Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0G036403.566ON39639621170.0
Kpol_380.73.566ON38538510081e-135
ZYRO0E09504g3.566ON3773889131e-120
KAFR0J028703.566ON3843848841e-116
Smik_7.183.566ON3853928811e-116
YGL243W (TAD1)3.566ON4004008731e-114
Skud_7.243.566ON3913918571e-112
KLTH0G00748g3.566ON3853878501e-111
TDEL0D063403.566ON4023928461e-110
NCAS0E002703.566ON3883848421e-110
KNAG0I002403.566ON3913868361e-109
NDAI0I032303.566ON3863888311e-108
Suva_7.183.566ON3853898241e-107
SAKL0F00836g3.566ON3833888241e-107
Kwal_47.192633.566ON3833878181e-106
TBLA0E002303.566ON3943928011e-103
Ecym_25963.566ON3873877941e-102
KLLA0A00759g3.566ON3803877831e-101
CAGL0H07733g3.566ON3853877498e-96
AFR267W3.566ON3853937402e-94
KAFR0J002403.550ON233113668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0G03640
         (396 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   820   0.0  
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   392   e-135
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   356   e-120
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   345   e-116
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   343   e-116
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   340   e-114
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   334   e-112
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   332   e-111
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   330   e-110
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   328   e-110
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   326   e-109
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   324   e-108
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   322   e-107
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   322   e-107
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   319   e-106
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   313   e-103
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   310   e-102
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   306   e-101
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   293   8e-96
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   289   2e-94
KAFR0J00240 Chr10 (40222..40923) [702 bp, 233 aa] {ON} Anc_3.550...    30   8.4  

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MADNASQISRISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNET 60
           MADNASQISRISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNET
Sbjct: 1   MADNASQISRISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNET 60

Query: 61  GEFETIAITTGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSK 120
           GEFETIAITTGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSK
Sbjct: 61  GEFETIAITTGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSK 120

Query: 121 FVQVTKTNSYEWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNK 180
           FVQVTKTNSYEWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNK
Sbjct: 121 FVQVTKTNSYEWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNK 180

Query: 181 TTIRGRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQ 240
           TTIRGRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQ
Sbjct: 181 TTIRGRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQ 240

Query: 241 YIIIPRISGKESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSI 300
           YIIIPRISGKESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSI
Sbjct: 241 YIIIPRISGKESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSI 300

Query: 301 KIFMDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNV 360
           KIFMDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNV
Sbjct: 301 KIFMDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNV 360

Query: 361 SYLEFKSTLTKRMTLQQEVRSLLSPDGWITTKKDDC 396
           SYLEFKSTLTKRMTLQQEVRSLLSPDGWITTKKDDC
Sbjct: 361 SYLEFKSTLTKRMTLQQEVRSLLSPDGWITTKKDDC 396

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  392 bits (1008), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 202/385 (52%), Positives = 269/385 (69%), Gaps = 10/385 (2%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75
           + +K+S  +  EYSKL+ SSKP  +SN+V EWTVLA I+AI+N+  E   I I+TGVKAT
Sbjct: 6   LGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIPITISTGVKAT 65

Query: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS-YEWNK 134
           P+ +L+RS GKI+HDCH+EIL+LR FN +LL ++ R+S  D  SKF+   K +  Y WN+
Sbjct: 66  PNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGD-KSKFILPAKADGKYNWNE 124

Query: 135 KWDLALYISKLPCGDASMDDLMKVGDTAE--FEITDDNPLQYIDPKNKTTIRGRLNYKKR 192
            + +ALYISKLPCGDASMD L +  +  E  F I D++  Q+IDPK KT IRGRLNY K+
Sbjct: 125 NYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGRLNYSKK 184

Query: 193 DVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGKES 252
           +V+RTKPGRYDS +TLSKSC+DKLCMKQ   IL+S    L ++PIFL Y+IIP +  +  
Sbjct: 185 NVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPTLKDELL 244

Query: 253 I-LKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVME 311
           + L   F +RLRG   P+    F++C   FIDD   T I  EPALV+SIKI +     +E
Sbjct: 245 LKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDK--TEIKTEPALVSSIKILLPREHQIE 302

Query: 312 QSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTLTK 371
           QSI+NGV+NG Y+K  KPL+KNC+  IS+YS+W L K +   + E L  SY+E+K + T 
Sbjct: 303 QSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTL---KEEQLAKSYIEYKKSQTL 359

