Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0H009505.122ON56356327450.0
TPHA0Q00120singletonON56356326970.0
Kpol_1010.485.122ON56356325450.0
TBLA0B075205.122ON56356324120.0
KLTH0B01188g5.122ON59356224100.0
TDEL0E050805.122ON56356223880.0
NDAI0C031105.122ON56456323880.0
Suva_10.1285.122ON56356323820.0
YLR044C (PDC1)5.122ON56356323730.0
Smik_12.1065.122ON56356323700.0
TBLA0B10060singletonON56456323680.0
SAKL0G14894g5.122ON56456323670.0
Skud_12.1105.122ON56356323660.0
NCAS0D016605.122ON56456323570.0
ZYRO0F01606g5.122ON56356323550.0
SAKL0G10164gna 1ON56456323510.0
CAGL0M07920g5.122ON56456323490.0
ACL134C5.122ON58656323480.0
KAFR0E020205.122ON56456323300.0
KLLA0E16303g5.122ON56356223280.0
Suva_10.227na 2ON56356323240.0
Ecym_24795.122ON56456323230.0
Skud_12.203na 2ON56356323200.0
YLR134W (PDC5)na 2ON56356323200.0
Kwal_33.155405.122ON56456223100.0
NDAI0A01400na 3ON56356223060.0
Smik_12.197na 2ON56356322910.0
KAFR0E01520singletonON56356322670.0
NCAS0A14630na 3ON56356322660.0
TBLA0D02840singletonON56356322590.0
AAL073Wna 1ON56356222520.0
TBLA0E03070singletonON56356322390.0
NDAI0A02510singletonON56356322390.0
Suva_7.369na 4ON56356322150.0
KNAG0M012505.122ON56356322140.0
SAKL0F04334gsingletonON56456322090.0
KNAG0J01340singletonON56556221980.0
KNAG0J01330singletonON56456321850.0
YGR087C (PDC6)na 4ON56356321810.0
KLTH0D08272gsingletonON56356221490.0
NCAS0A14240singletonON56556421420.0
NDAI0D03270singletonON52152120820.0
CAGL0G02937gna 4ON56456320370.0
Ecym_3185na 1ON56356319480.0
SAKL0E04972g2.390ON61154817640.0
ZYRO0A08426g2.390ON58454615390.0
YDL080C (THI3)2.390ON60955415390.0
Suva_4.1672.390ON62055415350.0
KLTH0E09702g2.390ON60754915190.0
Kwal_47.178782.390ON61054815120.0
TDEL0G032102.390ON60656715040.0
CAGL0L06842g2.390ON63857015050.0
Skud_4.1752.390ON62055414960.0
Smik_4.1562.390ON62155414800.0
KNAG0A059002.390ON62055714640.0
NCAS0A040002.390ON62556814420.0
KAFR0F029902.390ON60855714140.0
TPHA0G026202.390ON68859314210.0
NDAI0E017002.390ON62156813930.0
TBLA0B088202.390ON63558613880.0
Ecym_60552.390ON59256012611e-167
ADR254W2.390ON58155312471e-165
Kpol_1046.92.390ON59856310671e-138
SAKL0G03036g5.456ON6376018141e-100
CAGL0A03102g5.456ON6496018102e-99
KLLA0F16962g2.390ON5785537712e-94
Skud_4.6515.456ON6356187735e-94
KLTH0F15510g5.456ON6256057709e-94
NCAS0A118305.456ON6376157719e-94
YDR380W (ARO10)5.456ON6356157692e-93
Smik_4.6495.456ON6356217665e-93
Kpol_1062.125.456ON6305937612e-92
Suva_2.5545.456ON6356157603e-92
ACR211W5.456ON6295967524e-91
TPHA0J026805.456ON6486267371e-88
ZYRO0G04378g5.456ON6136057244e-87
KAFR0E037305.456ON6356047212e-86
TBLA0A026705.456ON6406077203e-86
Kpol_440.45.456ON6366047194e-86
KNAG0C047905.456ON6376157107e-85
TBLA0A064205.456ON6386047002e-83
TPHA0E016005.456ON6515966994e-83
TDEL0D024505.456ON6756117005e-83
KLLA0E02707g5.456ON6316016967e-83
SAKL0D00220gsingletonON5775746822e-81
KLTH0D00418gsingletonON5615636096e-71
TDEL0C07020singletonON5605645712e-65
TDEL0F00150singletonON5605645694e-65
NDAI0A044505.456ON5615585475e-62
Skud_7.383na 4ON86921703e-14
YMR108W (ILV2)2.441ON6873101572e-10
NDAI0H023802.441ON6853001563e-10
TPHA0G024402.441ON6913051529e-10
Smik_13.2972.441ON6873101502e-09
KAFR0A005702.441ON6823081492e-09
TBLA0I014002.441ON7103161484e-09
CAGL0K03465g2.441ON6773351474e-09
SAKL0E03740g2.441ON6793091465e-09
Kpol_297.122.441ON6713101441e-08
NCAS0F015002.441ON6843101441e-08
TPHA0G028852.441ON6883051431e-08
KNAG0A062502.441ON6803161431e-08
ZYRO0E03454g1.450ON5492871421e-08
KLLA0B12584g2.441ON6913031422e-08
TDEL0B055201.450ON5554911412e-08
KNAG0E023602.441ON6933121403e-08
Suva_13.2872.441ON6873031393e-08
Kwal_26.75822.441ON6792981394e-08
NCAS0A043202.441ON6893121377e-08
NCAS0G039601.450ON5773011368e-08
Ecym_61072.441ON6893101368e-08
Skud_13.2672.441ON6873091323e-07
KLTH0D04532g2.441ON6783031287e-07
ZYRO0G19954g2.441ON7003101271e-06
YEL020C1.450ON5605311261e-06
TDEL0A021602.441ON6823041242e-06
AEL305C2.441ON6683081215e-06
Skud_5.761.450ON5603141215e-06
Smik_5.871.450ON5604971207e-06
NDAI0E020502.441ON6903111207e-06
AEL055C1.450ON5452471101e-04
Ecym_13601.450ON5444991045e-04
KNAG0H015801.450ON5602711020.001
Suva_5.681.450ON561501970.004
SAKL0D10934g1.450ON550347960.005
TPHA0B039401.450ON575308940.008
Kwal_34.161161.450ON553275940.009
KLTH0H14102g1.450ON551291860.082
NCAS0B07970na 5ON205124810.15
Ecym_81121.166ON609195780.78
NDAI0G005201.450ON575130714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0H00950
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...  1061   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}     1043   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   984   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   933   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   932   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   924   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    924   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   922   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   918   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   917   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   916   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   916   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   915   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   912   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   911   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   910   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   909   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   909   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   902   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   901   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   899   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   899   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   898   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   898   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   894   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              892   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   887   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   877   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   877   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   874   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   872   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              867   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   867   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   857   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   857   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   855   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   851   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   846   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   844   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   832   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            829   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              806   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   789   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   754   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   684   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   597   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   597   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   595   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   589   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   587   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   583   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   584   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   580   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   574   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   568   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   560   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   549   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   551   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    541   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   539   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   490   e-167
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   484   e-165
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   415   e-138
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   318   e-100
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   316   2e-99
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   301   2e-94
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   302   5e-94
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   301   9e-94
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   301   9e-94
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   300   2e-93
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   299   5e-93
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   297   2e-92
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   297   3e-92
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   294   4e-91
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   288   1e-88
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   283   4e-87
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   282   2e-86
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   281   3e-86
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   281   4e-86
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   278   7e-85
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   274   2e-83
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   273   4e-83
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   274   5e-83
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   272   7e-83
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   267   2e-81
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   239   6e-71
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   224   2e-65
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                223   4e-65
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   215   5e-62
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    70   3e-14
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    65   2e-10
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     65   3e-10
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    63   9e-10
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    62   2e-09
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    62   2e-09
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    62   4e-09
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    61   4e-09
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    61   5e-09
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    60   1e-08
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    60   1e-08
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     60   1e-08
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    60   1e-08
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    59   1e-08
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    59   2e-08
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    59   2e-08
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    59   3e-08
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    58   3e-08
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    58   4e-08
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    57   7e-08
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    57   8e-08
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    57   8e-08
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    55   3e-07
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    54   7e-07
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    54   1e-06
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    53   1e-06
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    52   2e-06
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    51   5e-06
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    51   5e-06
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    51   7e-06
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    51   7e-06
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    47   1e-04
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    45   5e-04
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    44   0.001
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    42   0.004
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    42   0.005
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    41   0.008
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    41   0.009
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    38   0.082
NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {...    36   0.15 
Ecym_8112 Chr8 complement(237472..239301) [1830 bp, 609 aa] {ON}...    35   0.78 
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    32   4.2  

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/563 (94%), Positives = 530/563 (94%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYK               
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNLIAQAKLTAATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/563 (92%), Positives = 524/563 (93%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MSQITLGKYLFERLKQVQC TIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSV+KGYK               
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTA+YNEIQNWKHLDIL TFGAKDYE  RVATTGEWDKLASD+AFNENSKIR+IEIML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNLIAQAKLT ATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/563 (86%), Positives = 508/563 (90%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQVQ QTIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSACISETT+MITDIA+A AEIDRCI+ TYI+QRTVYLGLPANMVDLMVPAD+
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AETEVL  IL ++K+AKNPIILADACASRHDVKAETK LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSDH KI+KASFPGVQMKFVL+KLVAQ+G+ VK YK               
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQVGKFL+EGDIVLTETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQNWKHLDILPTFGAKDYE IRVATTGE++KL  DKAFNENSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+AQAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/563 (80%), Positives = 498/563 (88%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           M++ITLGKYLFERL QV+ QTIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY+ QRTVYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AE EV+  +LEL+++AKNPII+ADAC SRHDVK+ET+ LI+ATQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSI+E+HPRFGGVYVGTLSRPEVK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIK++ A+FPGVQMKFVL+KLV+++G+ +KGYK               
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQ+G FL+EGDIVLTETGTSAFGINQT FP +TYGISQVLWGSI     
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEI+P KRTI+FIGDGSLQLTVQEIST+IRWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ W HL ILPTFGAKDYE +RVATTGEW KL +DKAF +NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+AQAKLTAATNAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/562 (78%), Positives = 488/562 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+Y+FERLKQV   T+FGLPGDFNL LLD+IYEV GMRWAGNCNELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITD+A+A +EIDRCI+ TYI QR VYLGLP+N VD MVPA +
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDL+LKPND  AE EV+  +LE+IKDAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSDHIKIR A+FPGVQMKFVL+ L+ +VG+VVK YK               
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQ+WLWNQVG+FL+EGDIVLTETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  KR I+F G+GSLQLT QEISTM+RWNLKPY+FVLNN GYTIEKLI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTA+YNEIQNW HLD+LPTFGAKDYE IRV+TTGEW+KLA DK FN+NSKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
           PVMDAP +L+ QA+LTAATNAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/562 (78%), Positives = 487/562 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQV   TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGMA L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDI SA AEIDRCI+ TY+SQR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLK ND +AE EV+  +L LIK AKNP+ILADAC SRHDVK ET+ LID TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL+A+VG V K YK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQ+W+WNQVGKFL+EGD+V+TETGTSAFGINQ+HFP  TYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  AQYN+IQ WK+LD+LPTFGAKDYET RV+TTGEW+KL +D  FN+NSKIRMIE+ML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
           PVMDAPS+L+AQA+LTA+ NAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/563 (79%), Positives = 490/563 (87%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL QV  +TIFGLPGDFNLSLLDKIYE PGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLK NDV+AETEV+  ILELIKDAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKI+ A+FPGVQMKF L+KL+  V    KGYK               
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+DPKKR I+FIGDGSLQLTVQEISTM+RWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ+W HL +LPTFGAKDYE  RVATTGEW KL  +K FN+NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+AQA+LTA  NAKQ
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/563 (79%), Positives = 486/563 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERL QV   T+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPID+SLKPND ++E EV+  IL L+KDAKNPIILADAC SRHDVKAETK LID TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPR+GGVYVGTLS+PEVKKAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDH+KIR A+FPGVQMKFVL+KL+  V    KGYK               
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQ+G+FL+EGD+V+ ETGTSAFGINQ  FP NTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP AQYNEIQNW HL +LPTFGAKDYET RVATTGEWDKL  DK+FNENSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/563 (79%), Positives = 486/563 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERLKQV   T+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPID+SLKPND ++E EV+  IL L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDH+KIR A+FPGVQMKFVL+KL+  +    KGYK               
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP AQYNEIQ W HL +LPTFGAKDYET RVATTGEWDKL  DK+FN+NSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 486/563 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERLKQV   T+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPID+SLK ND ++E EV+  IL L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDH+KIR A+FPGVQMKFVL+KL+  +    KGYK               
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP AQYNEIQNW HL +LPTFGAKDYET RVATTGEWDKL  DK+FN+NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/563 (79%), Positives = 496/563 (88%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MSQITLGKYLFERL QV+ QTIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF  FHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QRTVYLGLPAN+VDLMVPA +
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDL+LKPN  ++E+EV+  IL+++K+AKNPII+ADACASRH+VK ET+ LID TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E+HPRFGGVYVGTLSRPE+K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDH+KI+ A+F GVQMKFVLEKL+A++G  +K YK               
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQ+G FL+EGDIVLTETGTSAFGINQT FP +TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEI+P KRTI+FIGDGSLQLTVQEIST+IRWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ W HL ILPTFGAKDYE +RVATTGEWDKL +DKAFN+NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+AQA+LTAA NAKQ
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQ 563

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 496/563 (88%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL QV+ QTIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+ +TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDLMVPA +
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLKPND +AE EV+  +LELIKDAKNP+ILADACASRH+VK+ETK LID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS  +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL++QVG VVK YK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQVG+FL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  KR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  AQYNEIQ WK+LD+LPTFGAKDYET RVATTGEWDKLA D+AFN+NS+IRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+ QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/563 (78%), Positives = 486/563 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS++TLGKYLFERLKQV   T+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL V A +
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPID+SLKPND ++E EV+  I+ L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+  +    KGYK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+F+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP AQYNEIQNW HL +LPTFGAKDYET RVATTGEWDKL  DK+FN+NSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/563 (77%), Positives = 492/563 (87%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERL Q+  +TIFGLPGDFNLSLLDKIYE+PGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLK ND +AE EV+  IL+L+K AKNPIILADACASRHDVKAET+ LID TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSD+IKI+ A+FPGVQMKFVL+KL+  + +  KGYK               
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQVGKFL+EGD+V++ETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+F G+GSLQLTVQEISTM+RWNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  A YN+IQNW+HL++LPTFGAKDYE  RV+TTGEWDKL S+K FN+N++IRMIEIML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+AQAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/563 (77%), Positives = 481/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQV   TIFG+PGDFNLSLLDK+YEV G+RWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KG+A LITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDI +A AEIDRCI+  Y++QR VYLGLPAN+VD  VPA +
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LNTPIDLSLK ND +AETEV+  +LELIK+AKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSDHIKIR A+FPGVQMKFVL+KL+  V   VK YK               
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLW QVG FL+EGD+V+TETGTSAFGINQTHFP  TYGISQVLWGSI     
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG TA+YN IQ WKHL++L TFGAKDYE  RV+T GEW+KL  D  FNENS+IRMIE+ML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
            VMDAPS+L+AQA+LTAATNAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/563 (78%), Positives = 495/563 (87%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG YLFERL QV  +TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+ +TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDLMVPA +
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLKPND +AE EV+ ++LELIKDAKNPIILADACASRHDVK ETK LID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS  +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL++++G+VVK YK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQVG+FL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  KR I+FIGDGSLQLTVQEISTMIRW L+PY+FVLNN+GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  AQYNEIQ WK+LD+LPTFGAKDYET RVATTGEWDKLA D+AFN+NS+IRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+ QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/563 (79%), Positives = 487/563 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL QV  +TIFGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TYI+QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AETEV+  +LELIK AKNP+ILADACASRHDVKAETK LIDATQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL+  V   +KGYK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQV KFL+EGD+V+TETGTSAFGINQT FP N YGISQVLWGSI     
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  A YN+IQNW HL +LPTFGAKDYE  RVATTGEWDKL  DK FN+NSKIRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAP++LI QAKLTA+ NAKQ
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQ 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/563 (78%), Positives = 486/563 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL+Q++ QTIFGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA IS TT+MI+DI SA AEIDRCI+  YI+QR VYLGLPANMVDL VPA +
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDL+LKPND +AE EV+  +LE+I  AKNP+IL+DACASRHDVKAET  LID TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI EQHPRFGGVYVGTLS PEVK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSDHIKIR A+FPGVQMK+VL KLV  V  V+K Y                
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+DP +R I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG TAQYN+IQ W+HL++LPTFGAKDYE +RV+TTGEWD L  DKAFNENSKIRMIE+ML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+ QA+LTAATNAKQ
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQ 585

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/563 (78%), Positives = 483/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           M++ITLGKYLFERL QV  +TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AE EV+  IL LIKDAKNP+IL+DACASRHDVKAETK LIDATQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNI+EFHSD+ KIR A+FPGVQMKFVL KL+A V    KGYK               
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L QEW+WNQ  KF +EGD+++TETGTSAFGINQ+ FP N+ GISQVLWGSI     
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRWNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  A YN+IQNWKHL +L TFGAKDYE  RVATTGEWD L  DK FN+NS+IRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+ QAK+TAATNAKQ
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQ 563

