NNRMAACQ-RDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF------ 67

Query: 65  XXXXXXXXXXXXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSA--NVSDLAND 122
                                       C  S      +   +TS  TSA    + + N 
Sbjct: 68  ----------------------------CGESNGRRSWSG--TTSKPTSAPNGTTGMNNT 97

Query: 123 NSFDKTGIEYLHNEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLN 182
              D T +E LH      + T   N           +     HK          GVHS +
Sbjct: 98  RYSDPTPLENLHERRSSGIETCAKNK----------QGSSTGHKR---------GVHSPS 138

Query: 183 RGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDX---------XX 233
           R        K+      T + + +NLLWVPAN+HP VKP+NY+EL+QD            
Sbjct: 139 R--------KL------TANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIRLGDNDD 184

Query: 234 XXXXXXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRN-----HSSLVRRPTGLR 288
                       V + +    +K  M+         + DLNR      ++SL+RRP+ LR
Sbjct: 185 NDDENDKNENNRVTEETESHGNKENMN---------TVDLNRGMLRHGNASLIRRPSTLR 235

Query: 289 ISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDI 348
            SY+E      D +E +N             Q + +  T++   + T ++ +   SL+DI
Sbjct: 236 RSYTE-----FDDIEDDNG------------QRNEASKTVNRVEERTSRIKERPVSLRDI 278

Query: 349 TEELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVS-----DNLQSATQGNDDNKPR 403
           TEELTKISN AGL+N+D I+LAR+LS+AGS S   N        D+ +  + G   ++ +
Sbjct: 279 TEELTKISNSAGLTNNDTITLARTLSMAGSYSDGGNEAGPKDLKDDYEGESIGVASSQRK 338

Query: 404 SSEVSEAGYASNILVRNGITMPTR-SLRRSKFNTYKIR 440
           +S+  E  YASN+   N +T P R SL+RS+FNTY+IR
Sbjct: 339 ASDDGE--YASNMPTNNDMTGPERSSLKRSRFNTYRIR 374

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] {ON}
            similar to uniprot|P54786 Saccharomyces cerevisiae
            YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
            YMR273c ZDS1
          Length = 828

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 139/227 (61%), Gaps = 41/227 (18%)

Query: 828  VTETVDELSDGDDSQDITGGEFYTD-NTQVN-----TINTSYET-SYNSTRIVEQEANTL 880
            V E V EL +  DS++++G + + D N + N     +I+ S E+ S N +  +  +    
Sbjct: 635  VVEYVQELEE--DSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSINQSYSLHTDE--- 689

Query: 881  PESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIY 940
            P      +KLTF DV KPER N PMEFTDSAFGFPLP LT STVIM DHRL +NVERAIY
Sbjct: 690  PNKVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIY 749

Query: 941  RLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVE 1000
            RLSHLKLS+  RELR+Q+LLSNFMYAYL+LV H+L +E+AEQ  +     TS  DN VVE
Sbjct: 750  RLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQS----TSSPDNKVVE 805

Query: 1001 VAYLDDSFTYSKQTKNNTGSDYLNNDVTNDYHTERNAADGSICIPDL 1047
            +                 GS         +Y+T  N +DG+I IP+L
Sbjct: 806  LE----------------GS---------NYNTAHNQSDGTILIPEL 827

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 152/467 (32%), Positives = 227/467 (48%), Gaps = 90/467 (19%)

Query: 19  SAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXXXXXL 78
           S  L AAQSLD EVQNVK LKRLS+GS+DL+ DPE   T+                    
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTE---------------- 64

Query: 79  RKSRLFDNDNSLMECEVSENYDDIANLD-STSDLTSANVSDLANDNSFDKTGIEYLHNED 137
           R+   +D D  L     +E  D    +D S +D TSA         S D+T +EYL + D
Sbjct: 65  REDTSYDAD--LSNGSFTEEDDTTTEIDGSDADETSA---------SIDRTRVEYLTSYD 113

Query: 138 FEHVHTNEN-NNYTLGEEPNINESLFQSHKNN--SQLRRGLSGVHSLNRGNSKQLKPKIQ 194
                +NE+          N+N   + ++ N+  S   R L G  SL    S   KPK +
Sbjct: 114 NTQESSNESPKGVARTRSLNLN---YHANSNSDISIKERTLRGSRSL----SNLKKPKNE 166