Query: 372 RMTLQQEVRSLLSPDGWITTKKDDC 396
           R  L+  ++S LSPDGWI+T +DDC
Sbjct: 360 REDLKDIIKSKLSPDGWISTFQDDC 384

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  356 bits (913), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 251/388 (64%), Gaps = 14/388 (3%)

Query: 11  ISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITT 70
           + D  +  +++  V   Y KL  S KP  +SN V EWTVLAGI+AI+ +  +   I+I T
Sbjct: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT 60

Query: 71  GVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRI-SNHDGTSKFVQ-VTKTN 128
           GVKA PDA L RS GK++HDCHAEILALR FN  +LD I  + SN D     V+  ++  
Sbjct: 61  GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ 120

Query: 129 SYEWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLN 188
            + +   W+LA+YIS LPCGDASMD L +  D +  E+ DD+P+Q++DP   + +RGR N
Sbjct: 121 LFHFKDNWELAIYISTLPCGDASMDLLCQ--DESIIEMQDDDPIQFVDPAVTSIVRGRFN 178

Query: 189 YKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRIS 248
           Y +R V+RTKPGR+DS+ITL KSC+DKLC +QV+ IL+     L+  P++L+Y++ P  +
Sbjct: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT 238

Query: 249 GKESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNR 308
               +L  +F DR++    P    K + C   F  D H +    EP+ ++SIK++     
Sbjct: 239 ---DLLHQSFYDRIKV--LPNVPLKVLQCSYQFEHDKHSSE--EEPSAMSSIKLYSTPES 291

Query: 309 VMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKST 368
            +EQ+++NG+KNGFY+K  KPLR+NCEP +SRY++W L K +   R E  N +YL+FK+T
Sbjct: 292 TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTL---RPEFTNATYLQFKAT 348

Query: 369 LTKRMTLQQEVRSLLSPDGWITTKKDDC 396
           +  R  L Q+ R LLSP GWI+T +DDC
Sbjct: 349 IQDRNALIQDCRKLLSPKGWISTSRDDC 376

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 172/384 (44%), Positives = 249/384 (64%), Gaps = 8/384 (2%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGE--FETIAITTGVK 73
           + ++++  V+ EY +L+ SSKPV +SN   EWTVLA ++AIN    E   + IAI+TGVK
Sbjct: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64

Query: 74  ATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEWN 133
           A P+A LDRS G+I+HDCHAEILALR FN  LL  +  + N++ +S   +  +   + W 
Sbjct: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFRWK 124

Query: 134 KKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKKRD 193
            KW LALY+S+LPCGDASMD L    +  + E+++D+ LQYIDP     +RGR+N+K++ 
Sbjct: 125 SKWKLALYVSRLPCGDASMDHLEDASEL-DIEMSEDDRLQYIDPGKSKILRGRMNFKRKG 183

Query: 194 VIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGKE-S 252
            +RTKPGR DS ITLSKSC+DKLC+KQ+   L+S    LM+ P++L+Y++IP ++  +  
Sbjct: 184 AVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDTDKK 243

Query: 253 ILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVMEQ 312
            L   F  RL      +  F+F++ +  F DD   T+  + P+  + IK+F      +EQ
Sbjct: 244 ALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDK--TSDSQLPSATSFIKVFPSQEHTIEQ 301

Query: 313 SIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTLTKR 372
           +I+NGVKNGFY+K  KPLR+ CE I+SRYS+WNL K ++ +      +SYL+FK+   +R
Sbjct: 302 AILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVEN--GLSYLQFKAEQEQR 359

Query: 373 MTLQQEVRSLLSPDGWITTKKDDC 396
             L +  +  LS   WI T KDDC
Sbjct: 360 RDLVENAKICLSHGSWIATLKDDC 383

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  343 bits (881), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 261/392 (66%), Gaps = 17/392 (4%)

Query: 11  ISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAIN--NETGEFETIAI 68
           +S++ + +++S  V  EYSKL+P  +PV +   V EWTVLAGI+AIN  N+T   + +++
Sbjct: 2   LSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSM 61

Query: 69  TTGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTN 128
            TGVKA PD++L RS GKI+HDCHAEILALR  N  LL+ I   +  +G S F+Q     
Sbjct: 62  ATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANG-SDFIQSNDET 120

Query: 129 S--YEWNKKWDLALYISKLPCGDASMDDLM-KVGDTAEF-EITDDNPLQYIDPKNKTTIR 184
              ++    W+LALYISKLPCGDAS+D L     +  +F +I DD+  QY++   KT +R
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 185 GRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIII 244
           G LN+ +++V+RTKPGRYDS ITLSKSC+DKL MK++  IL++    L   P+FL+Y++I
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 245 PRISGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIF 303
           P +  + + +LK +F DRL   N    E  F+SC   F DD      V  P+L+ SIK+F
Sbjct: 241 PGLENEVKHVLKQSFHDRLPNAN---HETIFMSCNTSFYDDKAGEEDV--PSLMCSIKLF 295