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/562 (77%), Positives = 488/562 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQV+ QTIFGLPGDFNLSLLD IYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMS+ ISETT+MITDI +A AEIDRCI+ TY+SQR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLKPND +AE EV+  +L+LIK+AKNP+ILADAC SRHD KAETK LID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+ KIR A+FPGVQMKF L+KL+ +V    KGYK               
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+W QVG+FL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG TAQYN IQNW+HL++LPTFGAKDYE +RV+TTGEW+KL +D+ F +N++IR+IE+ML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
           P MDAPSNL+ QA+LTAATNAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 482/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERL QV C T+FGLPGDFNLSLLDK+YEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ T+ +QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPID++LKPND +AE EV+  ++E+I+DAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVKKAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKF L++L++ +  VVK YK               
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               +KQEW+WNQ+  FL+EGDIV+ ETGTSAFGINQT FPT+ Y I QVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPYIFVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A+YNE+Q W HL +LPTFGAKDYET RV TTGEWDKL  DK F +NS+IRMIE+ML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/563 (77%), Positives = 484/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+IT+G YLF+RLKQV+ QTIFGLPGDFNL+LLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISE+T+MITD+A+A  EIDRCI+  YISQR VYLGLPAN+VD  VPA +
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPID SLKPND +AE EV+G +LE+I ++KNP+IL+DACASRHDVK ETK LID TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLS PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDH K+R A+FPGVQMKFVL+KLV  VG V K Y                
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L+QEW+W +V +FL+EGD+V+TETGTSAFGINQTHFP +TYGISQVLWGSI     
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG TAQYN+IQ W HL +LPTFGAKDYE +RV+T GEW +L  DKAF+ENSKIRMIE+ML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+ QA+LTAATNAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 482/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERL QV C T+FGLPGDFNLSLLDK+YEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIASA +EIDRCI+ T+ +QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPID+SLKPND +AE EV+  ++E+IKDAKNP+ILADACASRHDVKAETK LI+ TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQHPR+GGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSDHIKIR A+FPGVQMKF L+KL+  +  VVK YK               
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               +KQEW+WNQ+G FL+EGDIV+ ETGTSAFGINQT FPT+ Y I QVLWGSI     
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+DPKKR I+FIGDGSLQLTVQEISTMIRW LKPYIFVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A+YNE+Q+W HL +LPTFGA+DYET R+ TTGEWDKL  DK F +NS+IRMIE+ML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/563 (77%), Positives = 481/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERL QV C T+FGLPGDFNLSLLDK+YEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY +QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AE EV+  ++ELIKDAKNP+ILADACASRHDVKAETK L+D TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLSRPEVKKAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKF L+KL+  +  VVK YK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               +KQEW+WN +G FL+EGDIV+ ETGTSAFGINQT FPT+ Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+DPKKR I+FIGDGSLQLTVQEISTMIRW LKPYIFVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A+YNEIQ W HL +LPTFGA++YET RVATTGEW+KL  DK F +NSKIRMIE+ML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/562 (79%), Positives = 487/562 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL+QV+C TIFGLPGDFNL LLD+IYE  GMRWAGN NELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+MI+D+A+A AEIDRCI+ TY+ QR VYLGLP+N VD MVPA +
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND  AE EV+  +L+LIK+AKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+ QVG VVK YK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQ+WLWNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  KR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  AQYNEIQ W HLD+LPTFGAKDYET+RVATTGEW+KLA D+ FN+NSKIRMIE+ML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
           PVMDAP +L+ QA+LTAATNAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/562 (78%), Positives = 486/562 (86%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL QV   TIFGLPGDFNLSLLDKIYE PGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AE EVL  +L LIK+AKNP+ILADAC SRHDVK ET+ LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+  V + VKGYK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WNQVGKFL+EGDIV+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPK+R I+FIGDGSLQLTVQEISTM+RWNLKPY+F+LNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ+W+HL +L TFGAKDYE  RVATTGEW+KL  +K FN NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
           PVMDAP +LI Q +LTA  NA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/563 (76%), Positives = 479/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERL QV+C T+FGLPGDFNLSLLDK+YEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKG+AC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ T+ +QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AE EV+  ++E+IKDAKNP+ILADACASRHDVKAETK LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLSRPEVK+ VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKF L+KL+  + +VVK YK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               +KQEW+WNQ+  FL+EGDIV+ ETGTSAFGINQT FPT+ Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPYIFVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A YNEIQ W HL +LPTFGAKDYE  R+ATTGEWDKL  DK F +NS+IR+IE+ML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP NL+ QA+LTA+ NAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/563 (75%), Positives = 480/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL QV  +TIFGLPGDFNL+LLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+++TDIA+A AEIDRCIK TYI+QR VYLG+PANM D  +PA +
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSLKPND +AE EV+ AIL L+K AKNP+IL+DACASRH+V+ ET+ LIDATQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPR+GGVYVGTLSRPEVKKAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSD+ KI+ A+FPGVQMKFVL+KL   +   VKGYK               
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L QEW+WNQ  KF +EGDI++TETGT+AFGINQ+ FPT+  GISQVLWGSI     
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  +R I+FIGDGSLQLTVQEISTMIRWNL+PY+FVLNNNGYTIEKLI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  AQYNEIQNWKHL +L TFGAKDYE  R+ATTGEWD L S+K FN+NS+IR+IEIML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNL+ QAK+TAATNA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/563 (75%), Positives = 481/563 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQV   TIFGLPGDFNL+LLDKIYEVPGMRWAGN NELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMS+ ISETT+M+TD+A+A +EIDRCI+ TY++QRTVYLGLPANM DL V A +
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLKPND  AE EV+  IL L+KDAKNPIILADAC SRHDVKAETK LID TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PR+GGVYVGTLS P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSDHIKI+ A+FPGVQMKFVL+KL+  + SV KGYK               
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               +KQEW+WN++ KF +EGD+++TETGTSAFGINQT FP N YGISQVLWGSI     
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+F G+GSLQLTVQEISTM+RWNLKPY+FVLNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG  A YN+IQ W HL++L TFGAKDYE  RV+TTGEW+KL ++K FN+NS+IR+IEIML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
            VMDAPSNL+AQA+LTA+ NAK 
Sbjct: 541 EVMDAPSNLVAQAQLTASINAKN 563

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/563 (74%), Positives = 477/563 (84%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MSQ+TLG+YLFERL Q++ QTIFGLPGDFNL LLDKIYE+PGMRW GN NELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSL AQAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF  F+RMS+ ISET  MI D+ +A AEIDRCIK  Y+ QR VYLGLP N+V+ MVP  +
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLSL+PND D+E+EV+  ILE++K AKNPII+ADACASRHDVKAET+ LID TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSI+EQHPRFGGVYVGTL+RPEVKKAVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN++EFHSDH KI+ A + G+QMKFVL KL+ ++G VVK YK               
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L+QEWLWNQ+G FL+EGDIVLTETGTSAFGINQT+FP NTYGISQVLWGSI     
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR ++FIGDGSLQLTVQEISTM+ WNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ W +L++L TFGAKDY+ +RVATTGEW+ L  +  FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           P MDAPSNLI+QA+LTA+ NAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 478/562 (85%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQV+ +TIFG+PGDFNLSLLDK+YEV GMRWAGN NELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+K ++CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SAQAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA IS+TT++ITDI+SA AEIDRCI+A Y+ QR VYLGLPANMVDL VPA +
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LNT IDLSLKPND +AE EV+  +LEL+ +AK+P+IL+DACASRHDVK ETK LID TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLS P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDH KIR A+FPG++MK VL+ LV ++G   KGY+               
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWNQV  FLKEGDIV+TETGT+AFGINQT FP++T GISQVLWGSI     
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDP KR I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG TAQYN IQ WKHLD+LPTFGAKDYET RVATTGEW  L   + FN+NS IRMIEIML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
            VMDAPS+LI QAKLTAATNA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/563 (75%), Positives = 472/563 (83%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERLKQV   TIFGLPGDFNL+LLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS ++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF VFHRMS  ISETT+MITD++ A ++ID CI+ TY +QR VYLG+PANM D  +PA +
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPI++ L PN+ ++E EV+  IL ++K AKNP+I+ADAC SRH+VKAET+ LIDATQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E HPRFGGVYVGTL+RPEVKKAVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKI+ A+F GVQMKFVL++L+ ++G  VK YK               
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L+QEWLWNQ+G FL+EGDIVLTETGTSAFGIN T FP NTYGI+QVLWGSI     
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR  +FIGDGSLQLTVQEISTMIRWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ W HL ILPTFGA DYE IRVAT GEW+KL +D  FN+NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNLIAQ KLT A NA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/563 (72%), Positives = 469/563 (83%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERL QV   TIFGLPGDFNL+LLDK+YEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVG PS ++QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMS+ ISETT+M+TDI +A AEIDRCI+ TYI+QR VYLG+PAN  DL VPA++
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LNTPIDLSL  N+ +AE E LG +LEL+K +KNPII+ DACASRHDVKAET  LI+ TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVGTLSRPEVK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y+TK++VEFHSD+++I+KA+FPGVQMKF+L+KL   + + V+ YK               
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQ WLWNQ+ KFLKEGDIV+ ETGTS FGIN+T FP N   ISQVLWGSI     
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+DPK+R I+F GDGSLQLTVQEISTMIRWNLKPY+FVLNN GYTIEKLI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTA YNEIQ+W+HL +L TFGAKDYE  RV+TTG W+++  DK FNENSKIRMIE+ML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAP +LI Q +LTA  N+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/563 (73%), Positives = 475/563 (84%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQV   TIFGLPGDFNLSLLDKIYEV G+RWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKG++ LITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMS  ISETTSMITDIA+A +EIDR I+ T+++QR  YLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LN PIDLSLKPND +AE EV+  +LELI+ +KNPIIL+DACASRH VK ET+ LID TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS+P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSD+IK++ A+FPGVQMKF L+KL++ + SV+K YK               
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWN++ KFL+EGD++++ETGTSAFGINQT FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+DP +R I+FIGDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A+YNEIQ W HL +LPTFGAK YE  +VATTGEWDKL  D  F +NS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP +LI QA+LTAATNAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/563 (74%), Positives = 469/563 (83%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           M  +TLG+YLFERL QV  +TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETT+M+TDI +A AEIDRCI+ TY++QR VYLGLPAN+VDL VP  +
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDL+LKPND +AE EV+  +LELI++A NP+ILADACA RHDVK ET  LID TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKFVL KL+A VGS VKGY                
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L+QEW+WN+V KF ++GDI+LTETGT+AFGINQ+ FP NT GISQVLWGSI     
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDP KR I+FIGDGSLQLTVQEIST+IRW+LKPY+FVLNNNGYTIE+LI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A YN IQ W+H  +L  FGA DYE +++ TTGEW  L  DK FNE SKIRMIE+ML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPSNLIAQAKLTA  N+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/563 (73%), Positives = 475/563 (84%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLG+YLFERLKQVQ QTIFGLPGDFNLSLLDKIYEVPG+RWAGN NELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMS+ ISETT++ITDI  A  EIDRCIK TY  QR VYLGLPAN+VDL V A +
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLS+ PND DAE EV+  +L ++  AKNP+ILADAC +RHDVK ETK LID TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPRFGGVYVGTLS PEVK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+ K+R A+FPGVQMK VL+KL+++V     GYK               
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+WN +  +L+EGD+V+TETGTSAFGINQ+ FP +TYGISQVLWGSI     
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  +R I+F+GDGSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HG TAQYN++Q W HL++LPTFGAKDY++IR++TTGE+ KL  D+AF+ NSKIR+IE+ML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAPS L+ QA+LTAATNAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/562 (72%), Positives = 461/562 (82%), Gaps = 1/562 (0%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS I+LG YLFERLKQV   TIFGLPGDFNL LLDKIY+VPG+RWAGN NELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACL+TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  +QA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF VFHRMSA ISETT MITD   A  +IDRCI+ TY+ QRTVYLG+PANM D  +P  +
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLK N+  +E +VL  IL+ +KDAKNPII++DACASRHDVK ET+ LI+ TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE HPR+GG+YVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYK-XXXXXXXXXXXXXX 359
           Y TKN+VEFHSDH+KI+ A FPGVQM+ +L KL+ ++ +VVKGY                
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 360 XXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXX 419
                L+QEW+WNQ+ +FL+EGDI++TETGTSAFGIN T FP N  GISQVLWGSI    
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 XXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKL 479
                     EEIDPKKR I+FIGDGSLQLTVQEISTMI+WNLKPY+F+LNNNGYTIEKL
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIM 539
           IHGPTA+YNEIQ+W HL +LPT GAKDYE +RVAT GEW+KL  DK FN+NS+IR+IE+M
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPSNLIAQAKLTAATNA 561
           LPVMDAP +LI Q KLT   NA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/563 (72%), Positives = 467/563 (82%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS ++LG YLFERLKQV   TIFGLPGDFNL LLDKIY++PGMRW GN NELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKGMACL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  +QAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF VFHRMSA ISETT++ITD++ A +EIDRCI+ TY+ QRTVYLG+PANM D  +P  +
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSLK N+ ++E+EVL  IL+L+  AKNPIILADACASRHDVK ET+ LIDATQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPR+GG+YVGTLS P VKKAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A FP +QMK +L+KL+ Q+  V+  Y                
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEW+W ++G FL+EGDIV+TETGTSAFGIN T FP NT GISQVLWGSI     
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDP +R I+FIGDGSLQLTVQEIST I+WNLKPY+F+LNNNGYTIEKLI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQ+W+HL +LPTFGAKDYE +R+AT GEW+KL  DK FN+NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PVMDAP +LI Q +LTAA NAK+
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKK 563

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/563 (73%), Positives = 471/563 (83%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+ITLGKYLFERLKQV   TIFGLPGDFNLSLLDKIYEV G+RWAGN NELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YARIKG++ L+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMSA ISETTSMITDIA+A +EIDR I+ T+I+QR  YLGLPAN+VDL VP  +
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L  PIDLSLKPND +AE EV+  +LELI+++KNP+IL+DACASRH+VK ET+ LID TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS+ +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSD++K++ A+F GVQMKF L+ L+  +  VVKGYK               
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               LKQEWLWN++ KFL+EGD++++ETGTSAFGINQT FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDP KR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP A+YNEIQ W HL +LP FGAK YE  ++ATTGEWD L +D  F +NS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           PV DAP +LI QA+LTAATNAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/562 (70%), Positives = 464/562 (82%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS ITLG+YLFERL+QV+C TIFGLPGDFNL LLD+IYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KG+ACLITTFGVGELSALNG+ GSYAEHVGVLHVVGVPSL++QAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF VFHRMSA IS+TT+M+TD+A+A  EIDRCI+ TY++QR VYLGLPAN+V+ MV   +
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDLSL+PND D E EVL  +L L++ A+NPIILADAC SRHD K E   L DATQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E+HPRFGGVYVGTLS P+VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y T+N+VEFHSDH K+R A FP V MKFVL+KL+ ++ + ++ Y                
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L QEWLW Q+G+FL+EGD+V+TETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EE+D  KR I+FIGDGSLQLTVQEIS+M+RW L+PY+FV NN+GYTIEKLI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGPTAQYNEIQNW HL +LPTFGA DYE +RVATTGEWD L +D AFN NS+IR++E+ML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPSNLIAQAKLTAATNAK 562
            VMDAPS+L+ QA+LTAATNA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/564 (72%), Positives = 460/564 (81%), Gaps = 2/564 (0%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS I+LG+YLFERL QV   TIFGLPGDFNL+LLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGMACL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFTVFHRMS+ ISETTS++TD+A A AEIDRCI+ TYI QR VYLG+PAN  DL + A +
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           LNTPIDLSL  ND +AETE +  +L L+KDA NPIIL DACASRHDVK ETK LID TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVG L+ P +K+AVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
             TKN+VEFHSD++KIR ASFPGVQMKFVL+KL  Q+    K YK               
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               +KQEW+WNQ+ KFL+EGDIV++ETGTS FGINQT FP NT GISQVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    EEIDPKKR I+F GDGSLQLTVQEISTM+RWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKD--YETIRVATTGEWDKLASDKAFNENSKIRMIEI 538
           HG  A YNEIQ W HL++   FGAK+  +E  RV+TTGEW+KL   K F +N+KIRMIE+
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPSNLIAQAKLTAATNAK 562
           MLPVMDAP++LI QAKLTA+ NAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/521 (73%), Positives = 428/521 (82%)

Query: 43  MRWAGNCNELNAAYAADGYARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGN NELNAAYAADGYAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SLSAQAKQLLLHHTLGNGDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRT 162
           S ++QAK LLLHHTLGNGDFTVFHRMS+ +SETT+MITD+ +A AEIDRCI+ TYI+QR 
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANMVDLMVPADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACA 222
           VYLG+PAN  DL VPA +LNTPIDL L PN+ +AE E L  ILELIKD+KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLI 282
           SRHDVKAET  LI+ TQFP FVTPMGKG+I+EQHPR+GGVYVGTLS+PEVKKAVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVK 342
           LSVGALLSDFNTGSFSYSY TKNIVEFHSD+IKIR A+FPGVQMKFVL+KL A +  VV 
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 GYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPT 402
           GYK                   LKQ W+WNQ+ KFLKEGD+V+ ETGT  FGIN+T FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNL 462
           N  GISQVLWGSI              EE+DP KR I+F GDGSLQLTVQEISTMIRWNL
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLA 522
           +PY+F+LNNNGYTIEKLIHGPTAQYNEIQ+W HL +L TFGAKDYE  RVATTGEW KL 
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 SDKAFNENSKIRMIEIMLPVMDAPSNLIAQAKLTAATNAKQ 563
            +K FN+NS+IR+IE+MLPVMDAP +LI Q +LTA  NAK 
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/563 (68%), Positives = 448/563 (79%), Gaps = 1/563 (0%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           M++ITLG+YLFERL Q+   TIFGLPGDFNL+LLDKIYEV G+RWAGN NELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+KGMACL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  ++AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DF  FHRMS+ ISETT +++D  +A AEIDRCI+  Y++QR VYLG+PANM D  V + +
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L+TPIDL+L+PN  DAE EVL  I+ +IK +K PIILADAC SRHDVK ETK LI+ TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSIDE  PRFGGVYVG LS PEVK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGY-KXXXXXXXXXXXXXX 359
            NT+N++EFHSDH+KIR A+FPGVQMKFVLEKL+ ++ +VVKG                 
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 360 XXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXX 419
                +KQEW+W  VGKFL+EGD+V+TETGTS FGI ++ FP NT GISQVLWGSI    
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 XXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKL 479
                     +EIDPKKR I+FIGDGSLQLTVQE+ST  RW L PYIFVLNNNGYTIE+L
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIM 539
           IHG T  YN+IQ+W H  ILP FGAK+YE  RVAT GEW+ + +DK FN+N K+RMIE+M
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVMDAPSNLIAQAKLTAATNAK 562
           LP MD P NL  QAKLTA+ NAK
Sbjct: 541 LPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/563 (62%), Positives = 437/563 (77%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS+I++G+YLFERL QV  +TIFGLPGDFNLSLLDK+YEVPG+RWAGN NELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120
           YAR+ GM CL+TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180
           DFT FHRM   I++TT++++D A+A +EIDRCIK   ++   VYLG+PANM    + A +
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           L TPIDLS + ND DAE EV+ A+L LI++A+NPIIL+DACASR+D+K E K LID TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P++VTPMGK S++EQHPR+GGVY G++S+PEVKKAVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXX 360
           Y+TK+IVEFHS    I+ A+F GVQMKFVL+KL  +VG VV+ Y                
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L Q+WLW +V  FLKEGDIV+ E+GT AFGIN+   PT T  ISQ+LWGSI     
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 XXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480
                    +EIDP +R I+FIGDGSLQL VQE+STMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540
           HGP AQYN+IQ W HL +LP FGAK+YE +R++T G W +L  D  FNE+SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPSNLIAQAKLTAATNAKQ 563
           P +D+   L+ QAK+    N+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/548 (57%), Positives = 413/548 (75%), Gaps = 1/548 (0%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I+LG YLF+RL+Q+Q QTIFGLPGDFN++LLDKIYEVPG+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           IKG+ CL+TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  AQ K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHRM+A ++  T++++D  +A  EID+C+K  +  QR VYLG+P N+ +++V   +L  
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           P+DLSLK ND + E +V+ +I++ +K AKNP+I+ADAC +RHDV  ET+ L+D TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           VTPMGKG+IDEQHPRFGGVYVG++S PEV++ V+ AD IL  G +LSDFNT SF++SY  
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           KN+V  +++H K++ A +P +++KFVL+ L+  + ++   YK                  
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WNQ+  +  EGDIV+TETGTSAFGINQT FP NT  ISQVLWGSI        
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 XXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIH-G 482
                 EE+  K R I+F+GDG+LQLTVQEISTMIRW LKPY+FV+NN GYTI++L+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 PTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIMLPV 542
            TA Y++IQ W +L +LP FGA +Y+  +V T G++ KL  D  F  + K++MIE++LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPSNLI 550
           MDAP  L+
Sbjct: 554 MDAPPALL 561

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/546 (49%), Positives = 376/546 (68%), Gaps = 1/546 (0%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           IT+  Y F RLKQ++  TIFGLPG+FN  L+DK+Y + G+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           +KG+ C+I+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  SAQ +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHRM+  +S  +++I D      E+D CI+  YI QR VY+G+P N+V + V +D LN 
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           PIDLS+ PND   E EV+  IL     A NP+I+ADAC +RH ++AET+ L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           VTPMGKGS+DE  P+FGGVY G++S P V++ V+ AD ++ +G +L+DF T +F ++Y  
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
             +V  +   +K + A++P + +K +L  L+A +      Y+                  
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WNQ+ ++  EGD+++TETGTSAFGINQT+FP +T GISQ LWGS+        
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 XXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGP 483
                 +E     R ++F+GDG+ QLT QE+ST+IRW L PYIF++NN GY++++ +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 TAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIMLPVM 543
            A Y +IQ W +  +   FGAKDYE+ ++ T G++  + +D AF+   +IR++EIMLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPSNL 549
           D P  L
Sbjct: 551 DVPQAL 556