Query: 195 NKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTS 254
                 E  ++  L WVPAN+HP VKPENY+EL+++                 +T  K  
Sbjct: 167 ------EQSVSDKLFWVPANQHPNVKPENYLELVKETLNKIRDI---------NTDGKEK 211

Query: 255 DKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKER 314
            +   + EV  +  I+++  R   S+VRRP+ LR SY+E   E  + L+           
Sbjct: 212 SENNSEEEVSNKENINEN-GRLRGSIVRRPSKLRKSYTEFSSEDLELLDK---------- 260

Query: 315 EPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLS 374
             +LS N I    I  +N +  +      SLK+IT EL K SNKAGL++ +A++LAR+LS
Sbjct: 261 --ALSNNRI----ISTRNTTNSKR----LSLKEITNELVKHSNKAGLTDDNAVTLARTLS 310

Query: 375 IAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVR-NGITMPTRSLRRSK 433
           IA SV+  + +  ++     Q N + + +S +  +  +A+ ++   + +   T SLRRSK
Sbjct: 311 IASSVTNQNETGRND-----QSNTEQQKQSEDADDDTFATAVVGNSHSLASNTSSLRRSK 365

Query: 434 FNTYKIRNPSGNILEQSRISKSEPSSRNVTGSSNRASSFDIEHTQDV 480
           FNTY+++  +G   +Q  IS+S     N   S+NR  +    HT + 
Sbjct: 366 FNTYRVK--AG---QQRGISRS-----NYIDSTNRTDNLIARHTWET 402

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  179 bits (455), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/98 (80%), Positives = 89/98 (90%)

Query: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942
           S LP RKLTF DV K E+PN P++FTDSAFGFPLP LT STV+MFDHRLP+NVERAIYRL
Sbjct: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878

Query: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQA 980
           SHLKLS+ KRELREQ+LLSNFMYAYL+LVNH+LY+EQA
Sbjct: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQA 916

 Score =  120 bits (300), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 135/250 (54%), Gaps = 35/250 (14%)

Query: 204 ITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSD---KMVMD 260
           +  NLLWVPAN+HP VKP+NY+EL+QD                 D     +    +   +
Sbjct: 146 LKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLGDNDDDNDNNDNEGDEAHGETESYGN 205

Query: 261 REVIRRRRISQDLNRN-HSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLS 319
           +E +    +++ + R+ ++SL+RRP+ LR SY+E    F D+             E  + 
Sbjct: 206 KENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTE----FDDS-------------EGDIG 248

Query: 320 QNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSV 379
           Q     +T++   + T ++ +   SL+DITEELTKISN AGL++ DAI+LAR+L++AGS 
Sbjct: 249 QGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSY 308

Query: 380 S-KTDNSVSDNLQ-------SATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTR-SLR 430
           S K D   S++ +       +   G+    P   E     YASN+ + N  T P R SL+
Sbjct: 309 SDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVE-----YASNMPINNDSTGPERSSLK 363

Query: 431 RSKFNTYKIR 440
           RS+FNTY+IR
Sbjct: 364 RSRFNTYRIR 373

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%)

Query: 10 ACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMG 59
          A +  +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +   G
Sbjct: 19 AASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFG 68

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  178 bits (451), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 88/97 (90%)

Query: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942
           S LP RKLTF DV KP++PN P++FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRL
Sbjct: 814 SVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 873

Query: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQ 979
           SHLKLS+ KR LREQ+LLSNFMYAYL+LVNH+LY+EQ
Sbjct: 874 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 910

 Score =  133 bits (335), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 150/270 (55%), Gaps = 42/270 (15%)

Query: 177 GVHSLNRG-NSKQLKPKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXX 235
           GVHS +R  N+  LK               +NLLWVPAN+HP VKP+NY+EL+QD     
Sbjct: 133 GVHSTSRKLNANALK---------------KNLLWVPANQHPNVKPDNYLELVQDTLQNI 177

Query: 236 XXXXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRNH-SSLVRRPTGLRISYSES 294
                      ++  NK S   V D +      +++ ++R+  +SL+RRP+ LR SY+E 
Sbjct: 178 QLNGSEDNNDDQNNGNKNSGSKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTE- 236

Query: 295 VEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTK 354
              F D+ +     N D +             T++   + T ++ +   SL+DITEELTK
Sbjct: 237 ---FDDSEDD----NGDSK-------------TVNKVEERTSRIKERPVSLRDITEELTK 276