Query: 304 MDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYL 363
           M N+   E++I+NGVKNGFY+K  KPLRK+C+ ++SR+++W L KQI   R E   +SYL
Sbjct: 296 M-NDHTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQI---RPEYEGMSYL 351

Query: 364 EFKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395
           +FKS+  +R  L   ++ +LSPDGWI TK DD
Sbjct: 352 QFKSSQKRRTRLIIAIKDILSPDGWIPTKIDD 383

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  340 bits (873), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/400 (47%), Positives = 263/400 (65%), Gaps = 36/400 (9%)

Query: 12  SDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG--EFETIAIT 69
           S++ + E++S  V  EYSKL+ + +P+I+ + + EWT+LAG+ AIN + G  + E ++I 
Sbjct: 19  SEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIA 78

Query: 70  TGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTS--KFVQVTKT 127
           TGVKA PD++L RS+GKI+HDCHAEILALR  N  LL   NRI N++ +S  KF+Q    
Sbjct: 79  TGVKALPDSELQRSEGKILHDCHAEILALRGANTVLL---NRIQNYNPSSGDKFIQHNDE 135

Query: 128 NSYEWNKK--WDLALYISKLPCGDASM---------DDLMKVGDTAEFEITDDNPLQYID 176
               +N K  W+LALYIS+LPCGDASM         DD +K+ D+ EF        QY+D
Sbjct: 136 IPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEF--------QYVD 187

Query: 177 PKNKTTIRGRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDP 236
              KT +RGRLN+ +R+V+RTKPGRYDS ITLSKSC+DKL MKQ   +L+     L + P
Sbjct: 188 RSVKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKP 247

Query: 237 IFLQYIIIPRISGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPA 295
           +FL+YI+IP +  + +  L+ +F  RL   +    E KF++C   F DD  D   V  P 
Sbjct: 248 VFLKYIVIPNLEDETKHHLEQSFHTRLPNLD---NEIKFLNCLKPFYDDKLDEEDV--PG 302

Query: 296 LVNSIKIFMDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRA 355
           L+ S+K+FMD+    E++I+NGV+NGFY+K  KPLRK+C+  +SR+++W L K+I   R 
Sbjct: 303 LMCSVKLFMDDFST-EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKI---RP 358

Query: 356 ELLNVSYLEFKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395
           E   +SYLEFKS   KR  L   ++++LSPDGWI T+ DD
Sbjct: 359 EYEGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDD 398

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  334 bits (857), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 183/391 (46%), Positives = 253/391 (64%), Gaps = 17/391 (4%)

Query: 12  SDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG--EFETIAIT 69
           S N +AE++S  V GEYSKL+   KP  +   + EWT+LAG++ IN   G    E +++ 
Sbjct: 9   SKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVA 68

Query: 70  TGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS 129
           TGVKA PD++L RS GK++HDCHAEILALR  N  LL  I      +G S F++      
Sbjct: 69  TGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANG-SDFIESNNEIP 127

Query: 130 YEWNKK--WDLALYISKLPCGDASMDDLMKVGDTAE--FEITDDNPLQYIDPKNKTTIRG 185
             +N K  W+LALYIS+LPCGDASMD L       E   +I D++  QY+DPK KT +RG
Sbjct: 128 IRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRG 187

Query: 186 RLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIP 245
           RLN+ K+ V+RTKPGRYDS ITLSKSC+DKL MKQ+  IL+S    L + P++L+YI+IP
Sbjct: 188 RLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIP 247

Query: 246 RISGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFM 304
            I  K + IL+ +F +RL      V+   F++C   F DD  D   +  P+ + SIK+F+
Sbjct: 248 DIEDKTKHILERSFHNRLPCDGHKVE---FLNCHTPFYDDRTDENDI--PSSMCSIKLFV 302

Query: 305 DNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLE 364
            N+   E++I NG+KNGFY+K  KPLRK+C+  +SR+++W L +QI   R +  ++SYL 
Sbjct: 303 -NDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQI---RPKHKSMSYLH 358

Query: 365 FKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395
           FKS   +R  L    ++ LSPDGWI+T+ DD
Sbjct: 359 FKSQQKERNRLITTAKNALSPDGWISTRIDD 389