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/554 (49%), Positives = 380/554 (68%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I +  YLF RL Q+   TIFGL G+F++ LLDK+Y +P +RWAGN NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHR+++ ++  T++I D      E+D+CIK  +I QR VY+G+P N V+L + +  LNT
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           P+DL L  ND D E EV+  IL  I  ++NP I+ DAC SR ++  ETK L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV++ V+ AD I+ +G +LS+F+T +F + Y T
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           KN    +S  +K++ A++P + +K +L+K++A +      Y+                  
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++  + + GDI++TETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
                 +EI+       K R I+F+GDG+ QLTVQE+ST+++W L PYIFV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMI 536
           + +H  + A Y +IQ W +L +L  FG  +YET ++ T GE+  + SD  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EIMLPVMDAPSNLI 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/554 (49%), Positives = 381/554 (68%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I +  YLF RL Q+   TIFGL G+F++ LLDK+Y++P +RWAGN NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHR+++ ++  T++I D      E+D+CI+  +I QR VY+G+P N V+L + ++ LNT
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           P+DL L  ND D E EV+  IL  I  +KNP I+ DAC SR ++  E K L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV++ V+ AD I+ +G +LS+F+T +F + Y T
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           KN    +S  +K++ A++P + +K +L+KL+A +      Y+                  
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++ ++ + GDI++TETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
                 +EI+       K R I+F+GDG+ QLTVQE+ST+++W L PYIFV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMI 536
           + +H  + A Y +IQ W +L +L  FG  +YET ++ T GE+  + +D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EIMLPVMDAPSNLI 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/549 (49%), Positives = 382/549 (69%), Gaps = 1/549 (0%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYA 62
           +I L +Y+  RL+Q+   TIFG+PG FN+ LL +I  VP M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           RIK +ACL+TTFGVGELSA+NG+AGS+AEHVG+LH VG+P L+AQ ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLN 182
            VFHR+ + +++ TS++TD  +   E+D+CI   +  QR VYLG+P N+ D +V + +LN
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
            P+DLS    + + + + + AIL  +   ++P I+ DAC SRH+V AE + L++ TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
           F TPMGKG+I+E HPRFGG +VG++S P+V++ V+ +D +L VGALLSDFN+ SF ++Y 
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXX 362
            KN     S + +++ A +P +++K  L  L+ ++      Y+                 
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 XXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXX 422
             L+QEW+WNQ+  + +EGDIV+TETGTSAFG+NQ+ FP NT  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHG 482
                   E     R I+F+GDG+LQLTVQE+STMIRW LKP IFV+NN+GYTI++L+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 PT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIMLP 541
            + A Y++IQ W +L +LP FGA DY+T  V T G++  L SD  F  N+KI+M+E++LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPSNLI 550
            MDAP  L+
Sbjct: 554 PMDAPPALM 562

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/548 (50%), Positives = 377/548 (68%), Gaps = 1/548 (0%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           ITL ++L  RL+Q+   TIF +PG F++  + +IY+ P M+WAGN NELNAAYAADGY+R
Sbjct: 15  ITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYSR 74

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           IK + CL TTFGVGELSA+NG+AG++AEHVG+LHVVG+P ++AQ KQLL HHTLGNGD+ 
Sbjct: 75  IKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDYQ 134

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHR+ + +++  +++ D  +   E+D+CI      QR VYLG+P NM +++V + +LN 
Sbjct: 135 VFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLNV 194

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           P+DL     + D E   +  +L  I    NP I+ADAC SRH+V+AE K L+D TQFP F
Sbjct: 195 PLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
            TPMGKGSIDEQHPRFGG +VG++S P+V++ V+ +D +L VGALLS+FNT SF ++Y T
Sbjct: 255 CTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYRT 314

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           KN V   SD+ K++ A +P + +K VL  ++A++      Y+                  
Sbjct: 315 KNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSNV 374

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+W Q+ ++ +EGDIV+TETGTSAFG+NQ  FP++T  I+Q LWGS+        
Sbjct: 375 PLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGACL 434

Query: 424 XXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGP 483
                  E     R I+F+GDG+LQLTVQEISTMIRW L P IF++NN+GYTI++L+H  
Sbjct: 435 GASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHKK 494

Query: 484 T-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIMLPV 542
           + A Y++IQ W +L ILPTFGA +YE   V T G++  L  D  F  N KI+M+E++LP 
Sbjct: 495 SNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLPP 554

Query: 543 MDAPSNLI 550
           MDAP  L+
Sbjct: 555 MDAPPALM 562

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/567 (48%), Positives = 384/567 (67%), Gaps = 8/567 (1%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I++ +YLF RLKQ+  +TIFGLPG FN +LLDK+ E+PG+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHRM++ ++  +++I D      E+D CI   +  Q+ VY+G+P N+VD  V +  LNT
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
            ++L+L  ND   E E++  IL+ +  +KNP+I+ADAC +RH +  ET  L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
            TPM KG+IDE  P FGGV++G++S PEV++ V  AD ++ +G +LSDF+T SF ++Y T
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           K  V  +   +K + A +P +++K ++  L+  +      Y+                  
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+ EW+WNQ+  + +EGDI++TETGTSAFGINQTHFP ++ GISQ LWGS+        
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 XXXXXXEEIDPKK------RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
                  E+   +      R I+F+GDG+ QLTVQE+STMIRW L PYIFV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 KLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMI 536
           + +H  + A Y +IQ W++L ++P FGA+ YET ++ T G++ ++  D  F  N KIRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EIMLPVMDAPSNLIAQAKLTAATNAKQ 563
           EIMLP MD P  L+ +  LT   N K+
Sbjct: 553 EIMLPPMDVPQALMDRW-LTEQENKKR 578

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/570 (48%), Positives = 380/570 (66%), Gaps = 19/570 (3%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGY 61
           SQI++ +YLF RL Q++  TIFGLPGDFN+ LLDK+Y +P MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGD 121
           +R+K + CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVL 181
           ++VF+R++  I+  T++I D      E+D CI+A +  Q+ VYLG+P N VD+ V +  L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 NTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFP 241
           N PIDLS+     + + +V+  +L+ +  A  PII+ DAC  RHD   ET AL + T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  FGGVY G+LS PEV++  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 NTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXX 361
             KN        +KI+KA+FP + +K  L+ LV  +      YK                
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 362 XXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXX 421
              L+QEW+WN++  + KE DI++TETG+SAFGINQT FPTNT GI+Q LWGS+      
Sbjct: 371 SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCS 430

Query: 422 XXXXXXXXEE------------------IDPKKRTIVFIGDGSLQLTVQEISTMIRWNLK 463
                   EE                  I  + RTI+F+GDG+ QLTVQE+ST+IRW LK
Sbjct: 431 CLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLK 490

Query: 464 PYIFVLNNNGYTIEKLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLA 522
           PYIF++NNNGY++++ +H  + A Y ++Q W +L +L  FG   +ET ++ T  ++ +L 
Sbjct: 491 PYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELL 550

Query: 523 SDKAFNENSKIRMIEIMLPVMDAPSNLIAQ 552
           +D++F +  KIRMIEIMLP  D P  LIA+
Sbjct: 551 ADESFAKPDKIRMIEIMLPQSDVPKTLIAR 580

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/554 (49%), Positives = 382/554 (68%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I +  YLF RL Q+   TIFGL G+F++ LLDK+Y++P +RWAGN NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHR+++ ++  T++I D      E+D+CIK  +I QR VY+G+P N V+L + +  LNT
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           P+DL L  ND D E EV+  IL ++  ++NP I+ DAC SR ++  ETK L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV++ V+ AD I+ +G +LS+F+T +F + Y T
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           KN    +S  +K++ A++P + +K +L+KL+A +      Y+                  
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++ ++ + GDI++TETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
                 +EI+       K R I+F+GDG+ QLTVQE+ST+++W L PYIFV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMI 536
           + +H  + A Y +IQ W +L +L  FG  +YET ++ T GE+  L +D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EIMLPVMDAPSNLI 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/554 (48%), Positives = 378/554 (68%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I++  YLF RL Q+   TIFGL G+F++ LLDK+Y +P +RWAGN NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           VFHR+++ ++  T++I D      E+D+CI+  +I QR VY+G+P N V+L + +  LNT
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
           P+DL L  ND D E EV+  IL  +  ++NP I+ DAC SR ++  E+K L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV++ V+ AD I+ +G +LS+F+T +F + Y T
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXX 363
           KN    +S  +K++ A++P + +K +L+KL+A +      Y+                  
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 XLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++  + + GDI++TETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
                 +EI        K R I+F+GDG+ QLTVQE+ST+++W L PYIFV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMI 536
           + +H  + A Y +IQ W +L +L  FG  +YET ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EIMLPVMDAPSNLI 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQVLL 568

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/557 (47%), Positives = 374/557 (67%), Gaps = 9/557 (1%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYA 62
           QIT+  YLF RL+Q++ +TIFGLPG+FN+ LLDKIY +P MRWAGN NELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           RIK + CL+TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLN 182
            VF+RM+  ++  T ++ D      E+D+C++  +  Q+  YLG+P N VDL V +  L+
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
           TP++L  +PN+ + E +V+  IL+ +   +NP I+ DAC  RHD+  ETK     T FP+
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
           FVTPMGKG++DE    FGGV+ G+LS P V++ V+ AD I+ +G+LL++F+T +F + Y 
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXX 362
           TKN    HS  +K++ A++P + +K +++ L++++ +                       
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 XXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXX 422
             LKQEW+WN++  + ++GDI++TE GTSAFGINQT FP  T GISQ LW S        
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 XXXXXXXEEIDP--------KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGY 474
                  +E+          + R ++F+GDG+ Q+T+QEISTMIRW L PYIF+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIEKLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKI 533
           ++++ +H  + A Y ++Q W +L     FGA DYET ++ T G+   + +DK F ++ KI
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEIMLPVMDAPSNLI 550
           RM+EIMLP  D P  L+
Sbjct: 556 RMLEIMLPSTDVPQVLV 572

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/568 (46%), Positives = 373/568 (65%), Gaps = 15/568 (2%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYA 62
           QIT+ +YLF RLKQ+  +TIFGL G++N+ L+DK+Y+V  +RWAGN NELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           R+KG+  LITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLN 182
           +VFHR+++ I+   ++I D      E+D+CI   ++ QR VY+G+P N V+L+V +  L+
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
            P+DL +  N  +  +E+   IL+ I   K+P I+ DAC  RH+   E +     T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
           FVTPMGKG+I+E  P FGGV++G+LS P V++ V+ AD I+ +G++LS+F+T +F + + 
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXX 362
            K+ V   SD +KI+ + +  + +K +++ L+  +      Y                  
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 XXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXX 422
             L+QEW+WN++  + +EGDI++TE GTSAFGINQT FP    GISQ LWGS        
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 423 XXXXXXXEEID--------------PKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFV 468
                  +E +               K R I+F+GDG+ QLT+QE+ST+IRWNL PYIFV
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNNGYTIEKLIHG-PTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAF 527
           LNN GY++++ +H    A Y +IQ W +LD++ TF AK+YET ++ T G++  +  D  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NENSKIRMIEIMLPVMDAPSNLIAQAKL 555
             N KIRM+EI+LP  D P  L+   KL
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/557 (46%), Positives = 369/557 (66%), Gaps = 10/557 (1%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYA 62
           +IT+  YLF RLKQ+  +TIFGLPG+FN+ LLD++Y +PG++WAGN NELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           R+KG+ C+ITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLN 182
            VFHRM+  +S  + +I D      E+D+CI+  Y+ Q+ VYLG+P N V+L V +  LN
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
             +   +  N++D E E +  IL+ I   ++P I+ DAC +R D   ET+  I  T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
           FVTPMGKGSIDE  P FGGV+ G++S P V++ V+ AD ++ +G+LL++F+T +F + Y 
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQV--GSVVKGYKXXXXXXXXXXXXXXX 360
           +KN V    D ++ + + +P + +K +++ +++++  G +                    
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 361 XXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXX 420
               L+QEW+W++   + +EGDI++TE GTS+FGINQ  FP++T GISQ LWGS      
Sbjct: 372 DDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSMG 431

Query: 421 XXXXXXXXXEE-----IDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYT 475
                     E        ++R I+FIGDG+ Q+T+QEISTMIRWNL PYIF+LNN GY+
Sbjct: 432 SCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGYS 491

Query: 476 IEKLIH--GPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKI 533
           I++ +H    T  Y ++Q W +L     FGA DYET ++ T G+  ++  ++ F+   +I
Sbjct: 492 IDRFLHHRKNTTLY-DVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRI 550

Query: 534 RMIEIMLPVMDAPSNLI 550
           RM EIMLP MD P  ++
Sbjct: 551 RMAEIMLPSMDVPKAIV 567

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/593 (45%), Positives = 379/593 (63%), Gaps = 43/593 (7%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYA 62
           ++T+ +YLF RLKQ+   TIFGLPG+FN+SLLDK+Y V GMRWAGN NELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           R+K + CL+TTFGVGELS +NGIAGS++E+VG++H+VG+P +  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLN 182
            +FHR+S  I   ++++T       EID+C+   ++SQ+ VYLGLP N+V + V + +LN
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
           TP+DL L  ND D E   +  IL+ I  AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
           FVTPMGKG +DE   +FGGV+VG++S  +V++ V+ ADLI+ +G L SDF T SF ++Y 
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYK----------------- 345
           TK+IV   S  +K++   +P + +K  L KLV  + +    YK                 
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 346 ----XXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFP 401
                                  LKQEW+WN+   + +EGDI++TETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 TNTYGISQVLWGSIXXXXXXXXXXXXXXEEI---DP---KKRTIVFIGDGSLQLTVQEIS 455
             T GISQ LWGS               EEI   +P   K R I+F+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMIRWNLKPYIFVLNNNGYTIEKLI----------------HGPTAQYNEIQNWKHLDIL 499
           TM++WNL PYIF++NN GY++++ +                      Y +IQ W +L++ 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIMLPVMDAPSNLIAQ 552
             F A +YET +V +  +  K+ + K+F+   +IRM+EI+LP MD P +L+ +
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/568 (44%), Positives = 371/568 (65%), Gaps = 15/568 (2%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGY 61
           S IT+ +Y+F RLKQ++ +TIFGLPG+FN+ L+DK+Y++P +RWAG+ NELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGD 121
           +R+KG+  L+TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVL 181
           + VF R+++ ++  T +I D      E+D+CI+  +  Q+ VY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 NTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFP 241
           N P+ LS   N  D   +V+  +L+ I  + +P+I+ D C  RH    E +  I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P F GV+ G++S P V++ V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 NTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXX 361
            +KN    +SD IK   A++P V +K +L+ L+  +      Y                 
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 XXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXX 421
              L+QEW+WN++  + +EGDI++TETGTSAFGINQT FP    GISQ LWGS+      
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 XXXXXXXXEEID--------------PKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIF 467
                   +E                 K R I+F+GDG+ QLT+QE+ST++RW L PYIF
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNNGYTIEKLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKA 526
           +LNN+GY++++++H  + A Y +IQ W +L+++ TF A D +T ++ T G+   +  D  
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNENSKIRMIEIMLPVMDAPSNLIAQAK 554
           F  +++IRMIE+MLP MD P  L+   K
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALVDTWK 578

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/586 (44%), Positives = 380/586 (64%), Gaps = 24/586 (4%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGY 61
           + ITL  YLF RL Q +  T+FGLPG+FN+ L+DK+  +P ++WAGN NELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGD 121
           ARIKG+ CL+TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVL 181
           +TVFHR+++ ++  ++++ D      EID  I   +  QR VYLG+P N +   + +++L
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 NTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFP 241
           N  +D +L+ N+  ++ +V+  IL+ I   K P+I+ DAC +RH+++ ET+ L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P F GV+ G++S P+V++ ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 NTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVG-SVVKGYKXXXXX--XXXXXXXX 358
            +K+ +   SD+IK R  +F  + +K +++KL+  +  S +K ++               
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQLQENNNGNIYIPNIK 370

Query: 359 XXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXX 418
                 L+QEW+WNQ+  + ++GDI++TETGT+AFGINQT FP N  GISQ LWGS    
Sbjct: 371 LNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTGYS 430

Query: 419 XXXXXXXXXXXEEI--------------------DPKKRTIVFIGDGSLQLTVQEISTMI 458
                       EI                     PK R I+FIGDG+ QLTVQE+ST+I
Sbjct: 431 LGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELSTII 490

Query: 459 RWNLKPYIFVLNNNGYTIEKLIHGPT-AQYNEIQNWKHLDILPTFGAKDYETIRVATTGE 517
           RW L PYIF++NN+GY+ ++ +H  + A Y +I  W +L +L  FGAK YE+ ++ T G+
Sbjct: 491 RWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITVGD 550

Query: 518 WDKLASDKAFNENSKIRMIEIMLPVMDAPSNLIAQAKLTAATNAKQ 563
           ++K+ ++  F  +S +RMIEI+LP MD P  L+ + +L      K+
Sbjct: 551 FEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  490 bits (1261), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 253/560 (45%), Positives = 352/560 (62%), Gaps = 12/560 (2%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYA 62
           QI LGKYLF RL Q+   TIFGLP +FN  LLD+IY++P MRW GN NELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           RIK ++CL+TTFGVGE+S LNGIAGS++EHV VLHVVG+P  SAQ K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLN 182
            +FHR+++ I   T+++ +  +    ID CI   Y  Q+ VY G+P N+   +V +  L+
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKPND--VDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
           +P+ L    N    DA  E++  +LE I  A++P+I+AD CASRHD   E   +   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  R+ GVY+G++S P+V++ V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YNTKNIVEFHSDHIKIR-KASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXX 359
           Y  KNIV     + K+    ++P V++K VL+ L   +      Y               
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVKP 372

Query: 360 XXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXX 419
                L+QEW+W ++  + + GD+++TE GTS  G+NQ  FP+ T  +SQ LWGS+    
Sbjct: 373 DANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYSV 432

Query: 420 XXXXXXXXXXEEID-----PKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGY 474
                     +E          R I+F+GDG+LQLTVQEIST+I+W L PYIFV+NN GY
Sbjct: 433 GACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQGY 492

Query: 475 TIEKLI----HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNEN 530
           TI++L+    H  TA Y  IQ W +L I+P FG  +Y+  +V   G+ D+L  D+ F+  
Sbjct: 493 TIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSNQ 552

Query: 531 SKIRMIEIMLPVMDAPSNLI 550
             ++M+EI+LP MDAP  L+
Sbjct: 553 DILKMVEIILPSMDAPQALL 572

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  484 bits (1247), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 236/553 (42%), Positives = 338/553 (61%), Gaps = 6/553 (1%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGY 61
           S I L +YLF RL+Q+   T FGLP D+N+ LLD +  V  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGD 121
           AR++ ++CL++TFGVGELS +NGIAGS+AEHV VL +VG+P  SAQ ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVL 181
           + VF R+++ I   ++++    +A   +D CI   Y  Q+ VY G+P N+ + M+P+  L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 NTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFP 241
           + P+ L  +P       E++  +L+ I  AK+P+++ DAC +RH    + + L  AT FP
Sbjct: 192 DVPLPLLDEP--CAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  RF GVYVG+LS P+V++ V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 NTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXX 361
             KNI   H+ H ++    FP   ++ +L  LV +                         
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 362 XXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXX 421
              L+ EWLW ++ ++   GDI+++ETGTSAFG+ QT  P     +SQ LWGS+      
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 422 XXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI- 480
                       P +R ++F+GDG+LQLTVQE+STM+R  L P IFVLNN GY+ ++L+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 481 ---HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIE 537
              H   A+Y ++Q W +L + P FGA  Y+   V T GE D L SD AF + S ++M+E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 538 IMLPVMDAPSNLI 550
           + LP MD P  L+
Sbjct: 550 VALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  415 bits (1067), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/563 (40%), Positives = 328/563 (58%), Gaps = 46/563 (8%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGY 61
           S IT+ +YLF RLKQ+  +TIFGLPG+FN+ L+DK+Y++P +RWAGN NELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGD 121
           AR+K + CLITTFGVGELSALNGIAGS++EH+G+LHVV +P L      +L+     NGD
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGD 129

