Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0H006303.189ON1911918721e-120
Kpol_1045.693.189ON2621304042e-48
NDAI0G018003.189ON2221383037e-34
TDEL0D043203.189ON2431173049e-34
CAGL0I04554g3.189ON2261002854e-31
KAFR0A012303.189ON220932837e-31
Ecym_53133.189ON2481132812e-30
ZYRO0A04928g3.189ON251942795e-30
Kwal_56.231143.189ON2101472741e-29
TBLA0F007503.189ON2341002751e-29
NCAS0E016003.189ON229932742e-29
KNAG0J012603.189ON1941762694e-29
Suva_4.2383.189ON2331212682e-28
Suva_2.1413.189ON204992652e-28
Skud_2.1263.189ON2041152653e-28
KLTH0G16060g3.189ON2131272635e-28
Smik_2.1333.189ON2041792582e-27
Smik_4.2233.189ON2321162602e-27
SAKL0C10494g3.189ON230982602e-27
AER017C3.189ON2161132574e-27
YBR014C (GRX7)3.189ON2031152541e-26
YDL010W (GRX6)3.189ON2311102561e-26
KLLA0E17733g3.189ON2111162522e-26
Skud_4.2423.189ON2321172507e-26
NCAS0C013408.679ON3571251682e-13
SAKL0H06468g8.679ON2581081592e-12
KAFR0A038708.679ON2671081548e-12
TPHA0G015908.679ON2971451486e-11
KLTH0D11308g8.679ON2711031423e-10
TPHA0B03560singletonON106981354e-10
AFR710W1.38ON111931345e-10
NDAI0K013508.679ON2711301407e-10
Ecym_10441.38ON158921341e-09
TDEL0E05740singletonON108891283e-09
NDAI0E011508.679ON2361101343e-09
KNAG0G025808.679ON2781051353e-09
Kpol_1072.148.679ON2501241343e-09
NCAS0B016408.679ON2401031334e-09
KLLA0D05973g8.679ON2811111345e-09
ACR146W8.679ON2131111325e-09
TBLA0A050801.38ON118961268e-09
Kwal_33.131661.38ON1381121279e-09
Ecym_23948.679ON281991311e-08
SAKL0C01320g1.38ON165971281e-08
Kpol_2002.361.38ON109801241e-08
YPL156C (PRM4)8.679ON284651292e-08
Suva_2.6931.38ON143841233e-08
TBLA0B038208.679ON251891273e-08
YDR513W (GRX2)1.38ON143841234e-08
Skud_4.7881.38ON145781234e-08
CAGL0K05813g1.38ON142951224e-08
KNAG0C004501.38ON157781235e-08
KLLA0C01298g1.38ON107921205e-08
Smik_4.7941.38ON143841225e-08
TPHA0E037301.38ON106871196e-08
Kpol_2000.991.38ON141771191e-07
Suva_16.1548.679ON283651231e-07
Kwal_26.88148.679ON2751141222e-07
Smik_6.3538.679ON286921212e-07
KLTH0F01276g1.38ON138901163e-07
Skud_16.1268.679ON287931204e-07
NDAI0F044301.38ON136771146e-07
NCAS0B088701.38ON1091041119e-07
Smik_3.421.38ON110741101e-06
Suva_3.1781.38ON316871152e-06
TPHA0B048201.38ON138831102e-06
NDAI0A003801.38ON109951064e-06
Skud_3.271.38ON110741056e-06
YCL035C (GRX1)1.38ON110741041e-05
ZYRO0F17732g1.38ON139911051e-05
KAFR0D003601.38ON1091031031e-05
CAGL0M02167g8.679ON2331101071e-05
TDEL0C066401.38ON143791041e-05
KNAG0F002501.38ON142881023e-05
KAFR0B026008.240ON259121983e-04
NCAS0A003601.38ON13877860.004
NCAS0B048908.240ON274108780.090
TBLA0H028905.260ON89468770.17
ZYRO0B07634g4.211ON10999690.53
Ecym_11878.519ON13995690.75
NCAS0B022908.519ON13931690.90
TBLA0F038608.240ON249104701.1
TBLA0H035008.519ON149104671.4
NDAI0E028908.519ON15582671.5
Suva_5.3088.240ON244102681.5
Skud_4.3568.240ON262102682.0
KNAG0H030308.240ON23645672.2
Kpol_1046.138.240ON246102672.6
SAKL0H17710g8.240ON24191662.9
NDAI0B023008.240ON299100662.9
KNAG0A020908.519ON14982643.4
TPHA0B033408.240ON24999663.5
NCAS0C022408.519ON16182644.1
ADR053W8.519ON138100634.4
Skud_5.3138.240ON244102645.3
Smik_5.3468.240ON24487646.2
Smik_4.3398.240ON265100646.3
YER174C (GRX4)8.240ON24488637.1
KLLA0F17006g2.391ON41561637.8
NCAS0A053402.490ON1116106648.1
NDAI0J015108.240ON24534628.8
Skud_16.726.220ON81046638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0H00630
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   340   e-120
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   160   2e-48
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   121   7e-34
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   121   9e-34
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   114   4e-31
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   113   7e-31
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   112   2e-30
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   112   5e-30
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   110   1e-29
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   110   1e-29
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   110   2e-29
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   108   4e-29
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   107   2e-28
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   106   2e-28
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   106   3e-28
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   105   5e-28
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   103   2e-27
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   104   2e-27
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   104   2e-27
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   103   4e-27
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   102   1e-26
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   103   1e-26
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   101   2e-26
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   100   7e-26
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    69   2e-13
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    66   2e-12
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    64   8e-12
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    62   6e-11
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    59   3e-10
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      57   4e-10
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    56   5e-10
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    59   7e-10
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    56   1e-09
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    54   3e-09
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    56   3e-09
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    57   3e-09
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    56   3e-09
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      56   4e-09
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    56   5e-09
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    55   5e-09
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    53   8e-09
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    54   9e-09
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    55   1e-08
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    54   1e-08
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    52   1e-08
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    54   2e-08
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    52   3e-08
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    54   3e-08
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    52   4e-08
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    52   4e-08
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    52   4e-08
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    52   5e-08
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    51   5e-08
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    52   5e-08
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    50   6e-08
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    50   1e-07
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    52   1e-07
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    52   2e-07
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    51   2e-07
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    49   3e-07
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    51   4e-07
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    49   6e-07
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    47   9e-07
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    47   1e-06
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    49   2e-06
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    47   2e-06
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    45   4e-06
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    45   6e-06
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    45   1e-05
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    45   1e-05
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    44   1e-05
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    46   1e-05
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    45   1e-05
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    44   3e-05
KAFR0B02600 Chr2 complement(522861..523640) [780 bp, 259 aa] {ON...    42   3e-04
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    38   0.004
NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON}      35   0.090
TBLA0H02890 Chr8 complement(697941..700624,700782..700782) [2685...    34   0.17 
ZYRO0B07634g Chr2 complement(600410..600739) [330 bp, 109 aa] {O...    31   0.53 
Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to...    31   0.75 
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      31   0.90 
TBLA0F03860 Chr6 complement(955792..956541) [750 bp, 249 aa] {ON...    32   1.1  
TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON...    30   1.4  
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      30   1.5  
Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}...    31   1.5  
Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 b...    31   2.0  
KNAG0H03030 Chr8 complement(568120..568830) [711 bp, 236 aa] {ON...    30   2.2  
Kpol_1046.13 s1046 complement(27947..28687) [741 bp, 246 aa] {ON...    30   2.6  
SAKL0H17710g Chr8 (1565867..1566592) [726 bp, 241 aa] {ON} simil...    30   2.9  
NDAI0B02300 Chr2 complement(576792..577691) [900 bp, 299 aa] {ON...    30   2.9  
KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.51...    29   3.4  
TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.24...    30   3.5  
NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519      29   4.1  
ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic hom...    29   4.4  
Skud_5.313 Chr5 complement(523537..524271) [735 bp, 244 aa] {ON}...    29   5.3  
Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}...    29   6.2  
Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 b...    29   6.3  
YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}  G...    29   7.1  
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    29   7.8  
NCAS0A05340 Chr1 complement(1055424..1058774) [3351 bp, 1116 aa]...    29   8.1  
NDAI0J01510 Chr10 (348743..349480) [738 bp, 245 aa] {ON} Anc_8.240     28   8.8  
Skud_16.72 Chr16 (133328..135760) [2433 bp, 810 aa] {ON} YPL207W...    29   8.9  