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 245/387 (63%), Gaps = 15/387 (3%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75
           +A+K++      Y KL+PS+KP ++SN   EW VLA ++AIN    +   +++ TGVKA 
Sbjct: 7   VADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANEDLRLVSLATGVKAA 66

Query: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRI--SNHDGTSKFVQVTKTNS--YE 131
           P+ DL RS G+I+HDCHAEILALR FN  LL  I  +  S        V  +  NS  Y 
Sbjct: 67  PNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSDNSGIYR 126

Query: 132 WNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKK 191
            N++W  ALYIS+ PCGDASM  L    D      TDD+  QY+D  NKT IRGR NY K
Sbjct: 127 LNEEWSFALYISRAPCGDASMGLLY---DEGCISFTDDDRCQYVDDNNKTIIRGRFNYAK 183

Query: 192 RDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISG-K 250
           +  +RTKPGR DSK+TLSKSCTDKLC KQV+ IL+S    L++ P+FL+YI+IP++    
Sbjct: 184 KGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVIPQLPRVA 243

Query: 251 ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKI-FMDNNRV 309
           E+  + AF  R++  + P+++ + +SC   F DD   T   + P+L++SI +  ++    
Sbjct: 244 EADFERAFDTRIK-DSVPMEKVQILSCSQRFDDDK--TYENQPPSLMSSILLNIIEGQVT 300

Query: 310 MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTL 369
            +QSI+NGVK G + KP  PL+KNCE ++SR S+W+L KQI   +  + + +Y EFKS  
Sbjct: 301 QQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQI---KGGVDSQTYREFKSQQ 357

Query: 370 TKRMTLQQEVRSLLSPDGWITTKKDDC 396
           T R  L++ +R  LS DGW+ T+ DDC
Sbjct: 358 TDRNALKERIRLALSKDGWVGTESDDC 384

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  330 bits (846), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 174/392 (44%), Positives = 253/392 (64%), Gaps = 18/392 (4%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNET--GEFETIAITTGVK 73
           + ++++     EY KL  + KPVI+SN   EWTVL+GI+AI++ +   +   ++I TGVK
Sbjct: 10  LGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTGVK 69

Query: 74  ATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTIN-RISNHDGTSKFVQVTKTNSYEW 132
           A PDA L+RS G+++HDCHAEILALR FN  LL+ +N  ++   G +  ++ T       
Sbjct: 70  ALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTTAGVCIL 129

Query: 133 NKKWDLALYISKLPCGDASMDDLMKVGDT-----AEFEITDDNPLQYIDPKNKTTIRGRL 187
             KW LALYIS LPCGDASM DL    +T      E    ++  +Q+ID K ++ +RGR 
Sbjct: 130 KSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILRGRF 189

Query: 188 NYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRI 247
           NY +  V+RTKPGRYDS+IT SKSC+DKLC+KQV  IL+S    LM  P+FL Y++IP +
Sbjct: 190 NYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVIPNL 249

Query: 248 S-GKESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMD- 305
           +  +   + H+F DRL  G  P +  + + C   F D+   ++   EP+ ++S+K+F+D 
Sbjct: 250 AVDRCQGVHHSFQDRL--GRLPQKSLELLECNVPFFDNK--SSKSEEPSSMSSVKLFLDL 305

Query: 306 -NNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLE 364
              +  EQ+I+NG+KNGFY+K  KPLRKNCE  +SR ++W +   I   R +    +YLE
Sbjct: 306 PERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNI---RPDAKQQTYLE 362

Query: 365 FKSTLTKRMTLQQEVRSLLSPDGWITTKKDDC 396
           FK+ L++R  + QEV+ +LSPDGWI+T+ DDC
Sbjct: 363 FKAGLSERNRIIQEVKKVLSPDGWISTRNDDC 394

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/384 (43%), Positives = 250/384 (65%), Gaps = 9/384 (2%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75
           + ++V+  V  EY+KL+PSSKPV++SN V EWTVLA  + +++ TG  + I+++TGVKA 
Sbjct: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKAL 66

Query: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS-YEWNK 134
           PD +L RS GK+IHDCHAEILALR FN  LL  I+ ++ +   S  ++++  N  Y    
Sbjct: 67  PDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHLRA 126

Query: 135 KWDLALYISKLPCGDASM--DDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKKR 192
           KW L LYIS+LPCGDASM          ++   I D +  QYIDP   T +RGRLN+ + 
Sbjct: 127 KWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGRLNFSRN 186