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKAT--YISQRTV--YLGLPANMVDLMVP 177
           +         +     ++T   S +   D  IK    +IS   +  Y     + +     
Sbjct: 130 YKF------PMKARDILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKIPKGKG 183

Query: 178 ADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDA 237
           AD             ++   T  L +     K+          C S + V+ +       
Sbjct: 184 ADXXX---------KNLQCRTSYLSSRSLRFKEQ------CRRCNSDYSVRKQ------- 221

Query: 238 TQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSF 297
            +FP FV P  +    E + +FGGV+ G++S P V++ V+ ADL++ +G  L DF+T SF
Sbjct: 222 -KFPYFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSF 279

Query: 298 SYSYNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXX 357
            +SY  K++V   S ++KIR   +P + +K +L  L+++V S +  Y             
Sbjct: 280 HFSYRAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSKL 339

Query: 358 XXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXX 417
                  L+QEW+WN++  + +E D+++TETGTSAFGINQT FP  ++GISQ LWGS+  
Sbjct: 340 PSKSV--LRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGY 397

Query: 418 XXXXXXXXXXXXEEIDPK-------KRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLN 470
                       +E+           R I+F+GDG+ QLT+QE+STMI+WNLKPYIF++N
Sbjct: 398 SLGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMN 457

Query: 471 NNGYTIEKLI-HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNE 529
           N GY+I++ + H   A+Y +IQ W++L++L  FGA DYE  ++ T  ++  +  D  F  
Sbjct: 458 NQGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFAR 517

Query: 530 NSKIRMIEIMLPVMDAPSNLIAQ 552
           N KIRMIEIMLP MD P +L+ Q
Sbjct: 518 NDKIRMIEIMLPPMDVPQSLMEQ 540

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/601 (33%), Positives = 312/601 (51%), Gaps = 52/601 (8%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY----EVPGMRWAGNCNELNAAYAAD 59
           I  G+Y+FERL     +++FG+PGDFNLSLL+ +Y    +   ++W G CNELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYL 165
                + N +F       +H M    IS +T  + ++  A  ++D+ +   Y   +  Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANMVDLMVPADVLNTPIDLSLKPNDVDA--ETEVLGA----ILELIKDAKNPIILAD 219
            +PA+  D MV A  L T   ++L+ N +      EV+ +    I++L+  +K P ++ D
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLE-NVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGD 270

Query: 220 ACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESA 279
               R     E +  +  T+  +F + MG+  +DE  P F GVY G  S P + +A+ S 
Sbjct: 271 VLCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSC 330

Query: 280 DLILSVGALLSDFNTGSFSYSYNTKNI-VEFHSDHIKI------RKASFPGVQMKFVLEK 332
           DLIL  G L ++ N G +S+S+N     VE HSD++         +    GV    VL +
Sbjct: 331 DLILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNR 390

Query: 333 LVAQVGSV---VKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETG 389
           ++  +      +K                      + Q++L N + ++L  GD+ + ETG
Sbjct: 391 IIQLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETG 450

Query: 390 TSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEE-------------IDPKK 436
           +  F +    FPTN   ISQ  + SI              ++             +D   
Sbjct: 451 SFQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTP 510

Query: 437 RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHL 496
           + I+  GDG+ Q+T+QE+++ +R+ +   IF+ NN+GYT+E+ I GPT  YN+I  WK  
Sbjct: 511 KLILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWT 570

Query: 497 DILPTFGAKD---YETIRVATTGEW-DKLASDKAFNENSKIRMIEIMLPVMDAPSNLIAQ 552
            +L  FG  D    E  +V   GE+ D + S K   E SK+R+IE+ML +MD P  L+A 
Sbjct: 571 KLLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAM 630

Query: 553 A 553
           A
Sbjct: 631 A 631

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  316 bits (810), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 203/601 (33%), Positives = 307/601 (51%), Gaps = 54/601 (8%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYE---VPGMRWAGNCNELNAAYAAD 59
           +IT G+Y+F RL     +++FG+PGDFNL+LL+ +Y+      +RW GNCNELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQL---LLHH 115
           GY+R    + CLITT+GVGELSALNG+AGS+AE V VLH+VGV S     K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I+  Y   +  YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANMVDLMVPA-DVLNTP---IDLSLKPNDVDAETE---VLGAILELIKDAKNPIILAD 219
           +PA+  D+MV   +++  P   ++ ++ P     E++   ++  + +LI ++ NP IL D
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGD 269

Query: 220 ACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESA 279
               R+ V  +  +LI   Q  +F T MGK  IDE +P + G+Y G      V +     
Sbjct: 270 VLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKC 329

Query: 280 DLILSVGALLSDFNTGSFSYSYNTK---NIVEFHSDHIKIRKAS------FPGVQMKFVL 330
           DLIL  G   ++ N G ++  YN     N+VEFHSD+I+   +         GV    VL
Sbjct: 330 DLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVL 389

Query: 331 EKL--VAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTET 388
            +L    Q   +   Y+                   + QE+L + + ++L  GD+++ ET
Sbjct: 390 NRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCET 449

Query: 389 GTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXX-----------XXXXXXXEEIDPKKR 437
           G+  FG+    FP+N   +SQ  + SI                         EEI+ + +
Sbjct: 450 GSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEPK 509

Query: 438 TIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHLD 497
            I+F GDGS Q+T+QE+STM+  N+K  IF+ NN+GYTIE+ I GPT  YN+I  W    
Sbjct: 510 LILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWTK 569

Query: 498 ILPTF----GAKDYETIRVATTGE--WDKLASDKAFNEN---SKIRMIEIMLPVMDAPSN 548
           +   F    G+K     +V +T E    +L   K    N    +I ++E+ + V+D P  
Sbjct: 570 MFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPEQ 629

Query: 549 L 549
           L
Sbjct: 630 L 630

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  301 bits (771), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 172/553 (31%), Positives = 293/553 (52%), Gaps = 34/553 (6%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           I L +YLF RL Q+ C+T+FG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFT 123
             G++C +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNT 183
           +FH              D+    +EID C++  +  +R VY+GL +     +VP+  LN 
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PI--DLSLKPNDVDAET--EVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQ 239
            I   + +K      +T   V+  I+  +  +  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P F G ++GT+S+P V++ + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXX 359
           +Y +KN +   +D +KI     P + +  +L +L+A + +                    
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMIPRVEP 362

Query: 360 XXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXX 419
                L+QE+LW ++  +LK+GD++++E+GTSA G+ Q  FP NT  +SQ +W S     
Sbjct: 363 QPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGYSI 422

Query: 420 XXXXXXXXXXEEIDP--KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
                      ++    K R I+ +GDGSLQ T QE+ST++    KPYIFV+NN GYT++
Sbjct: 423 GACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYTVD 482

Query: 478 KLIHGP----TAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKI 533
           + ++       A Y +IQ W+ L +   F +++Y   R  + GE + L SDK FN++ ++
Sbjct: 483 RTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSDQL 542

Query: 534 RMIEIMLPVMDAP 546
           +++E++LP MD P
Sbjct: 543 KIVELILPSMDVP 555

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  302 bits (773), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 204/618 (33%), Positives = 306/618 (49%), Gaps = 59/618 (9%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY----EVPGMRWAGNCNELNAAY 56
           ++ I+ G+Y+F RL     +++FG+PGDFNLSLL+ +Y    E  G++W G CNELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARI-KGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SLSAQAKQL 111
           AADGY+R    + CL+TTFGVGELSALNG+AGS+AE+V VLH+VGV     S S   +  
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 112 LLHH---TLGNGDFT-----VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRT 162
            +HH    L   +F      V+H M    ++ + + + DI +A  ++D  I+  Y   + 
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANMVDLMVPAD-VLNTP----IDLSLKPNDVDAETEVLGAILELIKDAKNPIIL 217
            Y+ +PA+  D+ V  + ++N P     D    P+ +    ++L  I   +  +K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQL-FDILDRITSWMYSSKTPAIL 260

Query: 218 ADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVE 277
            D    R+ V      LI AT   +F T MGK  IDE +P++ G Y G     +V +  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYN-TKNIVEFHSDHIKI------RKASFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++Y     I++FH ++I+        +  F G+    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVL 380

Query: 331 ---------EKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEG 381
                     +L  Q  S V  Y                    + Q  L   + KFL  G
Sbjct: 381 MELYKGIDVSRLSLQYDSGVTSY---TNETMQLEDPTNDQSNNITQVHLQKVMPKFLSPG 437

Query: 382 DIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP------- 434
           D+V+ ETG+  F +    FPT    ISQ  + SI              ++          
Sbjct: 438 DVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDEN 497

Query: 435 -----KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNE 489
                K R I+F GDG+ Q+T+QE+ST+++ ++   IF+ NNNGYTIE+ I GPT  YN+
Sbjct: 498 IGEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYND 557

Query: 490 IQNWKHLDILPTFGAKDYETIRVATTGEWDKLASD----KAFNENSKIRMIEIMLPVMDA 545
           + +WK   +L  FG  D +           KLA      K+ N    I ++E+ L V+D 
Sbjct: 558 VMSWKWTKLLEAFGDFDRKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDF 617

Query: 546 PSNLIAQAKLTAATNAKQ 563
           P  L       A    K+
Sbjct: 618 PEQLKCMVDAAALKRNKK 635

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  301 bits (770), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 202/605 (33%), Positives = 312/605 (51%), Gaps = 59/605 (9%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYE----VPGMRWAGNCNELNAAYAA 58
           +I LG+Y+FER+     +TIFG+PGDFNLSLL+ IY     + G++W G CNELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSL----SAQAKQLL 112
           DGY+R    + CLITT GVGELSALNGIAG++AE V +LH+VGV PS     SAQ+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SACISETTSMITDIASAQAEIDRCIKATYISQRTVY 164
            H      D  +    HR+        +S ++  + DI+SA  +ID  I   Y   +  Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANMVDLMVPADVLNTPIDLSLKP-------NDVDAETEVLGAILELIKDAKNPIIL 217
           + +PA+  D +V A  L     + L+        ND   + E+   ILE +  +  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 ADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVE 277
           AD    R+D+ +  + L++ T   +F + MGK  +DE +  F GVY G+ S+ +V K  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSY-NTKNIVEFHSDHIKI-----RKASFPGVQMKFVLE 331
           + D +L VG + ++ NTG +SY + N  NIVE H  ++        K  +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLVAQVGSVVK---GYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTET 388
            ++ Q+    K   GY+                   +   +L     KFL  GD+ + +T
Sbjct: 380 DMMTQMIDPTKLHLGYQ--ESIPSRTQEYCGPPHSSVTHSYLQTHFPKFLSSGDVFVVDT 437

Query: 389 GTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPK 435
           G+  FG+    FP++   ISQ  + SI              ++              + +
Sbjct: 438 GSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQ 497

Query: 436 KRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKH 495
            R I+  GDG+ Q+T+QE+++ +R+ +   +F+ NN GYT+E+ I GP   YN+I  W+ 
Sbjct: 498 PRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEW 557

Query: 496 LDILPTFGAKDYE---TIRVATTGEWDKLASDKAFNENSK----IRMIEIMLPVMDAPSN 548
            ++L  FG    E   + +V++  +  +L   K F  + K    +R++E+ML VMD P  
Sbjct: 558 TELLRVFGDPKLENSVSQKVSSADQMSELL--KTFRSSDKRSKLVRLVEVMLGVMDFPEQ 615

Query: 549 LIAQA 553
           L A A
Sbjct: 616 LKAMA 620

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  301 bits (771), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 203/615 (33%), Positives = 309/615 (50%), Gaps = 60/615 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVP----GMRWAGNCNELNAAYAAD 59
           I  G+YL +R+     ++IFG+PGDFNLSLL+ +Y       G+RW G CNELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SLSAQAKQLLLH 114
           GY+R    M+CLITT+GVGELSA+NG+AG++AE V VLH+VGV     S S       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDF-----TVFHRMS----ACISETTSMITDIASAQAEIDRCIKATYISQRT 162
           H    L + +F      V+  M     AC   + + + +I +A  E+D+ I   Y   + 
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLAC---SVAYLDNIETACDEVDKVIFDIYKYSKP 204

Query: 163 VYLGLPANMVDLMV-PADVLNTPIDLSLK---PNDVDAE-TEVLGAILELIKDAKNPIIL 217
            Y+ +PA+  D++V P+++++ P+ ++L+   P     E  EV   +L+ I D+K P I+
Sbjct: 205 GYIFVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAII 263

Query: 218 ADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVE 277
            D    R     E   LI  T   +F T MGK  IDE +P++ G+Y G      V +   
Sbjct: 264 GDVLTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFL 323

Query: 278 SADLILSVGALLSDFNTGSFSYSYN-TKNIVEFHSDHIKI------RKASFPGVQMKFVL 330
             DL+L  G  +++ N G ++Y YN    IVE H ++++        +  F GV    +L
Sbjct: 324 QCDLVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPIL 383

Query: 331 EKLVAQVGSVVKGYKXXXXXXXXXXX-----XXXXXXXXLKQEWLWNQVGKFLKEGDIVL 385
           ++L+ ++      +                         + Q  L N++  +  +GD+V+
Sbjct: 384 KRLLEKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVV 443

Query: 386 TETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKK--------- 436
            ETG+  F +    FP+    ISQ  + SI              ++  PK          
Sbjct: 444 CETGSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEH 502

Query: 437 ----RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQN 492
               R I+F GDG+ Q+TVQE++TM+R  +   I +LNNNGYTIE+ I GPT  YN+I  
Sbjct: 503 SYQPRLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMP 562

Query: 493 WKHLDILPTFGAKDYE---TIRVATTGEWDKLASDKAFNENSK-IRMIEIMLPVMDAPSN 548
           WK   +   FG  D +      V T  E D++  D  + +    I ++E+ L VMD P  
Sbjct: 563 WKWTKLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQ 622

Query: 549 LIAQAKLTAATNAKQ 563
           L +     A   +K+
Sbjct: 623 LQSMVDAAAFKRSKK 637

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  300 bits (769), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 204/615 (33%), Positives = 309/615 (50%), Gaps = 59/615 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY----EVPGMRWAGNCNELNAAYAAD 59
           I  G+Y+F+RL  +  +++FG+PGDFNLSLL+ +Y    E  G+RW G CNELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SLSAQAKQLLLH 114
           GY+R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+      LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYL 165
           H    L + +F      V+H M    ++ + + + DI +A  ++D  I+  Y   +  Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANMVDLMVPAD-VLNTPI----DLSLKPNDVDAETEVLGAILELIKDAKNPIILADA 220
            +PA+  D+ V  D ++N P     D  + P++ +  ++++  I   I  +K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSE-NQLSDIINKITSWIYSSKTPAILGDV 263

Query: 221 CASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESAD 280
              R+ V      LI  T   +F T MGK  IDE +P + G Y G     +V +  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYN-TKNIVEFHSDHIKI------RKASFPGVQMKFVLE-- 331
           L+L  G  +++ N G ++++Y     I++FH ++I++       +  F G+    +L+  
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKEL 383

Query: 332 -------KLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIV 384
                  KL  Q  S V  Y                    + Q  L   + KFL  GD+V
Sbjct: 384 YKRIDVSKLSLQYDSNVTQY---TNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVV 440

Query: 385 LTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------ 432
           + ETG+  F +    FP+    ISQ  + SI              ++             
Sbjct: 441 VCETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKE 500

Query: 433 DPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQN 492
           D K R I+F GDG+ Q+T+QE+ST+++ N+   + + NNNGYTIE+ I GPT  YN++ +
Sbjct: 501 DYKPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMS 560

Query: 493 WKHLDILPTFGAKD----YETIRVATTGEWDKLASDKAFNENSKIRMIEIMLPVMDAPSN 548
           WK   +   FG  D      T+    +    KL   K  N+ S I ++E+ L  +D P  
Sbjct: 561 WKWTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQ 620

Query: 549 LIAQAKLTAATNAKQ 563
           L    +  A    K+
Sbjct: 621 LKCMVEAAALKRNKK 635

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  299 bits (766), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 211/621 (33%), Positives = 308/621 (49%), Gaps = 65/621 (10%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY----EVPGMRWAGNCNELNAAY 56
           ++ I  G+Y+F RL  +  +++FG+PGDFNLSLL+ +Y    E  G+RW G CNELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SLSAQAKQL 111
           AADGY+R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMS----ACISETTSMITDIASAQAEIDRCIKATYIS 159
            LHH    + N +F      V+H M     AC   + + + DI +A  ++D  I+  +  
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVAC---SVAYLEDIETACVQVDNVIRDIFKY 198

Query: 160 QRTVYLGLPANMVDLMVPADVLNTPIDLSLK-----PNDVDAETEVLGAILELIKDAKNP 214
            +  Y+ +PA+  D+ V AD L     +S +     P +V    +++  I   +  +K P
Sbjct: 199 SKPGYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQL-LDIIDKITSWMYSSKTP 257

Query: 215 IILADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKK 274
            IL D    R+ V      LI  T+  +F T MGK  IDE +P + G Y G     +V K
Sbjct: 258 AILGDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYK 317

Query: 275 AVESADLILSVGALLSDFNTGSFSYSYN-TKNIVEFHSDHIKI------RKASFPGVQMK 327
             ES DL+L  G  +++ N G ++++Y     I++FH ++I+        +  F GV   
Sbjct: 318 HFESCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFV 377

Query: 328 FVLE---------KLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFL 378
            VL+         +L  Q  S V  Y                    + Q  L   +  FL
Sbjct: 378 PVLKELYKLIDVARLSLQYDSNVTSY---TNETMQIEDLTDDQSSIITQAHLQKVMPGFL 434

Query: 379 KEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------ 432
             GD+V+ ETG+  F +    FPT    ISQ  + SI              ++       
Sbjct: 435 NPGDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHIN 494

Query: 433 ------DPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQ 486
                 D K R I+F GDG+ Q+T+QE+ST+++ N+   I + NNNGYTIE+ I GPT  
Sbjct: 495 GSNVKEDYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRS 554

Query: 487 YNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENS----KIRMIEIMLPV 542
           YN+I +WK   +   FG  D +           KLA      +NS    +I ++E+ L V
Sbjct: 555 YNDIMSWKWTKLFEAFGDFDGKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGV 614