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  340 bits (872), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 169/191 (88%)

Query: 1   MSLMNKRNVRILSITGXXXXXXXXXXQNDNWLLEXXXXXXXXXXXXRTAERVRNNEAPRP 60
           MSLMNKRNVRILSITG          QNDNWLLE            RTAERVRNNEAPRP
Sbjct: 1   MSLMNKRNVRILSITGLLLFVVFLFVQNDNWLLESVVSDSSASAPSRTAERVRNNEAPRP 60

Query: 61  IVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDK 120
           IVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDK
Sbjct: 61  IVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDK 120

Query: 121 HPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVS 180
           HPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVS
Sbjct: 121 HPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVS 180

Query: 181 SKDAAPKPNKK 191
           SKDAAPKPNKK
Sbjct: 181 SKDAAPKPNKK 191

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  160 bits (404), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 97/130 (74%)

Query: 52  VRNNEAPRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSP 111
           V+NN A R + GGS   KFDPAQEY  I E++P++L++KTFCPYCKRL KLL ++Y F P
Sbjct: 126 VQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQP 185

Query: 112 DIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK 171
           +   ++LDKH +GDEL  ++ +QT H TVPN ++NGKSLGG+D I KL +   + +TIQ+
Sbjct: 186 EFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245

Query: 172 DSDFSVIVSS 181
            SD+SV+V +
Sbjct: 246 MSDYSVVVKA 255

 Score = 31.6 bits (70), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 5  NKRNVRILSITGXXXXXXXXXXQNDNWLL 33
          NKRN+RILSITG          QN+N +L
Sbjct: 6  NKRNIRILSITGVLLFVIFLISQNNNGML 34

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  121 bits (303), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 91/138 (65%)

Query: 48  TAERVRNNEAPRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNY 107
           T+E      A   IV   +   FD A+EY +I++  P+V+FSKTFCPY K LK+LL+ N+
Sbjct: 77  TSEEDSKINADSSIVQAEAEVPFDVAKEYTSILQRGPMVIFSKTFCPYSKALKELLSTNF 136

Query: 108 RFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQ 167
           + +P   +IELDKH +G+EL +YIK+QT   TVPNLI+NG S GG D +KKL D+ ++  
Sbjct: 137 QINPQPIVIELDKHEHGEELQAYIKEQTGRGTVPNLIINGNSKGGSDDMKKLFDENVLLD 196

Query: 168 TIQKDSDFSVIVSSKDAA 185
           ++ + S+ +  V + + A
Sbjct: 197 SLNEWSNGAYEVQATETA 214

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  121 bits (304), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 80/117 (68%), Gaps = 2/117 (1%)

Query: 63  GGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHP 122
           G  S G+FDPA+EY  I+ ++PV++FSK+FCPY  RLK+LL   Y  +P   +IELDKH 
Sbjct: 118 GTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHK 177

Query: 123 NGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK--DSDFSV 177
           +G  L  +I+++T   TVPNL++NGKS GGFD IK L     + +++ K  D DF+V
Sbjct: 178 HGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTV 234

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  114 bits (285), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           + PA+E+  +++ AP+V+FSK++CP+ K LKKLL  NYR  P    +E+D+HPNGD+L+S
Sbjct: 114 YSPAKEFQKLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYS 173

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTI 169
           YIK+ T   TVPNLI NG S GGFD +  L +   +E  +
Sbjct: 174 YIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNELESKL 213

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  113 bits (283), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 72/93 (77%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           F+ A+EY +I+E++P+V+FSK+FCP+  +LK+L A+ Y+F+P+  I+ELDKH +GD L +
Sbjct: 102 FNAAKEYASILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQA 161

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
           YIK++T   TVPN+++NG S GG D ++ L  D
Sbjct: 162 YIKEKTGRGTVPNVVINGVSRGGSDDLRALHAD 194

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  112 bits (281), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 73/113 (64%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           ++PA  Y  I++MAPV++FSKT CPY  +LK LL  NY+F+PD  +IELD      EL  
Sbjct: 132 YNPADRYQKILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQF 191

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSK 182
           YI QQT   TVPNL+VNGKS+GG D I  L     + ++I+  SD  V V+ K
Sbjct: 192 YISQQTGRKTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKKVTVTPK 244

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  112 bits (279), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 69/94 (73%)

Query: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           +FDP +EY  I++ +P+++FSK+ CPY K+LK+LL   Y F+P   +IELD+H NG EL 
Sbjct: 132 EFDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIELDRHHNGAELQ 191

Query: 129 SYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
            Y++Q+T  +TVPN+I+NGKS GG D  + L ++
Sbjct: 192 KYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNE 225

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  110 bits (274), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 8/147 (5%)

Query: 50  ERVRNNEAPRPIVGGSSSGK-------FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKL 102
           + +RN +    I  GSS GK       FDPA EY  I+  +P+++FSK+ CPY  ++K+L
Sbjct: 65  QAIRNIQEEVGIKEGSS-GKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKEL 123

Query: 103 LADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
           L   Y F+PD  ++ELD+H +G EL  YI + T+  TVPN++++G S GG+D  K L D 
Sbjct: 124 LKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDK 183

Query: 163 KLVEQTIQKDSDFSVIVSSKDAAPKPN 189
             + +++Q  SD   +  SK   P  N
Sbjct: 184 GKLLESLQDWSDGKTLSVSKKEKPSNN 210

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  110 bits (275), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 68  GKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDEL 127
           G FD A+EY  I++++PV++FSK++CP+   LK+LL+  + F+P+  +IELD+H +G EL
Sbjct: 114 GTFDAAKEYAMILDLSPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAEL 173

Query: 128 FSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD-KLVE 166
            +YI ++T  +TVPN+IVNG S GG D I  L D+ KL+E
Sbjct: 174 QAYIAKKTDRSTVPNMIVNGISRGGRDEIVALNDEGKLLE 213

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  110 bits (274), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 67/93 (72%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FD A+EY  I+   P+V+FSK+ CPY  +LKKLL  N++FSP+  I+ELDKH +GD L  
Sbjct: 110 FDVAKEYAAILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQG 169

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
           YIK++T   TVPNLIV G S GG D I+KL D+
Sbjct: 170 YIKEETGRGTVPNLIVGGLSRGGSDDIQKLFDE 202

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  108 bits (269), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 93/176 (52%), Gaps = 23/176 (13%)

Query: 4   MNKRNVRILSITGXXXXXXXXXXQN---------DNWLLEXXXXXXXXXXXXRTAERV-- 52
           +NKRN+R LS+T           QN         D  +LE              +     
Sbjct: 5   LNKRNIRALSVTLLLLLLVLFVTQNARNVSVTVDDRQVLEGVPLVNYANVEDPVSVAAVK 64

Query: 53  ------RNNEAPRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADN 106
                 R+ +AP P      +G F PA EY +I+  +PVV+FSK++CPY  +LKKLLA  
Sbjct: 65  PKIGTDRSGQAPEP------AGVFSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAG 118

Query: 107 YRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
           ++F+P   ++ELD+H +G EL  YI ++T  +TVPNLIVNG S GG D I  L ++
Sbjct: 119 FKFTPAYTVVELDEHEHGPELQKYIAEKTGRSTVPNLIVNGVSHGGCDDIVALSEN 174

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  107 bits (268), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 1/121 (0%)

Query: 64  GSSSGK-FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHP 122
           G+ +GK F+  QEY  ++++APV++FSK+ C Y K LK+LL   Y+F P+  IIELDKH 
Sbjct: 108 GTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHA 167

Query: 123 NGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSK 182
           +G+EL  YIK  T   TVPNL++NG S GG + IK+L     +  ++Q+ S     V  +
Sbjct: 168 HGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQR 227