Query: 355 ISNKAGLSNSDAISLARSLSIAGSVS-KTDNSVSDNLQSATQGNDDNKPRS-SEVSEAG- 411
           ISN AGL+++DAI+LAR+LS+AGS S K D +   N +      D N   S +E S+ G 
Sbjct: 277 ISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGE 336

Query: 412 YASNILVRNGITMPTR-SLRRSKFNTYKIR 440
           YASN+ + N +T P R SLRRS+FNTY+IR
Sbjct: 337 YASNMPINNNMTWPERSSLRRSRFNTYRIR 366

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/45 (68%), Positives = 38/45 (84%)

Query: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMG 59
          +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +   G
Sbjct: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFG 68

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  177 bits (450), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 78/98 (79%), Positives = 88/98 (89%)

Query: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942
           S LP RKLTF DV KP++PN P++FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRL
Sbjct: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863

Query: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQA 980
           SHLKLS+ KR LREQ+LLSNFMYAYL+LVNH+LY+EQ 
Sbjct: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901

 Score =  155 bits (392), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 205/454 (45%), Gaps = 131/454 (28%)

Query: 15  EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGXXXXXXXXXXXXXXX 74
           +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +   G               
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTSS 83

Query: 75  XXXLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIEYLH 134
              +                              SD T+ N     N    D T +E LH
Sbjct: 84  SASM-----------------------------PSDTTTVN-----NTRYSDPTPLENLH 109

Query: 135 ---NEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRG-NSKQLK 190
              N   E  +  +  NY LG +                      GVHS +R  N+  LK
Sbjct: 110 GRGNSGIESSNKTKQGNY-LGIK---------------------KGVHSPSRKLNANVLK 147

Query: 191 PKIQNKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDX--------XXXXXXXXXXX 242
                          +NLLWVPAN+HP VKP+N++EL+QD                    
Sbjct: 148 ---------------KNLLWVPANQHPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNE 192

Query: 243 XXXVEDTS---------NKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSE 293
              +ED           NK ++ + ++R + R           ++SL+RRP+ LR SY+ 
Sbjct: 193 NNDIEDNGEDKESQSYENKENNTINLNRGLSR---------HGNASLIRRPSTLRRSYT- 242

Query: 294 SVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELT 353
              EF D  + +N  +S  E             T++   +   ++ +   SL+DITEELT
Sbjct: 243 ---EFDDNEDDDNKGDSASE-------------TVNKVEERISKIKERPVSLRDITEELT 286

Query: 354 KISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAG-- 411
           KISN AGL+++DAI+LAR+LS+AGS S   +      Q   +G+ D        S+A   
Sbjct: 287 KISNSAGLTDNDAITLARTLSMAGSYSDKKD------QPQPEGHYDEGDIGFSTSQANTL 340

Query: 412 ----YASNILVRNGITMPTR-SLRRSKFNTYKIR 440
               +ASN+ + N +T P R SLRRS+FNTY+IR
Sbjct: 341 DDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  168 bits (425), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (64%), Gaps = 28/168 (16%)

Query: 812 SLQPAVCITSNRADVVVTETVDELSDGDDSQDITGGEFYTDNTQVNTINTSYETSYNSTR 871
           SLQPAV +TS +   +V +                      N  V    +  E + +S++
Sbjct: 676 SLQPAVNVTSTKNQEIVIQ----------------------NVTVTATPSQREEATDSSK 713

Query: 872 IVEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRL 931
              ++         P RKLTF DV K ++ N P+EFTDSAFGFPLP+LT STVIMFDHRL
Sbjct: 714 TASKKP------LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRL 767

Query: 932 PVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQ 979
           P++VERAIYRLSHLKLS+ KR LREQ+LLSNFMY+YL+LVNH+LY+EQ
Sbjct: 768 PIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 134/241 (55%), Gaps = 38/241 (15%)

Query: 202 DQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMVMDR 261
           D++ QNLLWV A++HP VKPENY+EL+QD                E+   + SD   +D+
Sbjct: 148 DEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDK------TEEHDKENSD--TLDK 199

Query: 262 EVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQN 321
            V R    +   + N++ LVRRP+ LR SY+E  E     ++ ++S N++ +  P     
Sbjct: 200 -VSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTP----- 253

Query: 322 SISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSK 381
                     NK          +LKDITEELT+ISNKAGL+N+DA++LAR+LS+A SV++
Sbjct: 254 ---------HNKK--------FTLKDITEELTRISNKAGLTNNDAVTLARTLSMA-SVAE 295