Query: 543 MDAPSNLIAQAKLTAATNAKQ 563
           +D P  L    +  A    K+
Sbjct: 615 LDFPEQLKCMVEAAALKRNKK 635

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 192/593 (32%), Positives = 303/593 (51%), Gaps = 53/593 (8%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY------EVPGMRWAGNCNELNAAYA 57
           +  G Y+F+RL     ++IFG+PGD+NL+LL+ +Y      +   + W G CNELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHT 116
           ADGY+R    + C++TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGL 167
           L N         ++ VF  M    +S +T  I ++ +A  E D  I+  Y   +  Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANMVDLMV-PADVLNTP-IDL----SLKPNDVDAETEVLGAILELIKDAKNPIILADAC 221
           P N   L V P ++  TP I L    ++ P+ ++    +   I   +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 ASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADL 281
             R+   +     I  T   +F T MGK  +DE    + GVY G     +V+KA+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFSYS-YNTK--NIVEFHSDHIKI----RKAS--FPGVQMKFVLEK 332
           IL  G   ++ N+G++++  Y +K   I+EFH  +I++     K++  F GV+  ++L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LVAQVG-SVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTS 391
           ++  V  S +                       + Q+ +   +  ++K GD+VL +TGT 
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGTF 443

Query: 392 AFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------DPKKRTI 439
            F +    F +    +SQ  + SI               +             + K R I
Sbjct: 444 QFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRLI 503

Query: 440 VFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHLDIL 499
           +F GDG+ Q+TVQE+STM+R+ +   IF+ NN+GYTIE+ I GPT  YN+IQ W    + 
Sbjct: 504 LFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYLF 563

Query: 500 PTFG------AKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIMLPVMDAP 546
             FG      AK++   +V TT E D + ++    + + I  +E+ L +MD P
Sbjct: 564 KAFGDAKENFAKNH---KVETTKELDNILTELRSKDQNNINFVEVTLGIMDMP 613

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 207/615 (33%), Positives = 310/615 (50%), Gaps = 59/615 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY----EVPGMRWAGNCNELNAAYAAD 59
           +  G+Y+F RL  +  +++FG+PGDFNLSLL+ +Y    E  G++W G CNELNAAYAAD
Sbjct: 25  MPFGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SLSAQAKQLLLH 114
           GY+R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+  LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLH 144

Query: 115 H---TLGNGDFT-----VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYL 165
           H    L + +F      V+H M    ++ + + + DI +A  ++D  I+  Y   +  Y+
Sbjct: 145 HLVPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYV 204

Query: 166 GLPANMVDLMVPAD-VLNTPIDLSLKPNDVDAETEVLGAILEL---IKDAKNPIILADAC 221
            +PA+  D+ V  D ++N P           +ET++   I ++   +  ++ P IL D  
Sbjct: 205 FVPADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVL 264

Query: 222 ASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADL 281
             R+ V      LI A++  +F T MGK  IDE +P + G+Y G     +V +  ES DL
Sbjct: 265 TDRYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDL 324

Query: 282 ILSVGALLSDFNTGSFSYSYN-TKNIVEFHSDHIKI------RKASFPGVQMKFVLE--- 331
           IL  G  +++ N G +S++Y     I++FH ++I+        +  F GV    VL+   
Sbjct: 325 ILHFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELY 384

Query: 332 ------KLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVL 385
                 KL  Q  S V  Y                    + Q  L   + KFL  GD+V+
Sbjct: 385 QCIDVSKLSLQYDSRVTPY---TNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVV 441

Query: 386 TETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP----------- 434
            ETG+  F +    FPT    ISQ  + SI              ++  P           
Sbjct: 442 CETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINE 500

Query: 435 --KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQN 492
             K R I+F GDG+ Q+T+QE+ST++++++   I + NNNGYTIE+ I GPT  YN+I +
Sbjct: 501 GYKPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMS 560

Query: 493 WKHLDILPTFGAKD--YETIRVATTGEWDKLASDKAFNENS--KIRMIEIMLPVMDAPSN 548
           WK   +   FG  D  Y    +  T     L      N ++  +I ++E+ L V+D P  
Sbjct: 561 WKWTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQ 620

Query: 549 LIAQAKLTAATNAKQ 563
           L    +  A    K+
Sbjct: 621 LRCMVEAAALKRNKK 635

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  294 bits (752), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 190/596 (31%), Positives = 310/596 (52%), Gaps = 44/596 (7%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYE----VPGMRWAGNCNELNAAYA 57
           +++ LG+Y+F RL     +T+FG+PGDFN+ LL+ +Y       G++W G CNELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-IKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   +AQ    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVY 164
           HH    L N +F      V+  M S  +S     + D+ +A  +ID  I+  +   +  Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANMVDLMVPA-DVLNTPIDL----SLKPNDVDAETEVLGAILELIKDAKNPIILAD 219
           L +PA+M ++ V + +++  P  +     L+  ++ A   +   IL+ +  +  P IL D
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSSTPAILCD 267

Query: 220 ACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESA 279
               R  +  + + L++ T   +F T MGK  +DE  P + GVY G  S+ E    ++  
Sbjct: 268 GLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSK-ERNALLQEC 326

Query: 280 DLILSVGALLSDFNTGSFSYSYNTKN-IVEFHSDHIKIRKASFPGV----QMKFVLEKLV 334
           DLIL +G +  + NT  +++ +N ++ I+E H +++ + +     +     +  VL  ++
Sbjct: 327 DLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSIL 386

Query: 335 AQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFG 394
           A +      +                    + Q  L + + + L  GD+++ +TGT  F 
Sbjct: 387 AHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTFQFS 446

Query: 395 INQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEE-----IDPK-------KRTIVFI 442
           +    FPT+   ISQ  + SI               E     + PK        R ++  
Sbjct: 447 VFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVLCE 506

Query: 443 GDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHLDILPTF 502
           GDG+ Q+T+QE+ST IR+ L   + + NN+GYT+E++I GPT  YN+I +W    +L  F
Sbjct: 507 GDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLRVF 566

Query: 503 GAKD---YETIRVATTGEW-DKLASDKAFNENSKIRMIEIMLPVMDAPSNLIAQAK 554
           G  D    E++RV       + L+S K+  + SKIR++E++L  MD  + L   AK
Sbjct: 567 GDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAK 622

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  288 bits (737), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 205/626 (32%), Positives = 311/626 (49%), Gaps = 73/626 (11%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY-------EVPGMRWAGNCNELNA 54
           + ITL +Y+F RL+     ++FG+PGDFNL LL+ +Y       EV  + W G CNELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  AYAADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSA-QAKQLL 112
           AYAADGY+R    + CL+TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHT---LGNGDFTVFHRMSAC---ISETTSMI-----TDIASAQA-----EIDRCIKAT 156
           +HH+   L N +  V +  + C   ++  T+ +     +DI +  +     +ID+ IK  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YISQRTVYLGLPANMVDLMVPADVL----NTPIDLSLKPNDVD----AETEVLGAILELI 208
           +IS +  YL +P+NM ++MV +  L       +D +LK    +     E +++  I +L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KDAKNPIILADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLS 268
             +K P IL D    R D + +   LI      +F T +GK  IDE + RF G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 RPEVKKAVESADLILSVGALLSDFNTGSFSYSYNTKN-IVEFHSDHIKIRKAS------F 321
              VK   ES DLIL +G   ++ NTG +S+SY     I+E   D+IKI K         
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFVLEKLV-------------AQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQE 368
             + ++ V++KL+               V S                         + Q+
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 369 WLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXX------ 422
            L  ++     +GD+V+ ETG+  F I    FP  T  I+Q  + SI             
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 423 ------XXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTI 476
                        E+  PKK  I+F GDG+ Q+T+QE+S+++R+ +   IF+ NNNGYT+
Sbjct: 495 MRDYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTV 553

Query: 477 EKLIHGPTAQYNEIQNWKHLDILPTFG--AKDYETIRVATTGEWDKLASDKAFNENSK-- 532
           E++  G    YN+I  WK +++L  FG   K +      +T +  +   D+  N N +  
Sbjct: 554 ERIFEGEKRSYNDIMPWKWVNLLKVFGDHEKTFSKSTTISTVQELRCKIDELKNANPQKI 613

Query: 533 IRMIEIMLPVMDAPSNL---IAQAKL 555
           I +IE+ L  MD P NL   + Q KL
Sbjct: 614 IELIEVKLGEMDIPKNLKHIVEQMKL 639

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  283 bits (724), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 191/605 (31%), Positives = 303/605 (50%), Gaps = 50/605 (8%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVP----GMRWAGNCNELNAAYAA 58
           +I  G+YLF++L Q   ++IFG+PGD+NL LL+ +Y+      G RW   CNELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTL 117
           DGY+R    +A LITT+GVGELSA+NG+AGS AE+V VLH+VGV  + + A +   HH +
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 118 ---------GNGDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLP 168
                    G      +  +   ++ +   + DI +A  ++D+ I   Y   +  YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANMVDLMVPADVLNTPIDL--SLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHD 226
           A+  D +V    LN  I+L  S++    +    ++  +L+ I  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVG 286
           + ++    I+ TQ  +F T MGK  IDE +PR+ G+Y G      V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYNTK-NIVEFHSDHIKI------RKASFPGVQMKFVLEKLVAQVG- 338
              ++ N  +  + Y  +  ++EFH  +I++       +  F  V    VL  L  ++  
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRIDI 372

Query: 339 ---SVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGI 395
              ++                        + Q +L  +  + L  GDI++++TG+  FG+
Sbjct: 373 SKLNLQYDKAIFTTYEPSQLNLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFGV 432

Query: 396 NQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP-------------KKRTIVFI 442
                PT +  ++Q  W SI              ++                K + ++ +
Sbjct: 433 RDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLGV 492

Query: 443 GDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHLDILPTF 502
           GDG+ Q+TVQE++TM+R+++   +FV NNNGYTIE+ I G  + YN+I  W+   +   F
Sbjct: 493 GDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEAF 552

Query: 503 G---AKDYETIRVATTGEWDKLASDKAFNENSK-IRMIEIMLPVMDAPSNLIAQAKLTAA 558
           G    K   +  V T  E D+   D   N+  K I ++E+ L VMD P+ L  Q  L+  
Sbjct: 553 GDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL--QMMLSNM 608

Query: 559 TNAKQ 563
            NAK+
Sbjct: 609 KNAKK 613

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 193/604 (31%), Positives = 305/604 (50%), Gaps = 61/604 (10%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVP----GMRWAGNCNELNAAYA 57
            QI  G+Y+F+R+     +++FG+PGDFNL LL+ +Y+      G+RW G CNELNAAYA
Sbjct: 23  DQIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYA 82

Query: 58  ADGYARI-KGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SLSAQA---KQLL 112
           ADGY+R  +G+ CLITT+GVGELSA+NGIAG++AE+V +LH+VGV  S+ +Q    KQ  
Sbjct: 83  ADGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRN 142

Query: 113 LHH---TLGNGDFT-----VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTV 163
           LHH    L + +F+     +++ M    IS +T  + +I +A  ++D+ I   Y   +  
Sbjct: 143 LHHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPG 202

Query: 164 YLGLPANMVDLMVPA-DVLNTPI----DLSLKPNDVDAETEVLGAILELIKDAKNPIILA 218
           Y+ +P + V++MV   ++L  P     D  L+ + ++   ++   IL+ I  +K+P I+ 
Sbjct: 203 YIFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIG 262

Query: 219 DACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVES 278
           D    R+         I  T+  +F T  GK  I+EQ+P + G+Y G      V      
Sbjct: 263 DVLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLK 322

Query: 279 ADLILSVGALLSDFNTGSFSYSYNTK-NIVEFHSDHIKI------RKASFPGVQMKFVLE 331
            DLI++VG  +++ N G +++SY     ++E H  +I++       +  F G+    VL+
Sbjct: 323 CDLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLK 382

Query: 332 KLVAQVG----------SVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEG 381
           +++ ++           SV K                      + Q +L   V  +L +G
Sbjct: 383 RMLIKIDIKRFDFDYDPSVTK----FDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDG 438

Query: 382 DIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK------ 435
           D+++ ETG   F       P     I+Q  + SI              ++  P+      
Sbjct: 439 DVLVVETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGK 497

Query: 436 ------KRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNE 489
                  R I+  GDG+ Q+TVQE+S+ IR+N+   I +LNN+GYTIE+ I GPT  YN+
Sbjct: 498 IPETYNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYND 557

Query: 490 IQNWKHLDILPTFGAKDYETIRVATTGEWDKLASD----KAFNENSKIRMIEIMLPVMDA 545
           I  W    I    G  D +     T     KL +     K   E +KI  IE++L V+D 
Sbjct: 558 IMAWNWTKIFEALGDFDNKATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDY 617

Query: 546 PSNL 549
           P  L
Sbjct: 618 PEQL 621

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 195/607 (32%), Positives = 305/607 (50%), Gaps = 63/607 (10%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY---------EVPGMRWAGNCNELNA 54
           IT G Y+F+RL  +  +++FG+PGDFNL LL+ +Y         E   +RW G CNELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSL----SAQAK 109
           AY+ADGY+R    ++CLITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQ 160
              LHH + + D          V+H M    IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RTVYLGLPANMVDLMVPA-DVLNTP---IDLSLKPNDVDAE------TEVLGAILELIKD 210
           R  YL +P+N  D++V   ++++ P   +D +L  N +D+        ++   IL+++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPIILADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRP 270
           ++ P ++ D    R+  K      I+ T+  +FVTP+ K +IDE +  + G+Y G  S  
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 EVKKAVESADLILSVGALLSDFNTGSFSYSY--NTK---------NIVEFHSDHIKIRKA 319
           +V +  E++DL+L  G   ++ NTG +S+SY  NT           +VE+ + H    + 
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHS--EL 380

Query: 320 SFPGVQMKFVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLK 379
            +  V    +L++L+  +      +K                   + Q  L         
Sbjct: 381 IYRDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQASLGQAFPSTFN 440

Query: 380 EGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEID------ 433
            GDI++ +TG   F I    F +    I+Q  + SI              ++        
Sbjct: 441 PGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAMQDYPLEHVYD 500

Query: 434 ----PKK---RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQ 486
               PK    R I+  GDG+ Q+TVQE+STMIR  +   I++ NN+GYTIE+ I GPT  
Sbjct: 501 KSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTIERAIMGPTRS 560

Query: 487 YNEIQNWKHLDILPTFG---AKDYETIRVATTGEW-DKLASDKAFNENSKIRMIEIMLPV 542
           YN+I  W    +L +FG    K   ++ + T  +   KL   K  + N  I  +E+ML  
Sbjct: 561 YNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKCIEFMEVMLGK 620

Query: 543 MDAPSNL 549
           +D P  L
Sbjct: 621 VDYPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  281 bits (719), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 191/604 (31%), Positives = 304/604 (50%), Gaps = 62/604 (10%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPG---MRWAGNCNELNAAYAAD 59
           +I LG+YL  RL  +  ++ FG+PGDFNL LL+ +Y   G   + W G CNELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSLSAQAKQLL---LH 114
           GY+R    + CLITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  ++ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYL 165
           H         + + +F ++++M    IS  +  +TDI ++  +ID  I   +   +  Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANMVDLMVPA-DVLNTP-IDLS--LKPNDVDAETEVLGAILELIKDAKNPIILADAC 221
            +P++  + +V + +++N P I+LS  L    ++    +   I++LI ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 ASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADL 281
             R          I  T+F +F T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-NTKNIVEFHSDHIKIRKAS---------FPGVQMKFVLE 331
            L  G  +++ N+G++S+ +     I+E + +++KI K           +P V M  +LE
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLVAQVG---------SVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGD 382
            L+A+V            VK Y                    + Q  L  ++  FL  GD
Sbjct: 376 GLIAKVNIHDANTNYDKSVKSYDTSELVLPLQQEDEEK----ITQVHLQRELPNFLNPGD 431

Query: 383 IVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK------- 435
           +++ ETG+  F +    FP+N   ISQ  + SI              ++  PK       
Sbjct: 432 VLVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDHS 490

Query: 436 ------KRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNE 489
                  R I+  GDG+ Q+TVQE++TM+R  +   IF+ NNNGYT+E+ I GP   YN+
Sbjct: 491 LARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYND 550

Query: 490 IQNWKHLDILPTFGAKDYETIRVATTGEWDKLASD----KAFNENSKIRMIEIMLPVMDA 545
           I  W    +L   G  + E  R  T  +  +L+      K   +N+ I++IE+ L   D 
Sbjct: 551 IMPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDI 610

Query: 546 PSNL 549
           P  L
Sbjct: 611 PRQL 614

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  278 bits (710), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 195/615 (31%), Positives = 298/615 (48%), Gaps = 58/615 (9%)

Query: 3   QITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVP----GMRWAGNCNELNAAYAA 58
           +I LGKYLF+R+     ++IFG+PGDFNL LL+ +YE      G+RW G CNELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTL 117
           DG++R    + CLITT+GVGELSALNG+AG++AE+V +LH+VGV   SA+ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GN--------GDFTVFHRM---SACISETTSMITDIASAQAEIDRCIKATYISQRTVYLG 166
            N         +  V++ M     C S     + +I  A  +ID+ I+  Y   +  Y+ 
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCS--AEYLENIDQACDQIDKVIRDIYRYSKPGYIF 204

Query: 167 LPANMVDLMVP-ADVLNTP-IDLS---LKPNDVDAETEVLGAILELIKDAKNPIILADAC 221
           +P + V+ +V   ++L TP IDL     +P++V    EV   I + I  + NP ++ D  
Sbjct: 205 IPVDFVNELVETTNLLVTPVIDLESSLARPDEVTV-IEVAQMIADWIYQSGNPGLVGDVL 263

Query: 222 ASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADL 281
             R+D        I  T+  +F T  GK  IDE +P + G+Y G      V       DL
Sbjct: 264 TDRYDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDL 323

Query: 282 ILSVGALLSDFNTGSFSYSY--NTKNIVEFHSDHIKIRKAS------FPGVQMKFVLEKL 333
           +L+ G  +++ N G +++ Y  N+K IVE H  +++           F G+   FVL++L
Sbjct: 324 VLNFGLDINEINHGHYTFKYKPNSK-IVELHPTYVRFLDTEYGTERLFKGLNFVFVLKEL 382

Query: 334 VAQVG--SVVKGYKXXXXXXXXXXXXX------XXXXXXLKQEWLWNQVGKFLKEGDIVL 385
           + ++     +  Y                          + Q  L   +  +L  GDIV+
Sbjct: 383 INRINPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVV 442

Query: 386 TETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------- 432
            ETG+  F +     P     +SQ  + SI              ++              
Sbjct: 443 CETGSFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDH 502

Query: 433 DPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQN 492
           + K R I+  GDG+ Q+TVQE+++MIR+ +   I + NNNGYT+E+ I GPT  YN+I  
Sbjct: 503 NYKPRLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMP 562

Query: 493 WKHLDILPTFG---AKDYETIRVATTGEWDKLASDKAFNENSK-IRMIEIMLPVMDAPSN 548
           W    +   FG    K   +  + TT +     +      N   I M+E+ L VMD P  
Sbjct: 563 WDWTKLFAAFGDFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDIIEMVEVKLGVMDYPHQ 622

Query: 549 LIAQAKLTAATNAKQ 563
           L    +       +Q
Sbjct: 623 LKHMVEAAKVRQVRQ 637

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  274 bits (700), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 179/604 (29%), Positives = 301/604 (49%), Gaps = 54/604 (8%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIY----EVPGMRWAGNCNELNAAYAAD 59
           + LG+YL+ +L Q+  +TIFG+PGDFNLSLL+ +Y    +  G++W G CNELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPA 169
              ++        V+  M +  +    + ITD+  A+ +I+  IK  +      Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NMVDLMVPADVLNTPIDLSLKPNDVDAETEVLGA---------ILELIKDAKNPIILADA 220
           +  D ++P  V        + P +   E  +L +         IL L+  +K P I+ D 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLEMVSVCDYILSLLYSSKTPCIIGDI 265

Query: 221 CASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESAD 280
              R  V  +   LI  T+  +F T M KG ++E +P + GVY G LS+  + K ++  D
Sbjct: 266 LVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQMCD 325