Query: 183 D 183
           +
Sbjct: 228 E 228

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  106 bits (265), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           KFD A EY  I++ + +V+FSK++CP+ K+LK LLA++Y+FSP   ++ELD+H + DEL 
Sbjct: 85  KFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQ 144

Query: 129 SYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQ-DDKLVE 166
            YI++ T   TVPN+I+NG S GG D +  L  +DKL+E
Sbjct: 145 DYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLE 183

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  106 bits (265), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FD A EY  I+E +P V+FSKT CPY K+LK LLA++Y  +P   ++ELD+H +G EL  
Sbjct: 86  FDAAAEYGKILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELKD 145

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKL-QDDKLVEQTIQKDSD-FSVIVSSK 182
           YI  +T  +TVPN+++NG S GG+  +  L ++D LV+   +  SD F+V  +S+
Sbjct: 146 YIGDKTGRSTVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDKFTVKATSQ 200

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  105 bits (263), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 81/127 (63%), Gaps = 7/127 (5%)

Query: 64  GSSSG-------KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKII 116
           G+SSG       +FDPA+EY  I+   P+++FSK+ CP+ K+LK LLA  + FSP   ++
Sbjct: 82  GASSGTDFTQEKEFDPAKEYQYILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSPSYMVV 141

Query: 117 ELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFS 176
           ELDKH +G EL  +I   T  +TVPN+I+NG S GG D  +KLQ+   +  +++   D +
Sbjct: 142 ELDKHEHGAELQKHIGSLTGRSTVPNVIINGVSRGGCDDFEKLQEKGELLSSLKTWCDKA 201

Query: 177 VIVSSKD 183
           + VS K+
Sbjct: 202 LTVSKKE 208

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  103 bits (258), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 16/179 (8%)

Query: 3   LMNKRNVRILSITGXXXXXXXXXXQNDNWLLEXXXXXXXXXXXXR---------TAERVR 53
           ++NKRNVR+L IT           +N N  +                       T + V 
Sbjct: 4   VINKRNVRVLVITNLLLILVFLVVRNSNANVNESTITPHGTSLATYNDAGNAPGTHKSVH 63

Query: 54  NNEA------PRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNY 107
           +++A      P      S   +FD A EY  I++ +P+++FSK+FCP+ K+LK LLA++Y
Sbjct: 64  DSDANKQVKEPDETNENSEEAQFDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAESY 123

Query: 108 RFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKL-QDDKLV 165
            FSP   ++ELDK  +  EL  +I++ T   TVPN++++G S GG D I  L ++DKL+
Sbjct: 124 TFSPSYYVVELDKREHTSELQEHIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKLL 182

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  104 bits (260), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 80/116 (68%), Gaps = 3/116 (2%)

Query: 65  SSSGK-FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPN 123
           S +GK F+  +EY  +++++PV++FSK+ C Y K +K+LL + Y+F P+  IIELDKH +
Sbjct: 108 SGTGKLFNVQKEYSLMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGH 167

Query: 124 GDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSD--FSV 177
           G+EL  YIK +T   TVPNL+VNG S GG + I+KL     + +++Q  SD  FSV
Sbjct: 168 GEELQEYIKLKTGRGTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGKFSV 223

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  104 bits (260), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 69/98 (70%)

Query: 65  SSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNG 124
           SSS +F+ A+EY +I+E +P+V+FSK++CP+  +LK LLA  Y+F+P   ++ELDKH +G
Sbjct: 107 SSSVEFNAAKEYASILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHG 166

Query: 125 DELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
            EL  YI   T  +TVPN+++N  S GG D ++ L  D
Sbjct: 167 AELQKYIGDVTGRSTVPNVVINRVSRGGSDDLRALHKD 204

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  103 bits (257), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 75/113 (66%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FD A+ Y  I+ ++ +V+FSK+ CP    LK+LL +NY F PD +++ELDKH NG EL  
Sbjct: 98  FDAAKTYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQK 157

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSK 182
           Y+ + T+ +TVPNL++NG S GG DSI +L     + ++++K ++    V+ K
Sbjct: 158 YVTKTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKHAVTQK 210

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  102 bits (254), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 72/115 (62%)

Query: 65  SSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNG 124
           S   +FD A EY  IME +P+++FSKT CPY K+LK LL ++Y FSP   ++ELD+H + 
Sbjct: 80  SGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHT 139

Query: 125 DELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIV 179
            EL   I++ T   TVPN+I+ G S GG+  I +L  +  +  + +K SD +  V
Sbjct: 140 KELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGAFTV 194

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  103 bits (256), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 2/110 (1%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           F+  +EY  I++++P+++FSK+ C Y K +K+LL + Y+F P+  IIELDKH +G+EL  
Sbjct: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQ-DDKLVEQ-TIQKDSDFSV 177
           YIK  T   TVPNL+VNG S GG + IKKL    KL+E   +  D  FSV
Sbjct: 173 YIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSV 222

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  101 bits (252), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           ++   EY NI+  +P+V+FSK++CP+  RLK LL + Y F P   I+ELDKH NG EL  
Sbjct: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQK 154

Query: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSKDAA 185
           YI  +T  +TVPN+I+NG S GG D    L +D  + Q+++  +  ++ V    AA
Sbjct: 155 YIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKAAAA 210

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  100 bits (250), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 78/117 (66%), Gaps = 3/117 (2%)

Query: 64  GSSSGK-FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHP 122
           GS +GK F+  +EY  +++++PV++FSK+ CPY + +K+LL + Y+F P+  IIELDKH 
Sbjct: 107 GSGTGKGFNVQKEYSLMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHG 166

Query: 123 NGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSD--FSV 177
           +G+EL  YI+  T    VPNL++NG S GG + I+ L     +  ++Q  S+  FSV
Sbjct: 167 HGEELQEYIRLMTGRGAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGKFSV 223

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FDP + +  I+  +P VLF K+       L+KLL + Y  SP++ +++LDKH NG EL  
Sbjct: 228 FDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELAVVDLDKHSNGVELEQ 287

Query: 130 YIKQQ--------TSHTTVPNLIVNGKSL---GGFDSIKKLQDDKLVEQTIQKDSDFSVI 178
           YIKQ          S   VP L +NG S+   G    I KL  +  + + ++  SD  ++
Sbjct: 288 YIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNGHLLEKLRSLSDGHIM 347

Query: 179 VSSKD 183
              KD
Sbjct: 348 FVKKD 352

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 59/108 (54%), Gaps = 15/108 (13%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FDP+  +  I+  +PVV+F+K+     + LK LL   Y+ SP + ++ELDKH  G EL  
Sbjct: 125 FDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAVVELDKHAKGKELQD 184

Query: 130 YIK--QQTSHTT----------VPNLIVNGKSL---GGFDSIKKLQDD 162
           YIK  + T++ +          VP L +NG S+   G  D IKKL  D
Sbjct: 185 YIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLHKD 232

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 63.9 bits (154), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 67  SGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDE 126
           S  FD    +  I+  +PVVLF KT        K LL   Y  SP++ +++LDKH NG +
Sbjct: 143 SASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKHSNGAK 202

Query: 127 LFSYIKQQ---TSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK 171
           L  YI++    T    +P L +N  ++   D++KK   D  + +  +K
Sbjct: 203 LQEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKK 250

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 15/145 (10%)

Query: 53  RNNEAPRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPD 112
           RNN+  +  +    +  FD A  Y  I+  + VVLF K+       +KKLL ++Y   P+
Sbjct: 151 RNND--KYDINAYKNAAFDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPE 208

Query: 113 IKIIELDKHPNGDELFSYIKQQTSHTT-----------VPNLIVNGKSL--GGFDSIKKL 159
           I I++LD+H  G  L  YI ++   T            VP L++NG S       +  KL
Sbjct: 209 IAIVDLDRHVQGALLHDYIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKL 268

Query: 160 QDDKLVEQTIQKDSDFSVIVSSKDA 184
            ++ L+ Q ++  +  SV++S KD+
Sbjct: 269 HNEGLLLQKLKNLAGDSVMISKKDS 293

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 67  SGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDE 126
           S  FDPA  +  I+  +PVVLF  +     +RL+ LL  +Y  SP   +++L+KH  G +
Sbjct: 140 SADFDPAANFQEILSASPVVLFVDS-AQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQ 198