Query: 382 TDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNG--ITMPTRSLRRSKFNTYKI 439
            D   +D+LQ   +  DD   R S  ++  YAS +L+     I     +L+RSK+ TY I
Sbjct: 296 EDE--TDDLQERPEAEDD-YARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHI 351

Query: 440 R 440
           R
Sbjct: 352 R 352

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%)

Query: 19 SAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFE 55
          S V IAAQSLD E+++VK LKRLS+GSMDLL+DPE +
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMD 42

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 77/109 (70%), Positives = 90/109 (82%)

Query: 877 ANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVE 936
           AN   +S LP RKLTF DV KPE+ NGPM++TDSAFGFPLP LT STVIM+D RL  NVE
Sbjct: 708 ANYQHKSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVE 767

Query: 937 RAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAK 985
           RAIYRLSHLKL + KR LREQ+L+SNFMYAYL+LVNH+L++EQ+  Q K
Sbjct: 768 RAIYRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQSNLQRK 816

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 98/190 (51%), Gaps = 34/190 (17%)

Query: 195 NKQTETEDQITQNLLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTS 254
            K+   + +I++ LLWV A+ HP VKPENY+EL+QD                  +    S
Sbjct: 140 GKKGGYDKEISKGLLWVSADVHPNVKPENYIELVQD-----------TLEQYNSSDYSIS 188

Query: 255 DKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKER 314
           +++  D++V+    +S    +   SLVR+P+ LR SY  S+E  +   E+    +++  R
Sbjct: 189 ERLPEDKQVL----LSAFRAKKSHSLVRKPSKLRKSYI-SIESNNTPAENN---DANAHR 240

Query: 315 EPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLS 374
           +P  S     + TI               SLK+++EEL KIS+ AGL+  DAI+LA +L 
Sbjct: 241 KPLGSSRDPVVSTI---------------SLKELSEELAKISSSAGLTKDDAITLATTLW 285

Query: 375 IAGSVSKTDN 384
           +  S+  +DN
Sbjct: 286 LTHSLLHSDN 295

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 34/45 (75%)

Query: 14 EEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58
          +E+R S + +AAQSL  EVQNV  LKRLSVGS+D+L D + E++ 
Sbjct: 8  KEQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFSF 52

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  166 bits (421), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 127/206 (61%), Gaps = 27/206 (13%)

Query: 793  DENAEDSFSYLEESLETQ-NSLQPAVCITSNRADVVVTETVDELSD----GDDSQDITGG 847
            D +  D+   L ES  T  N LQPA+ I + R     T  V   ++    G +S ++   
Sbjct: 835  DSSVLDASGPLTESRNTPLNGLQPAITIKTTRQPDPHTHAVAPRAETPPSGKNSANLP-- 892

Query: 848  EFYTDNTQVNTINTSYETSYNSTRIVE--------QEANT-----LP-ESSLPARKLTFK 893
               T N +      +Y TS   TR+ +        Q+A+T      P  S+LP RKLTF 
Sbjct: 893  ---TKNGRQRRKTGAYSTS---TRVSKTPKRSSRGQQASTNGNGPAPVTSTLPLRKLTFA 946

Query: 894  DVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRE 953
            DV    R NGP++F DS FGFPLP LT ST+IMF++RLP++VERAIYRLSHLKL D K+E
Sbjct: 947  DVPPTGRANGPVQFMDSTFGFPLPLLTRSTIIMFENRLPISVERAIYRLSHLKLGDTKKE 1006

Query: 954  LREQILLSNFMYAYLHLVNHSLYIEQ 979
            LR+Q+LLSNFMYAYLHLVNHSLY+EQ
Sbjct: 1007 LRQQVLLSNFMYAYLHLVNHSLYLEQ 1032

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 121/256 (47%), Gaps = 51/256 (19%)

Query: 205 TQNLLWVPANKHPGVKPENYV-ELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMVMDREV 263
           T  + WV A++HP V P   + E+L++                           + D++V
Sbjct: 145 TNAVKWVRADQHPNVSPSKQLNEVLENLH-------------------------IEDKQV 179

Query: 264 IRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDK-----EREPSL 318
            ++ R+S    +N SS+VRRP+ LR  +S + E F   +E + S   D      E E S 
Sbjct: 180 TKKDRLSITYKKNKSSIVRRPSKLR--HSSNDESFDSDIE-DPSFTKDHDTFSFENESSF 236