Query: 281 LILSVGALLSDFNTGSFSYSYNTKNI-VEFHSDHIKIR------KASFPGVQMKFVLEKL 333
           LI+  G + ++ NTG +S++Y   ++ ++ H D+++I       +  + G++ +  ++ +
Sbjct: 326 LIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFRTFVDMV 385

Query: 334 V--AQVGSVVKGYKXXXXXXXXXXXXXXXXXX--XLKQEWLWNQVGKFLKEGDIVLTETG 389
               Q  S+   Y                      +  ++L   + +++  GD+V+ ETG
Sbjct: 386 TKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINPGDVVVCETG 445

Query: 390 TSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEE--------------IDP- 434
           +  F +  T   ++   I+Q  + SI               +              + P 
Sbjct: 446 SIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKKSSHSNVPPN 505

Query: 435 -KKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNW 493
            K R I+  GDG+ Q+TVQEI+ +I++ +   I +LNN GYTIE+ I G   ++N+I  W
Sbjct: 506 YKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGADKEFNDICEW 565

Query: 494 KHLDILPTFGAKDYETIR----VATTGEWDKLASDKAFNENSKIRMIEIMLPVMDAPSNL 549
               +L   G    ET       +TT  ++KL   K +        +E++L  ++ P+ L
Sbjct: 566 NWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVILNKLNIPTTL 625

Query: 550 IAQA 553
           I  A
Sbjct: 626 IKMA 629

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  273 bits (699), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 188/596 (31%), Positives = 304/596 (51%), Gaps = 52/596 (8%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYE-----VPG-MRWAGNCNELNAA 55
           ++I  GKY+F RL+    +++FG+PGD+NL+LL+++Y+      P  ++W G CNELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLH 114
           YAADGY+R    + CLITT+GVGELSA+NGIAG++ E+V +LH+VGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRM-SACISETTSMITDIASAQAEIDRCIKATYISQRTVYL 165
           H + N +        + +   M    IS +T  + +IA+A  + D  ++  + + +  +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANMVDLMVP-ADVLNTP---IDLSLKPNDV--DAETEVLGAILELIKDAKNPIILAD 219
            +P    +LMV  A++   P   ++ S+ P+ +  D+   +     +LI  +K P I+ D
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAIIGD 275

Query: 220 ACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESA 279
               R         LI  T   +F T MGK  I+E +  + G++ G   + EV   +   
Sbjct: 276 ILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQC 335

Query: 280 DLILSVGALLSDFNTGSFSY-SYNTKN--IVEFHSDHIKIRKAS------FPGVQMKFVL 330
           DLIL  G   ++ N+G ++  +Y  KN  I+EFHS++IKI+  S      +  +    VL
Sbjct: 336 DLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIHVL 395

Query: 331 EKL--VAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTET 388
           ++L  +     ++  Y                    + Q+++ + + K L  GDI+L +T
Sbjct: 396 KRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLCDT 455

Query: 389 GTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEE------------IDPKK 436
           GT  F +     P     ISQ  + SI              ++            I  + 
Sbjct: 456 GTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKTQP 515

Query: 437 RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHL 496
           + I+  GDG+ Q+T+QEIST+IR+ +   IF+ NN+GYTIE+ I GPT  YN+IQ W   
Sbjct: 516 KLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWNWT 575

Query: 497 DILPTF--GAKDY-ETIRVATTGEWDKLAS---DKAFNENSKIRMIEIMLPVMDAP 546
            ++ +F    K + +T +V    E+  L +      FNE+S +  IE+ L  +D P
Sbjct: 576 MLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVP 630

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  274 bits (700), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 194/611 (31%), Positives = 296/611 (48%), Gaps = 68/611 (11%)

Query: 2   SQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVP-------GMRWAGNCNELNA 54
           +QI  G Y+F+RL  V  ++IFG+PGD+N+ LL+ +Y+          + W G CNELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSLSAQA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  L  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMS----ACISETTSMITDIASAQAEIDRCIKAT 156
           +   LHH L           D+ V+  M     AC   +   + D+ +A  ++D+ I+  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVAC---SVEYLDDLETACDKVDKVIEDI 236

Query: 157 YISQRTVYLGLPANMVDLMVPADVLNTPIDLSLKP----NDVDAETEVLGAILELIKDAK 212
           Y   +  YL +P + VD +V    L     ++L+     + VD    V   IL L+  + 
Sbjct: 237 YKYSKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSA 296

Query: 213 NPIILADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEV 272
           +P ++ D    R+ ++ E    I+      F T  GK  IDE  P + G Y G  S P V
Sbjct: 297 SPAVIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTV 356

Query: 273 KKAVESADLILSVGALLSDFNTGSFSYSYNTK-NIVEFHSDHIKI------RKASFPGVQ 325
            + + + DL+L  G   ++ N G++++ + +   IVE H  +I+       ++  + GV 
Sbjct: 357 SEKLLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVS 416

Query: 326 MKFVLE---------KLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGK 376
              +L+         +L  Q  S  K Y                    + Q  L   +  
Sbjct: 417 FVDILDLLNQSPELSELSFQYNSKFKAY-TIEELNLDERDFGNDETSDITQGTLQKSMPN 475

Query: 377 FLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI---- 432
           +L  GD+++++TGT  F I     P+    I+Q  + SI               +     
Sbjct: 476 YLNPGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHH 535

Query: 433 --DPKK-------RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGP 483
             D +K       + I+F GDG+ Q+TVQE+STMIR  +   IF+ NNNGYTIE++I GP
Sbjct: 536 VWDVEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGP 595

Query: 484 TAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEW-----DKLASDKAFNENSKIRMIEI 538
           T  YN+IQ WK   +L  FG  D +  R AT  E      +KL+  K  +    I  +E+
Sbjct: 596 TRPYNDIQPWKWTKLLEAFGDFDGKHSR-ATVLETRSQLENKLSELKYKDHRRGIDFMEV 654

Query: 539 MLPVMDAPSNL 549
            L  MD PS L
Sbjct: 655 KLATMDVPSQL 665

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  272 bits (696), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 184/601 (30%), Positives = 307/601 (51%), Gaps = 56/601 (9%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYE----VPGMRWAGNCNELNAAY 56
           +  I  G Y+FERL     ++IFG+PGDFNL LL+ +Y+      G++W G CNELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSLSAQAKQLL-- 112
           AADGY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVY 164
            +HH +   D          F  +   +  +++ + DI +A   +D+ I     + +  Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANMVDLMVP-ADVLNTPI---DLSLKPNDVDAETEVLG-AILELIKDAKNPIILAD 219
           + +P +  D +V   +++  PI   D  ++    +  T++ G  +L+ I ++  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESA 279
               R +++ E +  I+     ++ T MGK ++DE++P++ G+Y G  +  E++  V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYN--------TKNIVEF----HSDHIKIRKASFPGVQMK 327
           DLIL  G   ++ N G +S+ +N        + NI++F      +   + +A+F  V +K
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFIDIKDKNASTVEEANFVSV-LK 387

Query: 328 FVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTE 387
           +V + L     S                         + Q+ L   +  +  +GD+++ E
Sbjct: 388 YVNDNLDKSKLSF-----SYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVE 442

Query: 388 TGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXX----------XXXXXXEEIDPKK- 436
           TG+  FG+    F      I+Q  + SI                        + + PK  
Sbjct: 443 TGSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDY 502

Query: 437 --RTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWK 494
             R I+  GDG+ Q+T+QE ++ IR+ +   I V NNNGYT+E+ I+GPT  YN+I  +K
Sbjct: 503 IPRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFK 562

Query: 495 HLDILPTFG---AKDYETIRVATTGEWDKLASD-KAFNENSKIRMIEIMLPVMDAPSNLI 550
              +L  FG    K  E++ V    E  +L +  K+  E + I++ E+MLPVMD P  L 
Sbjct: 563 WTALLNVFGDFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQELN 622

Query: 551 A 551
           A
Sbjct: 623 A 623

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 177/574 (30%), Positives = 290/574 (50%), Gaps = 35/574 (6%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEV--PGMRWAGNCNELNAAYAA 58
           MS + LG YLF RL QV  +T+FG+PGDFNL+LL+ +Y      ++W GN NELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLL---HH 115
           DGY+RI    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ A+     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSACISETTSMITD--IASAQAEIDRCIKATYISQRTVYLGL 167
                 T    D  V+ +++   S  T  ++D  +   Q +ID  I++ +   +  YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANMVDLMVPADVLNTPIDLSLKPN---DVDAETEVLGAILELIKDAKNPIILADACASR 224
           P+N+ D  +P D LN  ++         D  A +E++   L+ I  ++NP  + D    R
Sbjct: 180 PSNLPDAEIPVD-LNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIVDQFM-R 237

Query: 225 HDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILS 284
            D++ +    ++   F  + T   +G  DE  P F GV+   LS     + ++  D IL 
Sbjct: 238 FDLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILH 296

Query: 285 VGALLSDFNTGSF----SYSYNTKNIVEFHSDHIKIRKAS--FPGVQMKFVLEKLVAQVG 338
           +G   ++ N  S+    S   + K+++    D+ ++        G+      E+L+ ++ 
Sbjct: 297 LG---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMN 353

Query: 339 S--VVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGIN 396
           S  + K                      + Q  L   V   L+E D+++ E  +  F + 
Sbjct: 354 SKTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFEMP 413

Query: 397 QTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEIST 456
              +      + Q  +GSI              ++     R I+F GDGS Q+T+QE+++
Sbjct: 414 NIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQELAS 473

Query: 457 MIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNE-IQNWKHLDILPTFGAKDYE---TIRV 512
            IR+ + P IF+LNN+GY++E++I GPT  YN+ I +W   +IL  FG ++ +   + +V
Sbjct: 474 YIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSYKV 533

Query: 513 ATTGEWDKLASDKAFNENSKIRMIEIMLPVMDAP 546
              GE   + + +    + KI+M+EI+L  MD P
Sbjct: 534 EKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  239 bits (609), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 163/563 (28%), Positives = 262/563 (46%), Gaps = 15/563 (2%)

Query: 5   TLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARI 64
           T+G YL  RL Q   +  F +PGD+NL LLDK+ E P +     CNELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTV 124
           KG+A ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVD-LMVPADVLNT 183
            + M+  I+     I     A + ID  I+     ++  Y+ +P NM   +  P   +++
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 184 PIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSF 243
            ++    P DV   ++ + A ++ I     P +LA       D +     L +A +    
Sbjct: 183 LVNSVPTPKDV--LSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKCAVA 240

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYNT 303
           V P  K    E HP+F GVY G +S  +    +E +DL +  G + +D++T  ++    +
Sbjct: 241 VQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQPS 300

Query: 304 KNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGY-KXXXXXXXXXXXXXXXXX 362
            + +E  +D+++    SF  + +   L  L  +V    K   +                 
Sbjct: 301 SHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAADPK 360

Query: 363 XXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXX 422
             + ++ +  Q+ + +     +  ETG S F   Q   P       ++ WG I       
Sbjct: 361 AAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSVPAS 420

Query: 423 XXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIH- 481
                      P +R I  +GDGS Q+T QE+S M+R      IF++NN GYTIE  IH 
Sbjct: 421 LGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVEIHD 476

Query: 482 GPTAQYNEIQNWKHLDILPTFGAKD--YETIRVATTGEWDKLASDKAFNENSKIRMIEIM 539
           GP   YN I+NW +  ++  F A +   +  +  T GE    A +KA    S   +IEI 
Sbjct: 477 GP---YNNIKNWNYAALMEVFNANEGSGKGFKARTGGELAD-AIEKAQANVSGPTLIEIQ 532

Query: 540 LPVMDAPSNLIAQAKLTAATNAK 562
           +   D  + LI      A  NA+
Sbjct: 533 INRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  224 bits (571), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 161/564 (28%), Positives = 256/564 (45%), Gaps = 17/564 (3%)

Query: 5   TLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARI 64
           T+G YL  RL +V  +  F +PGD+NL+LLDK+   P +      NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTV 124
           KG+A ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNTP 184
              M+  I+     I     A + ID  I+     ++  Y+ +P NM      +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTNM---STQSCALPGP 180

Query: 185 ID--LSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
           I+  L   P++    T  + A  +LI     P +LA         +     L +A     
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
            V P  K    E HP++ GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKG-YKXXXXXXXXXXXXXXXX 361
             + +E  SD++K     +  +++   L+ L  +V    K   +                
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 362 XXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXX 421
              + ++ +  Q+   +     +  ETG S F   Q   P       ++ WG I      
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 XXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIH 481
                       P +  +  +GDGS Q+TVQE++ MIR      IF++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 -GPTAQYNEIQNWKHLDILPTFGAKD--YETIRVATTGEWDKLASDKAFNENSKIRMIEI 538
            GP   YN I+NW +  ++  F A D   +  +V T  E  + A  KA +      +IEI
Sbjct: 477 DGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSE-AIKKAKSNTRGPTLIEI 532

Query: 539 MLPVMDAPSNLIAQAKLTAATNAK 562
            +   D  + LI+     A  NA+
Sbjct: 533 QINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  223 bits (569), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 161/564 (28%), Positives = 256/564 (45%), Gaps = 17/564 (3%)

Query: 5   TLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARI 64
           T+G YL  RL +V  +  F +PGD+NL+LLDK+   P +      NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTV 124
           KG+A ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNTP 184
              M+  I+     I     A + ID  I+     ++  Y+ +P NM      +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTNM---STQSCALPGP 180

Query: 185 ID--LSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPS 242
           I+  L   P++    T  + A  +LI     P +LA         +     L +A     
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYSYN 302
            V P  K    E HP++ GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKG-YKXXXXXXXXXXXXXXXX 361
             + +E  SD++K     +  +++   L+ L  +V    K   +                
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 362 XXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXX 421
              + ++ +  Q+   +     +  ETG S F   Q   P       ++ WG I      
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 XXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIH 481
                       P +  +  +GDGS Q+TVQE++ MIR      IF++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 -GPTAQYNEIQNWKHLDILPTFGAKD--YETIRVATTGEWDKLASDKAFNENSKIRMIEI 538
            GP   YN I+NW +  ++  F A D   +  +V T  E  + A  KA +      +IEI
Sbjct: 477 DGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAE-AIKKAKSNTRGPTLIEI 532

Query: 539 MLPVMDAPSNLIAQAKLTAATNAK 562
            +   D  + LI+     A  NA+
Sbjct: 533 QINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  215 bits (547), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 168/558 (30%), Positives = 259/558 (46%), Gaps = 61/558 (10%)

Query: 58  ADGYARIKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SLSAQAKQLL 112
           ADG++R    + CLITT+GVGELSALNGIAG+++E+V VLH+VGV     S S       
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRM----SACISETTSMITDIASAQAEIDRCIKATYISQ 160
           LHH    L + +F      V+  M     AC   + + + DI +A  E+D+ I   Y   
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVAC---SVTYLEDINTACDEVDKVIMDIYRYS 119

Query: 161 RTVYLGLPANMVDLMV-PADVLNTP-IDL----SLKPNDVDAETEVLGAILELIKDAKNP 214
           +  Y+ +P +  D++V P+++   P I L    S  P+ V    E++  +L+ I ++K P
Sbjct: 120 KPGYVFVPVDFSDMLVDPSNLFKRPEITLENCVSYAPSPV--VDELVRMVLQYIYESKCP 177

Query: 215 IILADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKK 274
            I+ D    R    +    LI  T   +F T MGK  IDE +  + G+Y G  S   V +
Sbjct: 178 SIIGDVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTE 237

Query: 275 AVESADLILSVGALLSDFNTGSFSYSYNTK-NIVEFHSDHIKIRKAS------FPGVQMK 327
               +DL+L  G  + + N G ++ +Y     ++EFHS++I+   AS      F GV   
Sbjct: 238 RFLQSDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFV 297

Query: 328 FVLEKLVAQVGSVVKGYKXXXXXXXXXXXXXX-----XXXXXLKQEWLWNQVGKFLKEGD 382
            VLE+L+  +      ++                        + Q +L   V  +L  GD
Sbjct: 298 QVLERLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGD 357

Query: 383 IVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEI---------- 432
           +++ ETG+  F I     P+    I+Q  + SI              ++           
Sbjct: 358 VLVCETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHP 417

Query: 433 -------DPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTA 485
                  D + R I+  GDG+ Q+T+QE+++M+R+ +   I +LNNNGYTIE+ I GPT 
Sbjct: 418 SHVEIPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTR 477

Query: 486 QYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASD-KAFNENSK---IRMIEIMLP 541
            YN++ +W    +L  FG    +    A      KLA   K      K   I ++EI L 
Sbjct: 478 SYNDVMSWDWTKLLEAFGDFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLD 537

Query: 542 VMDAPSNLIAQAKLTAAT 559
            MD P  L +     A T
Sbjct: 538 TMDFPKQLQSMVDAAAFT 555

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 386 TETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDG 445
           TETG S    NQ     + + ISQVLW  I              E+IDP  R I+F GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATLSA----EDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTMIRWNLKPYIFVLNNNGYTIE 477
            L LTVQE+ T IRW LKPY+FV NN+   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 130/310 (41%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+  +      I+   + AT      V + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LNTPI--DLSLKPNDVDAET---------EVLGAILELIKDAKNPIILADACASRH-DVK 228
           L  PI    +L  N ++  T         + +    +LI  AK P++   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              K L D  Q P   T  G GS D++ P+   + +G         AV++ADLI++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 132/300 (44%), Gaps = 18/300 (6%)

Query: 7   GKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKG 66
           G+   E +K+    T+FG PG   L + D IY     ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  -MACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMV--PADVL 181
              +S   ++   M+  +A     I+   + A       V + LP ++   ++  P  + 
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPIK 265

Query: 182 NT-PIDLSLKPNDVDAET-EVLGAILELIKDAKNPII-LADACASRHDVKAETKALIDAT 238
           +T PI   LK    +A T E +    +LI  AK P++ + +   +  D     K L D  
Sbjct: 266 STLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDRA 325

Query: 239 QFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFS 298
           Q P   T  G G+ D++ P+   + +G         A+++ADL++++GA   D  TG+ +
Sbjct: 326 QIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTGNIA 384

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 129/305 (42%), Gaps = 34/305 (11%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E +K+    T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPAN-MVDLM--VPA 178
                 +S   ++   M+  I     ++ +CI   +        G P   +VDL   V A
Sbjct: 211 ------ISRSCTKWNVMVKRI----EDLPKCINEAF---EIATSGRPGPVLVDLPKDVQA 257

Query: 179 DVLNTPIDL-------SLKPNDVDAETE----VLGAILELIKDAKNPII-LADACASRHD 226
            +L TPI +       +L+    + +T+     +    ELI  AK PI+ +     +  +
Sbjct: 258 SILKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPE 317

Query: 227 VKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVG 286
                K L D  Q P   T    G+ D++ P+   + +G         A+++ADLI++VG
Sbjct: 318 GPRLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVG 376

Query: 287 ALLSD 291
           A   D
Sbjct: 377 ARFDD 381

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 129/310 (41%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+  +      I+   + AT      V + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LNTPI--DLSLKPNDVDAET---------EVLGAILELIKDAKNPIILADACASRH-DVK 228
           L  PI    +L  N ++  T         + +    +LI  AK P++   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              K L    Q P   T  G GS D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 133/308 (43%), Gaps = 26/308 (8%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D IY+    ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMACLI-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G   ++  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   MI ++A     I+   + AT      V + LP ++   ++   +
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKDVTAAILRDAI 257