Query: 127 LFSYIK----QQTSHTTVPN----LIVNGKSLGGFDSIKKLQD 161
           L +YI+    +  S T VP     L VNG S+   D    +QD
Sbjct: 199 LETYIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQD 241

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query: 73  AQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNGDELFSYI 131
           AQ    ++   P+ + +K++CPYC+  K  L        D   +++LD+  +G  + + +
Sbjct: 6   AQSVKELIAAKPIFVAAKSYCPYCQASKSTLFKELNVPADKATVLDLDQMQDGQAIQAIL 65

Query: 132 KQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTI 169
            + T   TVPN+ +NGK +GG   ++ L+++  +++ +
Sbjct: 66  AELTQQNTVPNIFINGKHIGGNSDLQALKNNGELQKLV 103

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 56/93 (60%), Gaps = 6/93 (6%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRF-SPDIKIIELDKH-PNGDELFSYIKQQTSHTTVPN 142
           V + SKT+CPYC+  K+ L +  R  +  +K++ELD     G  + + +++ +   TVPN
Sbjct: 19  VFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQAALQELSGQRTVPN 78

Query: 143 LIVNGKSLGGFDSIKKLQD----DKLVEQTIQK 171
           + +NG+ +GG   ++ L+     D+L+E+ +++
Sbjct: 79  IYINGRHVGGNSDLEALKASGELDQLLEEALRE 111

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 12/130 (9%)

Query: 66  SSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGD 125
           SS  F+    +  I+  +P VLF K+     + LK LL+  Y  SP + I++L+KH NG+
Sbjct: 137 SSTSFNAEDNFKQILNTSPAVLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGN 196

Query: 126 ELFSYIKQQ---------TSHTTVPNLIVNGKSL---GGFDSIKKLQDDKLVEQTIQKDS 173
           +L +YIK+          +S   +P L +NG S+   G    IK+L  +  +   ++  S
Sbjct: 197 QLLNYIKKNKLLPPSNKASSTPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYS 256

Query: 174 DFSVIVSSKD 183
           D  +    K+
Sbjct: 257 DGHIFFEKKN 266

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 55/92 (59%), Gaps = 2/92 (2%)

Query: 73  AQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFS-PDIKIIELD-KHPNGDELFSY 130
            Q+  ++++ + + + SKT+CPYC+R KK L ++ +   P+ K++ELD     G ++ + 
Sbjct: 55  VQQVQSLIKQSKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVLELDIMGQEGVDIQAA 114

Query: 131 IKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162
           + + +   TVPN+ + GK +GG   ++ L+  
Sbjct: 115 LLELSGQRTVPNIYIGGKHIGGNSELQALESS 146

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 53.9 bits (128), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 51/89 (57%)

Query: 78  NIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH 137
            ++E   VV+FSKTFCPYCK   K   +       +++++LDK  +G E+   + +    
Sbjct: 12  ELVEDNKVVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNGQ 71

Query: 138 TTVPNLIVNGKSLGGFDSIKKLQDDKLVE 166
            TVP++ +  + +GG   ++KL+ + ++E
Sbjct: 72  KTVPSIYILKRHIGGNSELQKLKHEGVLE 100

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 10/110 (9%)

Query: 51  RVRNNEAPRPIVGGSSS-GKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRF 109
           +++      PI   SS    F+P   +  I+E +P+VLF K+     K ++ +L   Y  
Sbjct: 88  QIKTTSILSPIPTSSSPIQSFNPEVNFFQILETSPMVLFIKSSERDSKIIRDILTKEYEI 147

Query: 110 SPDIKIIELDKHPNGDELFSYIKQ---------QTSHTTVPNLIVNGKSL 150
           SP++ +++LDKH +GDEL  +I+           +S  ++P L VN  S+
Sbjct: 148 SPELAVVDLDKHKHGDELEEFIRLNKLNEQAIFSSSLASLPYLFVNEVSM 197

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 6/105 (5%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTF--CPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDEL 127
           +DP   +  +M M+PVVLF K+         ++K+L+  Y  SP   +++LDKH  G+EL
Sbjct: 148 WDPLSTFTEVMNMSPVVLFIKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEEL 207

Query: 128 FSYIKQQT----SHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQT 168
            +YI+ Q     S   +P L VN   + G   I  + + K +  T
Sbjct: 208 QNYIETQKLPGGSSQQLPYLFVNRVPVIGAGEIDSVAEFKRLHST 252

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (50%), Gaps = 10/124 (8%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FD  + +  I+  +PVV+F K+  P    LK LL   Y  SP++ +++LD+H  G  L  
Sbjct: 122 FDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLLQK 181

Query: 130 YIK--QQTSHTT-----VPNLIVNGKSL---GGFDSIKKLQDDKLVEQTIQKDSDFSVIV 179
           YIK  Q TS        VP L +NG S+   G    IK+ Q   ++   ++  +  +V++
Sbjct: 182 YIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNVMI 241

Query: 180 SSKD 183
             KD
Sbjct: 242 QKKD 245

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 52  VRNNEAPRPIVGG--SSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRF 109
           V + E P   +    S +  F+  Q +  I+  +PVVLF K+     + ++ LL   Y  
Sbjct: 95  VSHQERPTTTLQALPSHAAAFNVQQHFTQIIHTSPVVLFMKSSQDDSRLMRDLLQKEYEI 154

Query: 110 SPDIKIIELDKHPNGDELFSYIK------QQTSHTTVPNLIVN 146
           SP+I +++LDKH +G  L  YI+      + T++  +P L +N
Sbjct: 155 SPEIAVVDLDKHTHGAALQDYIRLNKLDNRGTAYVKLPYLFIN 197

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 16/111 (14%)

Query: 66  SSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGD 125
           S+ +F P+  +  I+  +PV+LF K+       LK +L   Y FSP+I +++LDKH  GD
Sbjct: 144 SNERFSPSLGFQQILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGD 203

Query: 126 ELFSYIK------------QQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKL 164
            +  YI+            + +    VP L +NG SL      K L+DD L
Sbjct: 204 SMQEYIQLNRLATYKSNYGESSKSPDVPYLFINGVSLIN----KSLKDDIL 250

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (47%), Gaps = 20/111 (18%)

Query: 57  APRPIV-------GGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRF 109
           A RP+V       GG   G F PAQ +  I+  +P VLF K      + L+ LL + Y  
Sbjct: 65  ATRPLVNLDAVRRGG---GDFRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEV 121

Query: 110 SPDIKIIELDKHPNGDELFSYIKQQTSHTT----------VPNLIVNGKSL 150
           +P+I +++L KH    +L  YI++   H            VP L V G+S+
Sbjct: 122 TPEIAVVDLSKHRYSGDLQRYIREHKLHGPLFQLTENTPDVPYLFVKGESV 172

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 53.1 bits (126), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 4/96 (4%)

Query: 66  SSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNG 124
           S    D  + +IN     P+ +  K+ CPY K+  + L D+     D + +I +D+  NG
Sbjct: 13  SHAVLDQVKAWIN---AKPIFVARKSDCPYSKKTLETLFDDLHVPKDKVLLITVDEIENG 69

Query: 125 DELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQ 160
            E+   I   T   TVPN  +NG+ +GG D ++KL+
Sbjct: 70  AEVKQAIIDYTGQKTVPNTYINGRHIGGNDDLQKLK 105

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 53.5 bits (127), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 64  GSSSGKFDPAQEYINIMEMAP---VVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELD 119
           GS  GK    Q   ++  +     + + SKT+CPYC+   KLL ++ + + D + +++LD
Sbjct: 24  GSVFGKMASPQTIQHVQGLIKNNKIFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLD 83

Query: 120 KHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK 171
               G E+   + + +   TVPN+ ++G+ +GG   ++ L+    ++  ++K
Sbjct: 84  TIKEGSEIQEALAEISGQKTVPNVYISGEHIGGNSDLQALESSGKLDALLKK 135

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 50/99 (50%), Gaps = 12/99 (12%)