Query: 319 S---QNSISMITIDLQNKSTYQMGKNY-ASLKDITEELTKISNKAGLSNSDAISLARSLS 374
           S   Q  IS+   D ++        N+  SLK+IT+ELT+ISN AGL +SDAI+LA+SL 
Sbjct: 237 STNDQTDISITRFDSRDTINSNGNSNHRLSLKNITDELTRISNDAGLVDSDAINLAQSLG 296

Query: 375 IAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEV-----------SEAGYASNILVRNGIT 423
           +  S     N   D+   A   +  N+  + E            SE        V NG+ 
Sbjct: 297 LTSSYQNNINDFYDDKNLAIYDSTINESSNMETFNEQDKILNLNSENSKGGTFAV-NGMK 355

Query: 424 MPTR-SLRRSKFNTYK 438
           +P R SLRRSKFNTY+
Sbjct: 356 VPMRSSLRRSKFNTYR 371

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 32/44 (72%)

Query: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58
          E R  A+L A Q LD E++NV  LKR S+GSMD+L+DPE EY +
Sbjct: 12 ESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRI 55

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  164 bits (416), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/125 (60%), Positives = 97/125 (77%), Gaps = 9/125 (7%)

Query: 872  IVEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRL 931
            ++E +   +P       KL+F DV + ++PNG M FTDSAFGFPLP LT STVIMFD+RL
Sbjct: 959  VIEHQPTDIPH------KLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRL 1012

Query: 932  PVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDT 991
            P++VERAIYRLSHLKLS+PKR LR+Q+LLSNFMYAYLHLVNH+LY+E+    AK  +M++
Sbjct: 1013 PISVERAIYRLSHLKLSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKY---AKSHDMNS 1069

Query: 992  SEYDN 996
               +N
Sbjct: 1070 HNGNN 1074

 Score = 95.9 bits (237), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 148/305 (48%), Gaps = 55/305 (18%)

Query: 168 NSQLRRGLSGVHSLNRGN---SKQLKPKIQNKQTETED------QITQNLLWVPANKHPG 218
           N+ LRRG S       G    +K   PK    QT  +D       I++NLLWVPA++HP 
Sbjct: 110 NTSLRRGQSTSKVSYNGRISYNKSSMPKQHTHQTLDDDIDNENVPISKNLLWVPASQHPN 169

Query: 219 VKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKMVMDREVIRRRRISQDLNRNHS 278
            KP+N   + QD               V+D     S+  +  +E ++R +   +  R ++
Sbjct: 170 AKPKN---INQDSLLNNGL--------VQD-----SNSDLDTQEELQRNKSYLNSRRKNN 213

Query: 279 SLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQM 338
           SLVR+P+ LR SY++  ++  D          ++ RE + S NS +    ++ N      
Sbjct: 214 SLVRKPSTLRKSYTDFTDDDSDY---------NRSREANTSNNSRNTSDNEMNNLKASHG 264

Query: 339 GKNYA----SLKDITEELTKISNKAGLSNSDAISLARSLSIAGSV-----------SKTD 383
               A    SL DI EEL+KISN AGL+ ++A +LARSLSI G             + T 
Sbjct: 265 NSPSADSTFSLNDIKEELSKISNSAGLTETNAATLARSLSITGKYINRELLEEDDEASTS 324

Query: 384 NSVSDNLQSATQGNDDNK----PRSSEVSEAGYASNILVRNGITMPTR-SLRRSKFNTYK 438
           +  +D     T   D +     P  +EV +  +AS+IL+   + +P R SLRR KFNTY+
Sbjct: 325 DDNNDANDINTSIEDKSTLKQIPDLNEV-DGEFASHILLTKNVNVPVRSSLRRKKFNTYR 383

Query: 439 IRNPS 443
           +R+ S
Sbjct: 384 VRSSS 388

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 33/40 (82%)

Query: 17 RKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEY 56
          R+  +LIAAQ+LD EVQ+VK+LKR S+GS DL+ DPE E+
Sbjct: 36 REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEF 75

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  163 bits (412), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 114/176 (64%), Gaps = 8/176 (4%)

Query: 808  ETQNSLQPAV-CITSNRADVVVTETVDELSDGDDSQDITGGEFYTDNTQVNTINTSYETS 866
            E  NS + +V  +T N    +V E+ +     DD   I        NT ++  + S +TS
Sbjct: 1355 ELMNSNEMSVNMMTGNNHSEIVDESGNPGETLDDKYHIKVNANELGNTSISEEDLSNDTS 1414