Query: 181 LNTPIDLSLKPNDVDAETE------VLGAI---LELIKDAKNPII-LADACASRHDVKAE 230
              P+  SL  N +   T       VL  I    +LI  AKNP++ +        D    
Sbjct: 258 ---PVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDGPKL 314

Query: 231 TKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLS 290
            K L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI+++G    
Sbjct: 315 LKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTRFD 373

Query: 291 DFNTGSFS 298
           D  TG+ +
Sbjct: 374 DRVTGNIA 381

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 132/316 (41%), Gaps = 35/316 (11%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           M  +T G+   E +++    T+FG PG   L + D IY     ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARIKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMV 176
                    +S   ++   M+  +      I+   +   +S R   V + LP ++   ++
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIA-MSGRPGPVLIDLPKDVTAAVL 280

Query: 177 --PADVLNTPIDLSLKPN-----DVDAETEVLGAILELIKDAKNPIILADA-CASRHDVK 228
             P  VLN  +  +   N          +E +    +LI  AK P+I A A   S  +  
Sbjct: 281 KNPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGP 340

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKKAVESADLI 282
              K L + +Q P   T    G+ D+Q P+        G  V  L       A+++ADLI
Sbjct: 341 TLLKELSERSQIPVTTTLQALGAFDQQDPKSLDMLGMHGSAVANL-------AIQNADLI 393

Query: 283 LSVGALLSDFNTGSFS 298
           +++G    D  TG+ S
Sbjct: 394 IALGGRFDDRVTGNIS 409

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 141/335 (42%), Gaps = 42/335 (12%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I+     ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+ ++A     I+   + AT      V + LP +     V A +
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAI 247

Query: 181 LNTPIDL-SLKPNDVDAE----------TEVLGAILELIKDAKNPII-LADACASRHDVK 228
           L TPI + S  P+    +           E +    +LI  AKNP++ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              K L +  Q P   T  G G+ D++ P+   + +G         AV+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFSYSYNTKNIVEFHSDHIKIRKASFPG 323
             D  TG         NI +F  +    RKA+  G
Sbjct: 367 FDDRVTG---------NITKFAPE---ARKAALEG 389

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 79/309 (25%), Positives = 130/309 (42%), Gaps = 28/309 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E +++ +  T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  S +A     +        D 
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVSTTA-----IGTDAFQEADV 198

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADVL 181
               R  +C ++   M+  I      I+   + AT      V + LP +     V A VL
Sbjct: 199 VGISR--SC-TKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAVL 250

Query: 182 NTPIDL-SLKPND---------VDAET-EVLGAILELIKDAKNPIILADACASRHDVKAE 230
             PI   S  P+D         VD  T   +    +LI  AK P++        H+   +
Sbjct: 251 RNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENGPK 310

Query: 231 -TKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALL 289
             K L +  Q P   T  G G+ D++ P+   + +G         AV++ADLI+++GA  
Sbjct: 311 FLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGARF 369

Query: 290 SDFNTGSFS 298
            D  T + S
Sbjct: 370 DDRVTCNIS 378

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 129/310 (41%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D IY     ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+  +      I+   + AT      V + LP +     V A +
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 241

Query: 181 LNTPIDL-SLKPNDV----------DAETEVLGAILELIKDAKNPIILADACASRHDVKA 229
           L  PI + S  P++           +   E L     LI  AK P++        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              + L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 361 FDDRVTGNIA 370

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 131/310 (42%), Gaps = 36/310 (11%)

Query: 7   GKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKG 66
           G+   E +K+    T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMVPADVLN 182
              +S   ++   M+  +A     I+   +   +S R   V + LP +     V A +L 
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIA-MSGRPGPVLVDLPKD-----VTAAILR 256

Query: 183 TPIDL-------------SLKPNDVDAETEVLGAILELIKDAKNPII-LADACASRHDVK 228
            PI +             S+   D  A++  +    +LI  AK P++ + +   +  D  
Sbjct: 257 EPIPIKSTLPSGTLTQIKSIAQEDFLADS--INRAADLINLAKKPVLYVGNGIFNNEDGP 314

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              K L +  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 315 RLLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGAR 373

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 374 FDDRVTGNIA 383

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 125/305 (40%), Gaps = 34/305 (11%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E +K+    T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPAN-MVDLM--VPA 178
                     IS + +    +     ++ +CI   +        G P   +VDL   V A
Sbjct: 208 ----------ISRSCTKWNVMVKRVEDLPKCINEAF---EIATSGRPGPVLVDLPKDVQA 254

Query: 179 DVLNTPIDL-------SLKPNDVDAETEVLGAIL----ELIKDAKNPII-LADACASRHD 226
            +L  PI +       +LK     A T+   A +    ELI  AK PI+ +     +  +
Sbjct: 255 SILRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPE 314

Query: 227 VKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVG 286
                K L D  Q P   T    G+ D+  P+   + +G         A+++ADLI++VG
Sbjct: 315 GPRLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVG 373

Query: 287 ALLSD 291
           A   D
Sbjct: 374 ARFDD 378

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 131/316 (41%), Gaps = 44/316 (13%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMVPAD 179
                 +S   ++   M+ ++A     I+       +S R   V + LP +     V A 
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIA-MSGRPGPVLVDLPKD-----VTAA 248

Query: 180 VLNTPIDL-SLKPNDV---------DAET-EVLGAILELIKDAKNPII-LADACASRHDV 227
           +L  PI + S  P            DA T E +    +LI  AK P++ +     +  + 
Sbjct: 249 ILRNPIPVESTLPTSTLKNLVGDMHDAFTKERIEKAAKLINIAKKPVLYVGGGILNNPEG 308

Query: 228 KAETKALIDATQFPSFVTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKKAVESADL 281
               K L D  Q P   T  G G+ D++ P+        G  V  LS       +++ADL
Sbjct: 309 PKLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDMLGMHGSAVANLS-------IQNADL 361

Query: 282 ILSVGALLSDFNTGSF 297
           I+++G    D  TG+ 
Sbjct: 362 IIAIGTRFDDRVTGNL 377

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 120/287 (41%), Gaps = 31/287 (10%)

Query: 9   YLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM- 67
           Y    L+     T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL GI  S +    +L + G    S++A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 128 MSACISETTSMITDIASAQAEI---DRCIKATYISQRTVYLGLPANMVDLMVPADVLNTP 184
           +S  +         + S+  ++   D      Y +    YL +P N++   V  D L  P
Sbjct: 113 VS-LLKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSL-PP 170

Query: 185 IDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSFV 244
           +     P     +   +  + +LI+     +++     + H    E +  +D  Q P   
Sbjct: 171 VKNIYVPKS-SPDPSAVQEVTDLIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLPFLP 228

Query: 245 TPMGKGSIDEQHPRFGGVYVGTLSRPEVK-KAVESADLILSVGALLS 290
           TPMGKG + + HP         L+    + +A++ A ++L +GA L+
Sbjct: 229 TPMGKGVVPDSHP---------LNVSSARSRALQEAKVVLVLGARLN 266

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 127/303 (41%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E +++    T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  + SA     +        D 
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSA-----IGTDAFQEADV 210

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADVL 181
               R  +C ++   M+  I      I+   + AT      V + LP +     V A VL
Sbjct: 211 VGISR--SC-TKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAVL 262

Query: 182 NTPIDL-SLKPND---------VDAET-EVLGAILELIKDAKNPIILADACASRHDVKAE 230
             PI + S+ P+D         VD  T E +    +LI  AK P++   A     ++  +
Sbjct: 263 RNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMGPQ 322

Query: 231 -TKALIDATQFPSFVTPMGKGSID-EQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
             K L D  Q P   T  G G+ + E H       VG         A+++ADLI+++GA 
Sbjct: 323 YLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAIQNADLIIALGAR 380

Query: 289 LSD 291
             D
Sbjct: 381 FDD 383

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 103/491 (20%), Positives = 191/491 (38%), Gaps = 55/491 (11%)

Query: 8   KYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM 67
           +Y  + L+Q    T+FG+ G   + L D +    G+++    NE +A+YAA  Y  + G 
Sbjct: 7   EYFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGK 65

Query: 68  -ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVFH 126
              L+   G G + AL GI  S +    ++ + G       ++ L   H  G  +     
Sbjct: 66  PGVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAG------SSEDL---HKGGFQELDQVS 116

Query: 127 RMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPA-NMVDLMVPADVLNTPI 185
            +S  +  T  + TD        D     TY + R    G P    +D   P  +++  I
Sbjct: 117 LLSDHLKFTGKLTTDP-------DVIELVTYNAMRLTTTGTPGVTYIDF--PGSLISESI 167

Query: 186 DLSLKPNDVDA------ETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQ 239
           + S  P    +      +TE L  +++L+   +N  IL        +   E + LI+   
Sbjct: 168 ERSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYN 227

Query: 240 FPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-KAVESADLILSVGALLS-------- 290
            P   TPM KG + + HP         L+    + KA++ A+++L +GA L+        
Sbjct: 228 LPFLSTPMAKGVVPDSHP---------LNASSARSKALKEAEIVLVLGARLNWILHFGAP 278

Query: 291 ---DFNTGSFSYSYNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKXX 347
              D NT       + +++ + +   +        G+ +K ++EKL  +  +     +  
Sbjct: 279 PKWDANTIFIQVDCDPESLGQNNQRGVGYSLCGDIGLTVKSLIEKLKLERWAYQGLSREL 338

Query: 348 XXXXXXXXXXXXXXXXXLKQEWL-WNQVGK----FLKEGDIVLTETGTSAFGINQTHFPT 402
                            +    L +N+V +    F+ +   ++   G +     +  FPT
Sbjct: 339 RSAIKLNHEKLAKKEQIVHHGRLNYNKVYQCLRTFIDDSRTIIVSEGANTMDQARISFPT 398

Query: 403 NTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNL 462
           + Y   ++  G+               +   P K  ++  GD +   +  EI T +R  L
Sbjct: 399 D-YPKHRLDAGT-NATMGIGLGYAIAAKIARPDKSIVLLQGDSAFGFSAMEIETAVRNRL 456

Query: 463 KPYIFVLNNNG 473
              I V+NN+G
Sbjct: 457 GLVIIVMNNSG 467

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 134/312 (42%), Gaps = 33/312 (10%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D IY     ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMVPAD 179
                 +S   ++   M+ ++A     I+   +   +S R   V + LP +     V A 
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIA-MSGRPGPVLVDLPKD-----VTAA 261

Query: 180 VLNT--PIDLSLKPNDVDAET------EVLGAIL----ELIKDAKNPII-LADACASRHD 226
           VL    P + +L   +  A T      E L   +    +LI  AK P++ + +   +  D
Sbjct: 262 VLREAIPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNED 321

Query: 227 VKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVG 286
                K L D  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VG
Sbjct: 322 GPRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVG 380

Query: 287 ALLSDFNTGSFS 298
           A   D  TG+ +
Sbjct: 381 ARFDDRVTGNIT 392

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 126/303 (41%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+  +      I+   + AT      V + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LNTPI--DLSLKPNDVDAET---------EVLGAILELIKDAKNPIILADACASRH-DVK 228
           L  PI    +L  N ++  T         + +    +LI  AK P++   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              K L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 127/298 (42%), Gaps = 26/298 (8%)

Query: 7   GKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKG 66
           G+   E +++ +  T+FG PG   L++ D IY      +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 196

Query: 126 HRMSACISETTSMITDIASAQAEIDRCIKATY---ISQR--TVYLGLPANMVD--LMVPA 178
             +   IS + +    +     E+ R I   +   +S R   V + LP ++    L  P 
Sbjct: 197 DVIG--ISRSCTKWNVMVKTVEELPRRINEAFEIAVSGRPGPVLVDLPKDVTSAILKTPI 254

Query: 179 DVLNT-PIDLSLKPNDVDAETEV---LGAILELIKDAKNPII-LADACASRHDVKAETKA 233
            V +T P D   K     A+      +  + +LI  AK P++ +      R D     + 
Sbjct: 255 PVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKLLRQ 314

Query: 234 LIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSD 291
           L D  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++GA   D
Sbjct: 315 LADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDD 371

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 128/312 (41%), Gaps = 34/312 (10%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    TIFG PG   L + D I++    ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPAN-MVDLM--VPA 178
                     IS + +    +     ++ RCI   +        G P   +VDL   V A
Sbjct: 211 ----------ISRSCTKWNVMVRTVDDMPRCINEAF---EIAMSGRPGPVLVDLPKDVTA 257

Query: 179 DVLNTPIDL-SLKPNDVDAE----------TEVLGAILELIKDAKNPIILADA-CASRHD 226
            +L  PI + S  P+   ++           E +     LI  AK P++   A   +  D
Sbjct: 258 AILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNNVD 317

Query: 227 VKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVG 286
                K L D  Q P   T  G G+ D++ P+   + +G         AV++ADL++++G
Sbjct: 318 GPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIALG 376

Query: 287 ALLSDFNTGSFS 298
               D  TG+ +
Sbjct: 377 TRFDDRVTGNIT 388

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 127/301 (42%), Gaps = 43/301 (14%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T  +Y    LKQ +  T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
           + G  A L+   G G + AL GI  S +    ++ + G  S +++  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSAC--ISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVD--LMVPA 178
               ++S      + T  +  I    A  +    A        Y+  P N+++    V A
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFNAYNFAIQSPMGVTYIDFPGNLIEGNYKVQA 178

Query: 179 DVLNTPIDL------SLKPNDVDAETEVLGAILELIKDAKNP--IILADACASRHDVKAE 230
                P+ +      S  PN V+   ++      +I+++ N   +IL       H    +
Sbjct: 179 QPATNPVSIPRRVRCSPDPNTVNEVAKL------IIENSSNNVLVILGKGAVEFHK---D 229

Query: 231 TKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-KAVESADLILSVGALL 289
               I+    P   TPM KG + + H          L+    + KA++ A+++L +GA L
Sbjct: 230 INKFINTFNLPFLPTPMAKGILPDSH---------NLNVSSARSKALKDANIVLVLGARL 280

Query: 290 S 290
           +
Sbjct: 281 N 281

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 134/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E +++ +  TIFG PG   L + D IY     ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+  +      I+   + AT      V + LP +     V A V
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 181 LNTPIDLS----------LKPNDVDAET-EVLGAILELIKDAKNPIILADACASRHDVKA 229
           L +PI ++          L  + VD  T + +    +LI  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-KALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
           +  K L +  Q P   T  G G+ D+  P+   + +G         A+++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 379 FDDRVTGNVA 388

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 125/309 (40%), Gaps = 42/309 (13%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADV 180
                 +S   ++   M+  +      I+   + AT      V + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LNTPI--DLSLKPNDVDAET---------EVLGAILELIKDAKNPIILADA-CASRHDVK 228
           L  PI    +L  N ++  T         + +    +LI  AK P++   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKKAVESADLI 282
              K L +  Q P   T  G GS D++ P+        G     L       AV++ADL+
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDMLGMHGCVTANL-------AVQNADLL 370

Query: 283 LSVGALLSD 291
           ++VGA   D
Sbjct: 371 IAVGARFDD 379

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 129/303 (42%), Gaps = 36/303 (11%)

Query: 7   GKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKG 66
           G+   E +++ +  T+FG PG   L++ D IY      +    +E  A + A+GYAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 195

Query: 126 HRMSACISETTSMITDIASAQAEIDRCIKATY---ISQR--TVYLGLPANMVDLMVPADV 180
             +   IS + +    +     E+ R I   +   +S R   V + LP +     V + +
Sbjct: 196 DVIG--ISRSCTKWNVMVKNVEELPRRINEAFEIAVSGRPGPVLVDLPKD-----VTSAI 248

Query: 181 LNTPIDL--SLKPNDVDAETEV---------LGAILELIKDAKNPII-LADACASRHDVK 228
           L TPI +  +L  N +   T+          L    +LI  AK P+I +      +    
Sbjct: 249 LRTPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGP 308

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              + L +  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++GA 
Sbjct: 309 KLLRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGAR 367

Query: 289 LSD 291
             D
Sbjct: 368 FDD 370

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 130/310 (41%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E +++    T+FG PG   L + D I+E     +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + SA     +        D 
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA-----IGTDAFQEADV 218

Query: 123 TVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMVPADV 180
               R  +C ++   M+ ++      I+   +   +S R   V + LP +     V A V
Sbjct: 219 VGISR--SC-TKWNVMVKNVEELPKRINEAFEIA-MSGRPGPVLVDLPKD-----VTAAV 269

Query: 181 LNTPIDL-SLKPNDVDAE----------TEVLGAILELIKDAKNPIILADA-CASRHDVK 228
           L  PI   S  P+D  A+          +  +    +L+  AK PI+   A   +  D  
Sbjct: 270 LRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDGP 329

Query: 229 AETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGAL 288
              K L +  Q P   T  G G+ D++  +   + +G         A+++ADLIL+VGA 
Sbjct: 330 RLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGAR 388

Query: 289 LSDFNTGSFS 298
             D  T + S
Sbjct: 389 FDDRVTCNIS 398

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 117/531 (22%), Positives = 209/531 (39%), Gaps = 52/531 (9%)

Query: 5   TLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNE--LNAAYAADGYA 62
           T  ++  + L++    T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAK---QLLLHHTLGN 119
             K    LI   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKPGVLLIVG-GPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSACIS-ETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPA 178
              + F + +  ++ +   MIT     Q  ++ CI+ T       Y+ +PA+ ++   P 
Sbjct: 120 --LSPFLKFTGKLTPDNIDMIT-----QKALNYCIQGT---AGVSYIDVPADFIEYEKPL 169

Query: 179 ---DVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALI 235
              D     + + L PN    +   +  +++LI   KN  IL            E + L+
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLV 229

Query: 236 DATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P    + V +       +A++ AD++L +GA L+     
Sbjct: 230 NTFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKIADIVLVLGARLNWILHF 281

Query: 296 SFSYSYNTKNI-VEFHSDHIKIRKASF-PGVQMK------FVLEKLVAQVGSVVKGYKXX 347
             S  +N+++I ++F S+   +   +  PG  +         +  LV ++      +K  
Sbjct: 282 GTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYS 341

Query: 348 XXXXXXXXXXXXXXXXXLKQEWL------WNQVGKFLK----EGDIVLTETGTSAFGINQ 397
                            L++E        +NQV   L+    +   +L   G +   I +
Sbjct: 342 GVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 THFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTM 457
             FPT+     + L                  +   P+   ++  GD +   +  EI T 
Sbjct: 402 ISFPTDAP--RRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWNLKPYIFVLNNNG-YTIEKLIHGPTAQYNEIQNWKHLDILPTFGAKDY 507
           +R  L   I V+NN+G Y  EK I G        +N ++  +    GA D+
Sbjct: 460 VRCQLALVIVVMNNSGIYHGEKDIEGDLPPTALSKNCRYDLVGKGLGANDF 510

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 126/304 (41%), Gaps = 32/304 (10%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I++     +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMVPAD 179
                 +S   ++   M+  I      I+   +   +S R   V + LP +     V A 
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKD-----VTAA 251

Query: 180 VLNTPI--DLSLKPNDV---------DAETEVLGAILELIKDAKNPIILADACASRHDVK 228
           +L  PI    +L  N +         ++  E +    +L+  AK P++   A    +   
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTADLLNKAKTPVLYVGAGILNNPAG 311

Query: 229 AE-TKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGA 287
            +  K L +  Q P   T    G+ D+Q P+   + +G         A+++ADLIL+VG+
Sbjct: 312 PKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVGS 370

Query: 288 LLSD 291
              D
Sbjct: 371 RFDD 374

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 122/308 (39%), Gaps = 32/308 (10%)