Query: 64  GSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPN 123
           G    +F PA  +  I+  +PVV+F+K      + LK LL   Y  +P+I I++L KH  
Sbjct: 142 GGMKNEFMPAIAFQEILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVDLMKHDQ 201

Query: 124 GDELFSYI---KQQTSHTT---------VPNLIVNGKSL 150
           GDEL  YI   K  T +T          VP L +NG S+
Sbjct: 202 GDELQKYIMLNKLNTYNTHYDASDDIPDVPYLFINGVSV 240

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 60/97 (61%), Gaps = 5/97 (5%)

Query: 78  NIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNGDELFSYIKQQTS 136
            +++ + + + SKT+CPYC+   + L D+ +   D IK+++L++  +G E+   +++ + 
Sbjct: 68  TLIKQSKIFVASKTYCPYCQATLRTLFDDKKVPNDKIKVLQLNQLDDGAEIQDALQEISG 127

Query: 137 HTTVPNLIVNGKSLGGFDSIKKL----QDDKLVEQTI 169
             TVPN+ + GK +GG   +++L    + D+L+E+ +
Sbjct: 128 QRTVPNIYILGKHIGGNSDLQELAAAGELDRLLEEAL 164

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 84  PVVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNGDELFSYIKQQTSHTTVPN 142
           PV + +K++CP+C+  ++ L + Y    +   ++ELD   +G E+   + + T   TVPN
Sbjct: 18  PVFVAAKSYCPHCRATRETLFEEYNLPREKALVLELDLMTDGAEIQEALAEITHQDTVPN 77

Query: 143 LIVNGKSLGGFDSIKKLQDD 162
           + + G+ +GG   ++ L+ D
Sbjct: 78  IFIYGQHVGGNSDLQALKKD 97

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           KFDP  ++++I+  +P VLF K+       LK LL   +  SP++  ++L+KH +G EL 
Sbjct: 153 KFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEKHSHGYELE 212

Query: 129 SYIKQ 133
            YIKQ
Sbjct: 213 KYIKQ 217

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 85  VVLFSKTFCPYCK-RLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           V + +KT+CPYCK  L  L  +         ++ELD+  NG E+   +++ +   TVPN+
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKAVVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 144 IVNGKSLGGFDSIKKL-QDDKLVE 166
            +NGK +GG   ++ L ++ KL E
Sbjct: 113 YINGKHIGGNSDLEALKKNGKLAE 136

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 5/89 (5%)

Query: 67  SGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDE 126
           +G ++P   +  I+  +P+VLF ++     K +KKL  + Y  SP+  I++LD H NG+ 
Sbjct: 122 TGSYNPELNFKQILNTSPMVLFIRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNI 181

Query: 127 LFSYIK-----QQTSHTTVPNLIVNGKSL 150
           L +YI+      +     VP L +NG S+
Sbjct: 182 LQNYIQTKKIINKDDTLDVPYLFINGVSV 210

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 85  VVLFSKTFCPYCK-RLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           V + +KT+CPYCK  L  L  +         ++ELD+  NG E+   +++ +   TVPN+
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 144 IVNGKSLGGFDSIKKL-QDDKLVE 166
            +NGK +GG   ++ L ++ KL E
Sbjct: 113 YINGKHIGGNSDLETLKKNGKLAE 136

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 4/78 (5%)

Query: 85  VVLFSKTFCPYCK-RLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           V + +KT+CPYCK  L  L  +         ++ELD+  NG E+   +++ +   TVPN+
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQRTVPNV 112

Query: 144 IVNGKSLGG---FDSIKK 158
            +NGK +GG    +S+KK
Sbjct: 113 YINGKHIGGNSDLESLKK 130

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 78  NIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKII-ELDKHPNGDELFSYIKQQTS 136
           N++    + + SK++CPYC+  K+ L +  +   D  ++ ELD+   G ++   + +   
Sbjct: 45  NMIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQALAEING 104

Query: 137 HTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK 171
             TVPN+ ++G+ +GG   ++KL+    ++  +QK
Sbjct: 105 QNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQK 139

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 84  PVVLFSKTFCPYCK-RLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPN 142
           P+ + SKT+CPYC+  LK L  +      +  +++LD+ P+G E+   +       TVPN
Sbjct: 66  PIFVASKTYCPYCRATLKTLFKELEIPESEAVVLQLDEMPDGPEIQEALFDINGQKTVPN 125

Query: 143 LIVNGKSLGGFDSIKKLQ 160
           + + G+ +GG D ++ L+
Sbjct: 126 IYIKGQHIGGNDDLQTLK 143

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 50.8 bits (120), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 79  IMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIK-IIELDKHPNGDELFSYIKQQTSH 137
           ++  + + + SKT+CPYC+   K L +  +    +  +++L++  +G ++   + + T  
Sbjct: 13  LINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEITGQ 72

Query: 138 TTVPNLIVNGKSLGGFDSIKKLQD----DKLV 165
            TVPN+ +NGK +GG   +++L +    DKL+
Sbjct: 73  KTVPNIFINGKHIGGNSDLQELNNSGDLDKLL 104

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 85  VVLFSKTFCPYCK-RLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           V + +KT+CPYCK  L  L  +         ++ELD+  NG E+   +++ +   TVPN+
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 144 IVNGKSLGGFDSIKKL-QDDKLVE 166
            +NGK +GG   ++ L ++ KL E
Sbjct: 113 YINGKHIGGNSDLETLKKNGKLAE 136

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 84  PVVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNGDELFSYIKQQTSHTTVPN 142
           PV + +K++C      K  L D Y    D   ++ELDK  +G+ +   + + +  +T+PN
Sbjct: 17  PVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSKISQQSTLPN 76

Query: 143 LIVNGKSLGGFDSIKKLQDDKLVEQTI 169
           + + GK +GG+  +K++ +   +E+ +
Sbjct: 77  IFIKGKHIGGYQDLKEMNESGELEKLL 103

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRFSPDIKII-ELDKHPNGDELFSYIKQQTSHTTVPNL 143
           V + +K++CPYC+   + L  +Y    D  ++ +L++  +GD++ + + + T   TVPN+
Sbjct: 51  VFVAAKSYCPYCQASLQTLFTDYHVPKDKSLVLQLNQMEDGDDIQAALAEITGQRTVPNI 110

Query: 144 IVNGKSLGGFDSIKKLQ 160
            ++GK +GG   +++L+
Sbjct: 111 YIDGKHIGGNSDLQQLK 127

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           KFDP   +++I+  +P VLF K+       LK+LL   +  SP++ I++L+KH  G EL 
Sbjct: 152 KFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHSYGYELE 211

Query: 129 SYIKQ 133
            YIK+
Sbjct: 212 KYIKE 216

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (53%), Gaps = 12/114 (10%)

Query: 65  SSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNG 124
           +S   FD A  +  I+  +PVV+F  +     + L+ LL  +Y  SP   +++L+KH  G
Sbjct: 143 ASGSDFDAAASFSEILNTSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRG 201

Query: 125 DELFSYIK----QQTSHTT---VPNLIVNGKSLGGFDSIKKLQD----DKLVEQ 167
            +L S+I+     QTS+ +    P L VNG+S+   D    +QD    +KL+E+
Sbjct: 202 AQLESFIRLYKTDQTSNPSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEK 255

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 13/92 (14%)

Query: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129
           FDP   +++I++ +P VLF K+       L+ LL   +  SP++  ++L+KH  G EL  
Sbjct: 156 FDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYELEK 215

Query: 130 YIKQ-----------QTSHTTVPNLIVNGKSL 150
           YIKQ           ++ H   P L +NG SL
Sbjct: 216 YIKQNKLNIDPDIALESIHP--PYLFLNGVSL 245

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 50/90 (55%), Gaps = 5/90 (5%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           + + +KT+CPYC    KLL  + +   D + +++LD    G E+   + + +   TVPN+
Sbjct: 48  IFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEISGQRTVPNI 107

Query: 144 IVNGKSLGGFDSIKKLQD----DKLVEQTI 169
            + G+ +GG   ++ L+     D+L+E+ +
Sbjct: 108 YILGEHIGGNSDLQALEASGKLDELLEKAL 137