Query: 867  YNSTRIVEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIM 926
              S    E+E    PE +    KLTF DV +  +PN  M F +SAFGFPLP LT ST+IM
Sbjct: 1415 IESAEGTERE----PEVNY---KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIM 1467

Query: 927  FDHRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQ 982
             D+RLP+NVERAIYRLSHLKLSDPKRELREQ+LLSNFMY+YLHLVNH+LY+EQ  Q
Sbjct: 1468 IDNRLPINVERAIYRLSHLKLSDPKRELREQVLLSNFMYSYLHLVNHTLYLEQVTQ 1523

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 89/183 (48%), Gaps = 34/183 (18%)

Query: 208 LLWVPANKHPGVKPENYVELLQDXXXXXXXXXXXXXXXVEDTSNKTSDKM---------V 258
           L W   NK   +KP+NY+EL+ D               V   S  T++K+         +
Sbjct: 368 LSWSSVNKRSSLKPDNYIELVNDAINSSNNVS------VTTNSTPTANKIEQGDSYYDNI 421

Query: 259 MDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSE---SVEEFHDALESENSLNSDKERE 315
            D   ++ RR S          VRRP+ LR SY++   ++ ++ D L   N  NS  E  
Sbjct: 422 PDSRKVKYRRNSN---------VRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDE-- 470

Query: 316 PSLSQNSISMITIDLQNKSTYQMGKNYAS---LKDITEELTKISNKAGLSNSDAISLARS 372
             +S N   +   D  N        + AS   LKD+T+ELTK+SN AGL++SDAI+LA++
Sbjct: 471 --VSNNDHQLTPDDSFNFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKT 528

Query: 373 LSI 375
           LS+
Sbjct: 529 LSL 531

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (74%)

Query: 4  KNETLRACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58
          K++  ++    +KR S V IAAQSLDL+VQNVKKLKR S+GS+DLL DP+ E  +
Sbjct: 22 KSQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLELVV 76

>Kpol_1030.33 s1030 (68892..73031) [4140 bp, 1379 aa] {OFF}
           (68892..73031) [4140 nt, 1380 aa]
          Length = 1379

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 733 AELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSSY 792
           A  Q   LD+S++ +E+++ SES    EV +      N+LD   +  ANTS ED ++ SY
Sbjct: 138 ANTQIRELDNSIKKLEKQI-SESKLQYEVTVKSIEPHNALDGNFLNSANTSREDLISHSY 196

Query: 793 DENAEDS 799
           ++   D+
Sbjct: 197 EDEGYDT 203

>Kpol_YGOB_1030.33 s1030 (68901..73031) [4131 bp, 1376 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 1376

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 733 AELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSSY 792
           A  Q   LD+S++ +E+++ SES    EV +      N+LD   +  ANTS ED ++ SY
Sbjct: 135 ANTQIRELDNSIKKLEKQI-SESKLQYEVTVKSIEPHNALDGNFLNSANTSREDLISHSY 193

Query: 793 DENAEDS 799
           ++   D+
Sbjct: 194 EDEGYDT 200

>Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W
           (REAL)
          Length = 829

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 61/128 (47%), Gaps = 9/128 (7%)

Query: 759 TEVNIPVGTQSNSLDSKPIEIANT--SYEDKLNSSYDENAEDSFSYLEESLETQNSLQPA 816
            ++N  +G   N+LD K  E+ N   S ++ L+ S D +  D  + L E + T+NSLQ  
Sbjct: 473 AQLNDKIGDIHNTLDCKEDELNNLKLSLKETLSMSKDFDDADLITQLNELISTKNSLQQK 532

Query: 817 VCITSNRADVVVTETVDELSDGDDSQDITGGEFYTDNTQVNTI-------NTSYETSYNS 869
           +    +  D  +    DEL +  ++  +   E  + N ++N +       +  ++T +N+
Sbjct: 533 INDLGSLNDDNLKSLNDELKENKNTLSLKDSEINSLNDEINELKKQIDLKDEEFKTWHNN 592

Query: 870 TRIVEQEA 877
              VE EA
Sbjct: 593 YENVEDEA 600

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,994,531
Number of extensions: 5123832
Number of successful extensions: 27140
Number of sequences better than 10.0: 515
Number of HSP's gapped: 28057
Number of HSP's successfully gapped: 671
Length of query: 1049
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 929
Effective length of database: 39,721,479
Effective search space: 36901253991
Effective search space used: 36901253991
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)