Query: 7   GKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKG 66
           G+   E +++    T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSACISETTSMITDIASAQAEIDRCIK-ATYISQRTVYLGLPANMVDLMVPADVLNT 183
              +S   ++   M+  +      I+   + AT      V + LP +     V A +L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRS 241

Query: 184 PI------------DLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAE- 230
           PI             L+ +  D+D     L     LI  A+ P++   A         E 
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDG-VRSLADASRLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLS 290
            + L +  Q P   T    G+ D++  +   + +G          V++ADLI+++GA   
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFD 359

Query: 291 DFNTGSFS 298
           D  TG+ +
Sbjct: 360 DRVTGNIA 367

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 136/314 (43%), Gaps = 30/314 (9%)

Query: 8   KYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM 67
           ++  + L++    T+FG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAK---QLLLHHTLGNGDFT 123
              L+   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSACIS-ETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPA---D 179
            F + +  ++ +   M+T     Q  ++ CI+ T       Y+ +PA+ ++   P    D
Sbjct: 122 PFLKFTGKLTPDNVDMVT-----QKALNHCIQGT---AGVSYIDVPADFIESEKPLEGND 173

Query: 180 VLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQ 239
            +   + + L P     +   +  I++LI   ++  IL            E + LI+   
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSHEIRRLINKFN 233

Query: 240 FPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSY 299
            P   TPM KG + +  P    + V +       +A+++AD++L +GA L+       S 
Sbjct: 234 LPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADVVLVLGARLNWILHFGTSP 285

Query: 300 SYNTKNI-VEFHSD 312
            +N ++I ++F S+
Sbjct: 286 KWNAESIFLQFDSN 299

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 106/497 (21%), Positives = 199/497 (40%), Gaps = 59/497 (11%)

Query: 8   KYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNE--LNAAYAADGYARIK 65
           +Y  E L++    T+FG+ G   + L D +    G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAK---QLLLHHTLGNGDF 122
               LI   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  PGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSACIS-ETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV- 180
           + F + +  ++ +   MIT     Q  ++ CI+ T       Y+ +PA+ ++   P +  
Sbjct: 121 SPFLKFTGKLAPDNIRMIT-----QKALNHCIQGT---AGVAYIDVPADFIEYEKPLEGN 172

Query: 181 --LNTPIDLSLKPNDVDAETEVLGAILELI-KDAKNPIILA---DACASRHDVKAETKAL 234
             +   + + L PN    +   +  +++LI K+ +N I++     A  + H+V+     L
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVRR----L 228

Query: 235 IDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNT 294
           I+    P   TPM KG + +  P    + V +       +A+++AD++L +GA L+    
Sbjct: 229 INKFNIPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADIVLVLGARLNWILH 280

Query: 295 GSFSYSYNTKNI-VEFHSDHIKIRKASF-PGVQMK------FVLEKLVAQVGSVVKGYKX 346
              S  +N+++I ++F S+   +   +  PG  +         +  L+ +V      +K 
Sbjct: 281 FGASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKY 340

Query: 347 XXXXXXXXXXXXXXXXXXLKQE----------WLWNQVGKFLKEGDIVLTETGTSAFGIN 396
                             LK+E           ++  +   + +    L   G +   I 
Sbjct: 341 SGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIA 400

Query: 397 QTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEIST 456
           +  FPTN     + L                  +   P+   ++  GD +   +  EI T
Sbjct: 401 RVSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIET 458

Query: 457 MIRWNLKPYIFVLNNNG 473
            +R  L   I V+NN+G
Sbjct: 459 AVRCQLALVIVVMNNSG 475

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 127/311 (40%), Gaps = 32/311 (10%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T G+   E + +    T+FG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSLSAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQR--TVYLGLPANMVDLMVPAD 179
                 +S   ++   M+  +      I+   +   +S+R   V + LP +     V A 
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKD-----VTAA 259

Query: 180 VLNTPIDLSLK-PNDVDAETEVLGA---ILELIKD-------AKNPIILADA-CASRHDV 227
           +L  PI +    P+   ++   L     ILE IK        AK P++   A   +  + 
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEG 319

Query: 228 KAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGA 287
               K L    + P   T  G G+ D++ P      +G         AV+++DLI++VG 
Sbjct: 320 PRILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVGT 378

Query: 288 LLSDFNTGSFS 298
              D  TG+ S
Sbjct: 379 RFDDRVTGNIS 389

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 108/247 (43%), Gaps = 23/247 (9%)

Query: 14  LKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM-ACLIT 72
           LKQ   + +FG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      L+ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVFHRMSACI 132
             G G + AL GI  ++     +L + G  S   + K          G F    ++   +
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAG--STEDEYK----------GGFQELDQLR-IV 118

Query: 133 SETTSMITDIA--SAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVLNTPIDLSLK 190
           +  TS    ++  +    +   +K   +     YL +P  ++++     + + P+D+   
Sbjct: 119 APWTSFKGRLSLDNVNYMVYTAVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHV 178

Query: 191 PNDVDAETEVLGAILELIKDAKNP-IILADACASRHDVKAETKALIDATQFPSFVTPMGK 249
            +  D+ + V GA  +L++D +N  +++   CA    V    ++ ++  + P    PM K
Sbjct: 179 RSGPDS-SRVQGAA-KLLQDGRNILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAK 233

Query: 250 GSIDEQH 256
           G + + H
Sbjct: 234 GIVPDSH 240

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 90/499 (18%), Positives = 187/499 (37%), Gaps = 87/499 (17%)

Query: 14  LKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM-ACLIT 72
           LKQ   + +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    L+ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVG------------VPSLSAQAKQLLLHHTLGNG 120
             G G + AL G+  S+     +L + G            +  LS  ++    +  +  G
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAGSSENEYYEGFQELDQLSVMSRWCKFYGRINTG 129

Query: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMV-PAD 179
           + +                         +   +K + +     Y+ +P  +++     +D
Sbjct: 130 NLSHL-----------------------VYTAMKTSMLQNAVTYIDIPGGLIEEKAKSSD 166

Query: 180 VLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQ 239
            L  P  + +       + + +  +  +++  K  +++    ++ +   AE +A ++  Q
Sbjct: 167 EL--PKKMEIAHIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQ 222

Query: 240 FPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKK-AVESADLILSVGALLS-------- 290
            P   TPM KG + + H          L+    +  A++SA+++L +GA L+        
Sbjct: 223 LPFLPTPMAKGIVPDTH---------ELNVNGARSLALKSAEVVLILGARLNWILHFGLE 273

Query: 291 ----------DFNTGSFSYSYNTKNIVEF--HSD---HIKIRKASFPGV-QMKFVLEKLV 334
                       +    +   N    V F  HSD    I+      P   +   V EK++
Sbjct: 274 PKWSDDACFIQVDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKIL 333

Query: 335 AQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSAFG 394
           +++ S  K  K                   L+   ++ ++ +F+ +   ++   G +   
Sbjct: 334 SKIHSNGKAMK---------EKEIIPEGSALRYHGVYAKLREFIDDKSTIMVLEGANTMD 384

Query: 395 INQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQEI 454
           I +  FPT +Y   ++  G+               +  +P K  +   GD +   +  E+
Sbjct: 385 IARVSFPT-SYQKHRLDAGT-SATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMEL 442

Query: 455 STMIRWNLKPYIFVLNNNG 473
            T+ R  L   + V+NN G
Sbjct: 443 ETIARNKLGIVVVVMNNGG 461

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 106/271 (39%), Gaps = 43/271 (15%)

Query: 4   ITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYAR 63
           +T+ + +   L+  +   +FG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  IKGM-ACLITTFGVGELSALNGI-------------AGS----YAEHVGVLHVVGVPSLS 105
           + G    L+   G G + +L G+             AGS    + ++ G    +   SL 
Sbjct: 62  LTGKPGVLLVVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHGHDQYRGAFQELDQISLL 121

Query: 106 AQAKQLLLHHTLGNGDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYL 165
               +     T GN D  +F   +  +  T  +          +D  I    I  + V  
Sbjct: 122 KPYVKFSGKLTEGNVDHVLFSAYNIALQGTKGV--------TYVD--IPGNLIETQAVCA 171

Query: 166 GLPANMVDLMVPADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRH 225
           G P     L+ P   +  PI  S  P+ V         +  LI + ++  +L        
Sbjct: 172 GTPG----LLPP---VPQPIKCSPDPHTVK-------RVASLILENRDKKVLVVVGKGSQ 217

Query: 226 DVKAETKALIDATQFPSFVTPMGKGSIDEQH 256
              A  +  ID   FP   TPMGKG + ++H
Sbjct: 218 GAFAAVRRFIDEFNFPFLPTPMGKGVVPDEH 248

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 99/501 (19%), Positives = 194/501 (38%), Gaps = 60/501 (11%)

Query: 5   TLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNE--LNAAYAADGYA 62
           T+ ++  + L++    T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDF 122
             K    LI   G G + +L GI  S +    +L + G  S           + +  G F
Sbjct: 63  NDKPGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSS----------QNDVYKGGF 111

Query: 123 TVFHRMSAC------ISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVD--- 173
               ++S          + TS   D+ + +A ++ CI+ T       Y+  PA++++   
Sbjct: 112 QELDQISLLSPFLKFTGKLTSDNIDMVTRKA-LNHCIQGTM---GVSYIDFPADLIENEK 167

Query: 174 -LMVPADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETK 232
             +   D L   + + L PN    +   +  I++LI   ++  IL            E +
Sbjct: 168 KSLAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQNRDKNILIVIGKGAVKNSHEIR 227

Query: 233 ALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDF 292
            L+ +   P   TPM KG + +  P    + V +       +A+++AD++L +GA L+  
Sbjct: 228 RLVSSFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADIVLVLGARLNWI 279

Query: 293 NTGSFSYSYNTKNI-VEFHS------DHIKIRKASFP-----GVQMKFVLEKLVAQ---- 336
                S  +N +++ ++F S      D+     A        G+ +  ++E+L  Q    
Sbjct: 280 LQFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRPRW 339

Query: 337 ----VGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQEWLWNQVGKFLKEGDIVLTETGTSA 392
               V + ++  +                   L    ++  +   +++   +L   G + 
Sbjct: 340 KYSGVNNALR--EKIHVNETRLQEKEKMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANT 397

Query: 393 FGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFIGDGSLQLTVQ 452
             I +  FPT+       L                  +   P+   ++  GD +   +  
Sbjct: 398 MDIARVSFPTDAP--RHRLDAGTNATMGIGLGYALASKASRPELDVVLIQGDSAFGFSAM 455

Query: 453 EISTMIRWNLKPYIFVLNNNG 473
           EI T +R  L   I V+NN+G
Sbjct: 456 EIETAVRCQLALVIVVMNNSG 476

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/347 (19%), Positives = 131/347 (37%), Gaps = 44/347 (12%)

Query: 164 YLGLPANMV------DLMVPADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIIL 217
           Y+ +P N++      +  +   ++ +P+  S  P        V+  +  LI + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 218 ADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKK-AV 276
                   +   E +  +D  Q P   TPM KG + + HP         L+    +  A+
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLAL 256

Query: 277 ESADLILSVGALLS-DFNTGSFSYSYNTKNIVEFHSDHIKIRKASFPGVQMKFV--LEKL 333
             AD++L +GA L+   + G      +T   V+F     ++   +  G+       +   
Sbjct: 257 RKADVVLLLGARLNWILHFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIGLS 316

Query: 334 VAQVGSVVKGYKXXXXXXXXXXXXXXXXXXXLKQE-------WLWNQV----GKFLKEGD 382
           + ++GS +  +K                     +E         +NQV     +++ + +
Sbjct: 317 LEELGSKLHAFKYRGLNNAIREKIDTNELKLRGKERETRTALLHYNQVYALMRQYITDDE 376

Query: 383 IVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRTIVFI 442
            +L   G +   + +  FPT+ Y   ++  G+               +  D  K  I   
Sbjct: 377 TILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYALAAKASDTTKTVICIQ 434

Query: 443 GDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNE 489
           GD +   +  E+ T +R +L   + V+NN+G     + HG   Q  E
Sbjct: 435 GDSAFGFSAMELETAVRCSLPLVVVVMNNSG-----IYHGTVDQSVE 476

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 131/308 (42%), Gaps = 46/308 (14%)

Query: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60
           MS I++  Y+   LK+    T+FG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARIKGM-ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGN 119
           Y  +      L+T  G G + AL GI  S   +  ++ + G   + +Q K     +  G 
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQK-----YKNGF 112

Query: 120 GDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPAD 179
            +      +++ +  T  + T+       ID  +   Y S R   L  P  +  L +P D
Sbjct: 113 QELNHIALLNSYMKFTGELSTE------NIDLLV---YESMRNSMLS-PKGVSFLEIPGD 162

Query: 180 VLNTPIDLSL-------KPNDVDAET-----EVLGAILELIKDA-----KNPIILADACA 222
           +++  +  ++       KP  VDA T     ++L    + + DA     +N +++    A
Sbjct: 163 LIHKSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRKRDQNMLVIVGKGA 222

Query: 223 SRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLI 282
                 +  +  I+    P   TPM KG I++ +     V  G         A++ AD+I
Sbjct: 223 I--GASSALRHFINCFNLPFLPTPMAKGIIEDSNEL--NVSSGR------SMALKDADVI 272

Query: 283 LSVGALLS 290
           L  GA L+
Sbjct: 273 LVFGAKLN 280

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/123 (18%), Positives = 52/123 (42%), Gaps = 7/123 (5%)

Query: 365 LKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIXXXXXXXXX 424
           L    ++ ++    K+ + +L   G +   + +  FPT+ +   ++  G++         
Sbjct: 380 LNYNVVFGRLKTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLATMGIGLGY 438

Query: 425 XXXXXEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPT 484
                    P K  ++  GD +   +  E+ T +R+NL   + ++NN+G     + HG T
Sbjct: 439 AISTKLS-KPNKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG-----IYHGTT 492

Query: 485 AQY 487
             +
Sbjct: 493 KDH 495

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 113/275 (41%), Gaps = 29/275 (10%)

Query: 21  TIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM-ACLITTFGVGEL 79
           T+FG+ G   + + D I     +R+ G  NE  A+YAA  Y  + G    L+   G G +
Sbjct: 21  TVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASAYGYLTGKPGVLLVVGGPGLI 80

Query: 80  SALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVFHRMSACISETTSMI 139
            AL G+  S +    +L + G                L  G F    ++ A +S      
Sbjct: 81  HALAGVYNSISNKWPLLVLAGS------------SEDLNRGGFQALDQI-AVLSRYVKFS 127

Query: 140 TDIASAQAE--IDRCIKATYISQRTV-YLGLPANMVDLMVPADVLNTPIDLSLKPNDVDA 196
           + + ++     +   ++ + +    V YL +P ++++  V  +  N   +++    +   
Sbjct: 128 SRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSVEKEKYNCVRNIT--KVEYQP 185

Query: 197 ETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQH 256
             + L  + +LI +     +L        D   E +  I+  Q P   TPM KG + + H
Sbjct: 186 SKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIERFQLPFLPTPMAKGVVPDSH 245

Query: 257 PRFGGVYVGTLSRPEVKK-AVESADLILSVGALLS 290
           P         L+    +  A+ SAD++L +GA L+
Sbjct: 246 P---------LNVSSARSLALRSADIVLVLGARLN 271

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 121/291 (41%), Gaps = 35/291 (12%)

Query: 8   KYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADGYARIKGM 67
           +YL E L       +FG+ G   + L D +     +++ G  NE  A+YAA  Y  + G 
Sbjct: 6   EYLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGR 65

Query: 68  -ACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNGDFTVFH 126
              L+   G G + AL G+  S +    ++ + G    S +            G F    
Sbjct: 66  PGVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNR------------GGFQELD 113

Query: 127 RMSACIS---ETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPAD---V 180
           ++ A +S   + +S +++    Q+  D   +A   +    YL +PAN++D  V  +    
Sbjct: 114 QI-ALLSKYVKYSSRLSNSNVDQSFYDALRQAVLGTPGVSYLDIPANVIDQEVEKNESFS 172

Query: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240
                 +S +P D       L  + +L+   ++  IL        +   + +  +D  Q 
Sbjct: 173 RRHIAKISYQPTDA-----ALQRVAKLLNANRDKNILCVIGKGATENAQQIRPFVDEFQL 227

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKK-AVESADLILSVGALLS 290
           P   TPM KG + + H          L+    +  A++SAD++L +GA L+
Sbjct: 228 PFLSTPMAKGVVPDSH---------ALNVSSARSLALKSADIVLVLGARLN 269

>NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {ON}
           
          Length = 205

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 98  VVGVPSLSAQAKQLLLHHTLGNGDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATY 157
           +V   +++ +  ++     L  G       + A  +     +TDI  +  EI   +   Y
Sbjct: 1   MVAFKAVTPKKARVAADEPLEKGVLRFLVSIGASYTTRPEFLTDIVDSTTEIIDTVGNKY 60

Query: 158 ISQRTVYLGLPANMVDLMVPADVLNTPID---------LSLKPNDVDAETEVLGAILELI 208
            S +  YL +  N+ DL +   V+ +P D           LKP ++ AE    GA L + 
Sbjct: 61  ESTQFGYLNIKTNVKDLKIKTYVIKSPEDKDDVVVLSEYDLKPYEIFAEYGQEGAKLSMG 120

Query: 209 KDAK 212
           +DAK
Sbjct: 121 EDAK 124

>Ecym_8112 Chr8 complement(237472..239301) [1830 bp, 609 aa] {ON}
           similar to Ashbya gossypii AEL132W
          Length = 609

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 79/195 (40%), Gaps = 23/195 (11%)

Query: 128 MSACISE-TTSMITDIASA-----QAEIDRCIKATYISQRTVYLGLPANMVDLMVPADVL 181
           M  C++E T SM  ++  A     ++ ID  +  +Y+S   +Y    + M+      DV+
Sbjct: 373 MLECVAEHTDSMPYNVRRALLSTHRSRIDDMVITSYLSHNPLY----SPMIRTTKAVDVI 428

Query: 182 NTPIDLSLKPND----VDAETEVLGAILELIKDAKNPIILADACASRHD--VKAETKALI 235
              +  +  P      V+   E+  +I  +I+D    ++L    A RH   +  E K + 
Sbjct: 429 KGGVKANALPESTTFIVNHRVEITSSIDAVIEDD---LVLVKRVARRHGYGITLEGKEIW 485

Query: 236 DATQFPSF-VTPMGKGSIDEQHPRFGG---VYVGTLSRPEVKKAVESADLILSVGALLSD 291
            AT      VTP+ +       P  G    V+ GTL        +   D+   V   L  
Sbjct: 486 PATPIGYIEVTPLNRLDPSPISPTSGSTWDVFAGTLQDVYESNVLVDKDIDFYVTGSLFS 545

Query: 292 FNTGSFSYSYNTKNI 306
            NT S  Y  +TKNI
Sbjct: 546 ANTDSKFYWNSTKNI 560

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 164 YLGLPANMV--DLMVPADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADAC 221
           Y+  P +++  ++ VP    N  I  ++K +   A+  V   + +L++   +  +L    
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIPRAIKSS---ADPLVTKEVAQLLRRNSDQNVLVIIG 219

Query: 222 ASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-KAVESAD 280
               +      A I   QFP   TPMGKG I +  P         L+    +  A+  +D
Sbjct: 220 KGAVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP---------LNVSSARSSALSKSD 270

Query: 281 LILSVGALLS 290
           ++L  GA L+
Sbjct: 271 IVLVFGARLN 280

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,037,777
Number of extensions: 2123143
Number of successful extensions: 5602
Number of sequences better than 10.0: 136
Number of HSP's gapped: 5448
Number of HSP's successfully gapped: 151
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)