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 13/93 (13%)

Query: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           +FDP   +++I+  +P VLF K+       LK LL   +  SP++  ++L+KH +G +L 
Sbjct: 156 EFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQLE 215

Query: 129 SYIKQ-----------QTSHTTVPNLIVNGKSL 150
            YIKQ           ++ H+  P L +NG S+
Sbjct: 216 KYIKQNKLSINPSTALESIHS--PYLFLNGVSV 246

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRFSPDIK--IIELDKHPNGDELFSYIKQQTSHTTVPN 142
           V++F+K++CPYCK  K  + +     P  K  +++LD   NG E+   +       TVP+
Sbjct: 48  VIIFAKSYCPYCKAAKHTIFEEINV-PKSKALVLDLDLMDNGQEIQQALLAINGQKTVPH 106

Query: 143 LIVNGKSLGGFDSIKKL 159
           + +NG+ +GG   ++K+
Sbjct: 107 VYINGEFIGGNSEVQKI 123

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 7/104 (6%)

Query: 73  AQEYIN----IMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIK--IIELDKHPNGDE 126
           +QE IN    ++    + + SKT+CPYC    K L       P  K  +++L++  +G E
Sbjct: 3   SQETINHVKQLINEKEIFVASKTYCPYCHATIKTLFKELNV-PKSKALVLQLNEMDDGAE 61

Query: 127 LFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQ 170
           +   + +     TVPN+ +NGK +GG D ++ L++   +E  ++
Sbjct: 62  IQQALFEINGQKTVPNIYINGKHVGGNDKLQDLKESGELEDLLE 105

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRF-SPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           + + SKT+CPYC      L +  +     + +++L++  +G E+ + + +     TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEINGQRTVPNI 78

Query: 144 IVNGKSLGGFDSIK 157
            +NGK +GG D ++
Sbjct: 79  YINGKHIGGNDDLQ 92

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 85  VVLFSKTFCPYCKR-LKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           + + SKT+CPYC   L  L          + +++L++  +G ++ + + Q     TVPN+
Sbjct: 225 IFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMKDGVDIQAALYQLNGQRTVPNI 284

Query: 144 IVNGKSLGGFDSIKKLQDDKLVEQTIQ 170
            +NGK +GG D +++L++   +E  ++
Sbjct: 285 YINGKHIGGNDDLQELRETGELEDLLE 311

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 79  IMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPD-IKIIELDKHPNGDELFSYIKQQTSH 137
           +++   V + +K++CPYCK     L D  +   +   +++LD   +G EL   ++Q    
Sbjct: 42  LIKQKSVFVAAKSYCPYCKNTLITLFDELKVPKEKALVLQLDGMSDGLELQDTLQQINGQ 101

Query: 138 TTVPNLIVNGKSLGGFDSIKKLQ 160
            TVP + ++GK +GG   ++KL+
Sbjct: 102 RTVPQIYIDGKHVGGNSELQKLK 124

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 7/95 (7%)

Query: 73  AQEYIN-IMEMA---PVVLFSKTFCPYCKRLKKLLADNYRFSPDIK--IIELDKHPNGDE 126
           +QE IN + EM     + + SKT+CPYC    K L +  +  P  K  +++L++  +G +
Sbjct: 3   SQETINRVKEMINEKEIFIASKTYCPYCFSTIKTLFEELKV-PKSKALVLQLNEMDDGAD 61

Query: 127 LFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQD 161
           +   + +     TVPN+ +NGK +GG   ++ L++
Sbjct: 62  IQEALFEINGQKTVPNIYINGKHIGGNSQLQDLKE 96

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRF-SPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           + + SKT+CPYC      L    +     + +++L++  +G ++ + + +     TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFQQLKVPKSKVLVLQLNEMEDGADIQAALYEINGQRTVPNV 78

Query: 144 IVNGKSLGGFDSIK 157
            +NGK +GG D ++
Sbjct: 79  YINGKHIGGNDDLQ 92

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRF-SPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNL 143
           + + SKT+CPYC      L +  +     + +++L+    G ++ + + +     TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNI 78

Query: 144 IVNGKSLGGFDSIK 157
            +NGK +GG D ++
Sbjct: 79  YINGKHIGGNDDLQ 92

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 71  DPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIK--IIELDKHPNGDELF 128
           D  Q    ++    + + SKT+CPYC+   K L  + +F P+ +  +++L+   +G ++ 
Sbjct: 39  DTIQRVKGLIGQKKLFVASKTYCPYCQATLKTLFTDLQF-PEAQAIVLQLNTIDDGQDIQ 97

Query: 129 SYIKQQTSHTTVPNLIVNGKSLGGFDSIKKL 159
             + +     TVPN+ ++GK +GG   +++L
Sbjct: 98  DALYEINGQRTVPNIYIDGKHIGGNSDLQEL 128

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 55/103 (53%), Gaps = 5/103 (4%)

Query: 73  AQEYIN----IMEMAPVVLFSKTFCPYCKR-LKKLLADNYRFSPDIKIIELDKHPNGDEL 127
           +QE IN    ++    V + SK++CPY K  L  L  +    +    ++++++ P G ++
Sbjct: 3   SQETINHVKDLINEKDVFVASKSYCPYSKAALNTLFTELNVPTSKALVLQVNQLPEGSDI 62

Query: 128 FSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQ 170
              + + T   TVPN+ + GK +GG D ++ L+    +E+ ++
Sbjct: 63  QDALLELTGQRTVPNIYIKGKHIGGNDDLQILKQSGKLEKLLE 105

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query: 69  KFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           ++DP + +  I+  +P VLF ++       L+KLL  +Y  +P++ I++LDKH +   L 
Sbjct: 97  EYDPEKNFKQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLE 156

Query: 129 SYIKQQTSHTT--------------VPNLIVNGKSL---GGFDSIKKLQD 161
            +I      +T               P L +NG SL   G  D I K  +
Sbjct: 157 RHILSHKIKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHE 206

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRFSPDIK--IIELDKHPNGDELFSYIKQQTSHTTVPN 142
           + + SKT+CPYC+   K L D+    P  K  +++L+   +G E+   + +     +VPN
Sbjct: 53  IFVASKTYCPYCQATLKTLFDDLNV-PKSKSLVLQLNTMDDGAEIQEALFEINGQKSVPN 111

Query: 143 LIVNGKSLGGFDSIKKLQD 161
           + ++GK +GG   +++L++
Sbjct: 112 IYIDGKHIGGNSDLQELKN 130

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 90  KTFCPYCKRLKKLLADNYRF-SPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGK 148
           KT+CPYCK     L D  +  +  IK+++L++  +G E+   + Q     TVP++ +N  
Sbjct: 53  KTWCPYCKATIVTLLDQMKVPASKIKVLKLNELKHGREIQEALFQMNGQKTVPHIYINQI 112

Query: 149 SLGGFDSIKKLQDD----KLVEQTIQKD 172
            +GG   +++L+       L+ + I+KD
Sbjct: 113 FIGGNSDLEELRVSGKLRNLLGEVIEKD 140

>KAFR0B02600 Chr2 complement(522861..523640) [780 bp, 259 aa] {ON}
           Anc_8.240 YDR098C
          Length = 259

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 24/121 (19%)

Query: 51  RVRNNEAPRPIVGGSSSGKFDPA--QEYINIMEMAPVVLF-----SKTFCPYCKRLKKLL 103
           R   NEA +P        + +PA  Q+  N+++ AP +LF     S+ +C Y +++ KLL
Sbjct: 145 RAIGNEACKP--------ELNPALTQKLSNLVQAAPAMLFLKGTPSEPYCGYSRQIVKLL 196

Query: 104 AD-NYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKK-LQD 161
            D N RF     +++       D +   +K  +   T P L +NG+  GG D IK+ LQ+
Sbjct: 197 RDHNVRFG-YFNVLK------NDVVRKAMKNYSDWPTFPQLYLNGEFQGGLDIIKESLQE 249

Query: 162 D 162
           D
Sbjct: 250 D 250

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 85  VVLFSKTFCPYCKRLKKLLADNYRFSPDIK--IIELDKHPNGDELFSYIKQQTSHTTVPN 142
           +++F+K++CPY    ++ L ++ +  P  K  ++ELD   +G E+   +       TVP+
Sbjct: 48  IIVFAKSYCPYSIATRRTLFNDCKV-PQSKALVLELDLMQDGQEIQQALLAINGQKTVPH 106

Query: 143 LIVNGKSLGGFDSIKKL 159
           + + G+ +GG   ++++
Sbjct: 107 VYIAGEFIGGNHELQQI 123

>NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 34.7 bits (78), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 56/108 (51%), Gaps = 16/108 (14%)

Query: 62  VGGSSSGKFDPAQEYINIMEMAPVVLF-----SKTFCPYCKRLKKLLADN-YRFSPDIKI 115
           + G +  KFD  ++   +++ APV++F     S+  C Y +++ K+L +N  RF     I
Sbjct: 157 INGQNEEKFD--KKLSKLVQAAPVMVFLKGSPSEPKCGYSRQMVKILRENKIRFGF-FDI 213

Query: 116 IELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKK-LQDD 162
           +        D +   +K+ +   T P L +NG+  GG D +K+ L+DD
Sbjct: 214 LR------DDNVRKNMKRFSDWPTFPQLYINGEFQGGLDIVKETLEDD 255

>TBLA0H02890 Chr8 complement(697941..700624,700782..700782) [2685
           bp, 894 aa] {ON} 
          Length = 894

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 4/68 (5%)

Query: 125 DEL----FSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVS 180
           DEL    FS+  Q+ + +T  N    G SLGG  S     DDK    T  K +       
Sbjct: 514 DELPKSTFSFDTQKKADSTSTNATTTGFSLGGLGSTTSAADDKKSSSTTSKPAFSFTSTQ 573

Query: 181 SKDAAPKP 188
            KD  P P
Sbjct: 574 KKDTTPTP 581

>ZYRO0B07634g Chr2 complement(600410..600739) [330 bp, 109 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 109

 Score = 31.2 bits (69), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 77  INIMEMAPVVLFSKTFCPYCKR----LKKLLADNYRFSPDIKIIELDKHPNGDELFSYIK 132
           + +++   V+ FS ++CP C+      KKL  +N  +  DI        P+ ++  S  +
Sbjct: 10  LELLKSHKVLQFSASWCPDCRYANSVWKKLGIENKIYVFDIASF---PRPDQEQWRSAFQ 66

Query: 133 QQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK 171
           Q T    +P++  NG   G    +   +++  +   ++K
Sbjct: 67  QVTGSRNLPSIYYNGTLWGTESQLHAFENNGTLRDELRK 105

>Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii ADR053W
          Length = 139

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 8/95 (8%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH 137
           APVVLF K       C + +   ++L              + +HP   EL   IK+ +  
Sbjct: 40  APVVLFMKGTPEFPQCGFSRASIQILGQQGVDPSKFAAYNVLEHP---ELREGIKEYSEW 96

Query: 138 TTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKD 172
            T+P L +N + +GG D +  +     + + ++K+
Sbjct: 97  PTIPQLYINKEFIGGCDILTNMAQSGELAELLEKE 131

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 31.2 bits (69), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 126 ELFSYIKQQTSHTTVPNLIVNGKSLGGFDSI 156
           EL   IK+ T   T+P L VNG+ +GG D I
Sbjct: 83  ELRDGIKEYTDWPTIPQLFVNGEFIGGCDVI 113

>TBLA0F03860 Chr6 complement(955792..956541) [750 bp, 249 aa] {ON}
           Anc_8.240 YDR098C
          Length = 249

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 52/104 (50%), Gaps = 13/104 (12%)

Query: 74  QEYINIMEMAPVVLF-----SKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELF 128
           +  I + + APV+LF     S+  C + +++  +L ++        I++ D    G    
Sbjct: 149 ERLIKLTQAAPVMLFMKGNPSEPKCGFSRQMVGILREHQVRFGFFDILKDDSIRQG---- 204

Query: 129 SYIKQQTSHTTVPNLIVNGKSLGGFDSIKK-LQDD-KLVEQTIQ 170
             +K+ +   T P L +NG+  GG D IK+ L++D +  + T+Q
Sbjct: 205 --LKKYSDWPTFPQLYLNGEFQGGLDIIKESLEEDPEFFQNTLQ 246

>TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON}
           Anc_8.519 YPL059W
          Length = 149

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 17/104 (16%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLA----DNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           APVVLF K       C + +    LL     D  +F+    ++E  +  NG      IK+
Sbjct: 46  APVVLFMKGTPEFPQCGFSRATISLLGQQGVDPAKFA-AFNVLEDPELRNG------IKE 98

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSV 177
            T   T+P L VN + +GG D I  +     + + ++ D+D  V
Sbjct: 99  YTEWPTIPQLFVNKEFVGGCDIITNMSQSGELAKLLE-DADVLV 141

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 8/82 (9%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH 137
           APVVLF K       C + K   +LL              + + P   EL   IK+ T  
Sbjct: 43  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFAAYNVLEDP---ELRDAIKEFTEW 99

Query: 138 TTVPNLIVNGKSLGGFDSIKKL 159
            T+P L VN + +GG D I  +
Sbjct: 100 PTIPQLFVNKEFVGGCDVITSM 121

>Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 20/102 (19%)

Query: 79  IMEMAPVVLF-----SKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           +++ APV+LF     S+  C + ++L  +L ++      I+    D   + D +   +K+
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILREH-----QIRFGFFDILRD-DNVRQSLKK 205

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDF 175
            +   T P L +NG+  GG D IK         ++I++DS+F
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK---------ESIEEDSEF 238

>Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 bp,
           262 aa] {ON} YDR098C (REAL)
          Length = 262

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 20/102 (19%)

Query: 79  IMEMAPVVLF-----SKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           ++  APV+LF     S+  C + ++L  +L ++        I+        D +  ++K+
Sbjct: 169 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDIL------RDDSVRQHLKK 222

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDF 175
            +   T P L +NG+  GG D IK         +++++D DF
Sbjct: 223 FSEWPTFPQLYINGEFQGGLDIIK---------ESLEEDPDF 255

>KNAG0H03030 Chr8 complement(568120..568830) [711 bp, 236 aa] {ON}
           Anc_8.240 YDR098C
          Length = 236

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 131 IKQQTSHTTVPNLIVNGKSLGGFDSIKK-LQDD-KLVEQTIQKDS 173
           +K  +   T P L +NG+  GG D IK+ L+DD +  + TIQ+ S
Sbjct: 192 LKNFSDWPTFPQLYINGEFQGGLDIIKESLEDDPEYFQHTIQQQS 236

>Kpol_1046.13 s1046 complement(27947..28687) [741 bp, 246 aa] {ON}
           complement(27947..28687) [741 nt, 247 aa]
          Length = 246

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 20/102 (19%)

Query: 79  IMEMAPVVLF-----SKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           + + APV+LF     S+  C + +++  +L ++        I++ D    G      +K+
Sbjct: 153 LTQAAPVMLFMKGSPSEPKCGFSRQIVGILREHQVRFGFFDILKDDSVRQG------LKK 206

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDF 175
            +   T P L +NG+  GG D IK         +++++DS+F
Sbjct: 207 FSDWPTFPQLYINGEFQGGLDIIK---------ESLEEDSEF 239

>SAKL0H17710g Chr8 (1565867..1566592) [726 bp, 241 aa] {ON} similar
           to uniprot|Q03835 Saccharomyces cerevisiae YDR098C GRX3
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase monothiol
           glutaredoxin subfamily member along with Grx4p and Grx5p
           protects cells from oxidative damage
          Length = 241

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 12/91 (13%)

Query: 79  IMEMAPVVLFSKTF-----CPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           + + APV+LF K       C + +++  +L ++        I++ D    G      +K 
Sbjct: 147 LTQAAPVMLFMKGTPSEPKCGFSRQMVGILREHQVRFGFFDILKDDAVRQG------LKS 200

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKK-LQDDK 163
            +   T P L VNG+  GG D IK+ L++D+
Sbjct: 201 FSDWPTFPQLYVNGEFQGGLDIIKESLEEDQ 231

>NDAI0B02300 Chr2 complement(576792..577691) [900 bp, 299 aa] {ON}
           Anc_8.240
          Length = 299

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 15/100 (15%)

Query: 79  IMEMAPVVLF-----SKTFCPYCKRLKKLL-ADNYRFSPDIKIIELDKHPNGDELFSYIK 132
           +++ APV+LF     S+  C Y +++ K+L A+  RF     + + +   N       +K
Sbjct: 190 LVQAAPVMLFLKGTPSEPKCGYSRQMVKILRANKIRFGFFNVLSDNNVRIN-------MK 242

Query: 133 QQTSHTTVPNLIVNGKSLGGFDSIKK--LQDDKLVEQTIQ 170
           + +   T P L +NG+  GG D IK+  L D      T+Q
Sbjct: 243 KFSDWPTFPQLYINGEFQGGLDIIKETLLDDPDYFFHTLQ 282

>KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.519
           YPL059W
          Length = 149

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 8/82 (9%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH 137
           APVVLF K       C + K    LL              + + P   EL + IK+ +  
Sbjct: 42  APVVLFMKGTPEFPQCGFSKATINLLGKQGVDPAKFAAYNVLEDP---ELRTAIKEFSDW 98

Query: 138 TTVPNLIVNGKSLGGFDSIKKL 159
            T+P L VN + +GG D I  +
Sbjct: 99  PTIPQLYVNNEFVGGCDVITSM 120

>TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.240
           YDR098C
          Length = 249

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 22/99 (22%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLAD-NYRFSPDIKIIELDKHPNGDELFSYIKQQTS 136
           APV+LF K       C + ++L  +L +   RF     I++ D    G      +K+ + 
Sbjct: 160 APVMLFMKGNPTEPKCGFSRQLVGILREYQLRFGF-FDILKDDSVRQG------LKKFSD 212

Query: 137 HTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDF 175
             T P L +NG+  GG D IK+         ++++D+DF
Sbjct: 213 WPTFPQLYINGEFQGGLDIIKR---------SLEEDNDF 242

>NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519
          Length = 161

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 8/82 (9%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSH 137
           APVVLF K       C + K   +LL              + + P   EL   IK+ T  
Sbjct: 46  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFAAYNVLEDP---ELREAIKEFTEW 102

Query: 138 TTVPNLIVNGKSLGGFDSIKKL 159
            T+P L V  + +GG D I  +
Sbjct: 103 PTIPQLFVENEFVGGCDVITSM 124

>ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL059W (GRX5)
          Length = 138

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 16/100 (16%)

Query: 83  APVVLFSKTF-----CPYCKRLKKLLA----DNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           APVVLF K       C + K   ++L     D  +F+    ++E        EL S IK+
Sbjct: 39  APVVLFMKGTPEFPQCGFSKAAIEILGRQGVDPAKFAA-FNVLE------DSELRSGIKE 91

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDS 173
            +   T+P L VN + +GG D +  +     +   +++ S
Sbjct: 92  YSEWPTIPQLYVNKEFVGGCDILTNMAQSGELTTMLEEAS 131

>Skud_5.313 Chr5 complement(523537..524271) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 20/102 (19%)

Query: 79  IMEMAPVVLF-----SKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQ 133
           +++ APV+LF     S+  C + ++L  +L ++      I+    D   + D +   +K+
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILREH-----QIRFGFFDILRD-DNVRQSLKK 205

Query: 134 QTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDF 175
            +   T P L +NG+  GG D IK         ++I++D +F
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK---------ESIEEDPEF 238

>Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 77  INIMEMAPVVLF-----SKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFSYI 131
           + +++ APV+LF     S+  C + ++L  +L ++      I+    D   + D +   +
Sbjct: 150 VKLVQAAPVMLFMKGSPSEPKCGFSRQLVGILREH-----QIRFGFFDILRD-DNVRQSL 203

Query: 132 KQQTSHTTVPNLIVNGKSLGGFDSIKK 158
           K+ +   T P L +NG+  GG D IK+
Sbjct: 204 KKFSDWPTFPQLYINGEFQGGLDIIKE 230

>Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 bp,
           265 aa] {ON} YDR098C (REAL)
          Length = 265

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 15/100 (15%)

Query: 79  IMEMAPVVLF-----SKTFCPYCKRLKKLLADN-YRFSPDIKIIELDKHPNGDELFSYIK 132
           ++  APV+LF     S+  C + ++L  +L ++  RF     + +     N       +K
Sbjct: 172 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQN-------LK 224

Query: 133 QQTSHTTVPNLIVNGKSLGGFDSIKK-LQDD-KLVEQTIQ 170
           + +   T P L +NG+  GG D IK+ L+DD   ++ T+Q
Sbjct: 225 KFSEWPTFPQLYINGEFQGGLDIIKESLEDDPDFLQHTLQ 264

>YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}
           GRX4Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx3p and
           Grx5p; protects cells from oxidative damage; mutant has
           increased aneuploidy tolerance; transcription is
           regulated by Yap5
          Length = 244

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 13/88 (14%)

Query: 77  INIMEMAPVVLF-----SKTFCPYCKRLKKLLADN-YRFSPDIKIIELDKHPNGDELFSY 130
           + +++ APV+LF     S+  C + ++L  +L ++  RF       ++ +  N  +    
Sbjct: 150 VKLVQAAPVMLFMKGSPSEPKCGFSRQLVGILREHQIRFG----FFDILRDENVRQ---S 202

Query: 131 IKQQTSHTTVPNLIVNGKSLGGFDSIKK 158
           +K+ +   T P L +NG+  GG D IK+
Sbjct: 203 LKKFSDWPTFPQLYINGEFQGGLDIIKE 230

>KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]
           {ON} uniprot|O60042 Kluyveromyces lactis GSK-3 Protein
           kinase
          Length = 415

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%)

Query: 99  LKKLLADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKK 158
           +KK+L D    + +++I++L  HPN  +L  Y  +Q+      NLIV+   +  +  +K+
Sbjct: 115 IKKVLQDRRFKNRELEIMKLISHPNLIDLKYYFLEQSDQELYLNLIVDYMPMSLYQRLKE 174

Query: 159 L 159
            
Sbjct: 175 F 175

>NCAS0A05340 Chr1 complement(1055424..1058774) [3351 bp, 1116 aa]
           {ON} Anc_2.490 YKL092C
          Length = 1116

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 42/106 (39%), Gaps = 2/106 (1%)

Query: 61  IVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYC--KRLKKLLADNYRFSPDIKIIEL 118
           I+ G++       ++Y  I+      LF + FCP     +L   +AD+   +    +  +
Sbjct: 717 IMNGNTKNDASSDEQYQTILNCISSFLFLRFFCPVILNPKLFYFVADHLTENSRRTLTLI 776

Query: 119 DKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKL 164
            K        SY  QQ  H    N  ++      FD I K+ + KL
Sbjct: 777 SKILLKFSTLSYFGQQEPHLMKINEFISSNREKLFDYIDKVTEKKL 822

>NDAI0J01510 Chr10 (348743..349480) [738 bp, 245 aa] {ON} Anc_8.240
          Length = 245

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 139 TVPNLIVNGKSLGGFDSIKK-LQDD-KLVEQTIQ 170
           T P L +NG+  GG D IK+ L+DD    + TIQ
Sbjct: 211 TFPQLYINGEFQGGLDIIKESLEDDPDFFQHTIQ 244

>Skud_16.72 Chr16 (133328..135760) [2433 bp, 810 aa] {ON} YPL207W
           (REAL)
          Length = 810

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 146 NGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSKDAAPKPNKK 191
           NGK  G   S KK+ +D+ V+  +++  +F + V   D   KP KK
Sbjct: 109 NGKKGGCCSSKKKISNDENVDPVVEEAKNFPMTVDFTDVFKKPTKK 154

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,521,795
Number of extensions: 816843
Number of successful extensions: 2553
Number of sequences better than 10.0: 119
Number of HSP's gapped: 2545
Number of HSP's successfully gapped: 120
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)