Query: 193 DVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRIS-GKE 251
            V+RTKPGR DS  TLSKSC+DKLC++QV  IL+     L+  P+F+ Y++IP+++   +
Sbjct: 187 GVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYDNK 246

Query: 252 SILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVME 311
           + L  +F +RL+      +  K+++    F +D +   I  EP+ ++SIK+F+     +E
Sbjct: 247 NDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKN--FITEEPSSMSSIKLFLTQGETIE 304

Query: 312 QSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTLTK 371
           ++++NGVKNG Y+K  KPLRKNCE I+SRY++W++ K+I  N +     SYLEFK + T 
Sbjct: 305 EALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSA---TSYLEFKRSQTA 361

Query: 372 RMTLQQEVRSLLSPDGWITTKKDD 395
           R+ L +    +LS +GW+ T+ DD
Sbjct: 362 RLELIKYTNEILSSEGWLPTQPDD 385

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 162/386 (41%), Positives = 241/386 (62%), Gaps = 9/386 (2%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG-EFETIAITTGVKA 74
           +  +++  V+ EY +L  SSKP ++SN   EWT+L+G++A+    G +   I++TTGVKA
Sbjct: 5   LGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTGVKA 64

Query: 75  TPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQ-VTKTNSYEWN 133
           TP+ DL+RSQG+++HDCHAEILALR FN  LL  +    N+D     +  +  TN +  N
Sbjct: 65  TPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKFRLN 124

Query: 134 KKWDLALYISKLPCGDASMDDLMKVGDTAE--FEITDDNPLQYIDPKNKTTIRGRLNYKK 191
            ++ LAL+IS+LPCGD SM+ L + G   +    I DD+P+QYIDP N++ +RGR NY K
Sbjct: 125 PEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFNYAK 184

Query: 192 RDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGKE 251
           +  +RTKPGR DSKIT SKSC+DKLC  Q   IL++    L+++ +++ Y+I+P IS  +
Sbjct: 185 KGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNISASD 244

Query: 252 -SILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVM 310
            + L+  F  RL    FPV + + +SC   F DD  D     +P+ ++ +K+++     +
Sbjct: 245 RNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDED--EQPSSISCVKLYITEGETL 302

Query: 311 EQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTLT 370
           EQ++++G++NGF++K  KPLR NCE  +SR S+W L   +    A     SY +FKS L 
Sbjct: 303 EQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLN-PEASNKYTSYRDFKSKLV 361

Query: 371 KRMTLQQEVRSLLS-PDGWITTKKDD 395
            R  L    RSLL+    WI T  DD
Sbjct: 362 PRAELITRTRSLLTNGQPWIPTCSDD 387

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  324 bits (831), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 166/388 (42%), Positives = 250/388 (64%), Gaps = 11/388 (2%)

Query: 13  DNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGV 72
           ++ +A++++  +  +Y  L+ SSKPV +SN + EWTV AGI+AIN +T +   I++ TGV
Sbjct: 4   EHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGV 63

Query: 73  KATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEW 132
           KA P+ +L+RS GK++HD HAEI+ALR FN  +L  I ++ N + T   +    +  Y +
Sbjct: 64  KALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSF 123

Query: 133 NKKWDLALYISKLPCGDASMDDLMKVGDTA--EFEITDDNPLQYIDPKNKTTIRGRLNYK 190
                +ALYIS+LPCGD SM  ++K  D A  E  I D++ +QYI+  NKT +RGRLN+ 
Sbjct: 124 KSNLKIALYISQLPCGDISM-RMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFN 182

Query: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISG- 249
           K+  +RTKPGR DS++T SKSC+DKLCMKQ   IL+     L++ P++L Y+I+P ++  
Sbjct: 183 KKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTE 242

Query: 250 -KESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNR 308
            KE I    F  +         E  ++S    F D  +  T  +EP+ + +IK+F+    
Sbjct: 243 MKEDI-DLCFNKQFERCVGTRHEVCYLSTSKEFKDTRN--TSDQEPSAIGAIKVFIGQGN 299

Query: 309 VMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKST 368
            +EQ+I+NGVKNG Y+K  KPLRKNCE ++SR+S+W + K+IE   +++   SYL+FK +
Sbjct: 300 SIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQM---SYLDFKQS 356

Query: 369 LTKRMTLQQEVRSLLSPDGWITTKKDDC 396
             +R  L    RS +SPDGWI+T++DDC
Sbjct: 357 QHERRKLIDYTRSKMSPDGWISTQEDDC 384

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/389 (47%), Positives = 251/389 (64%), Gaps = 21/389 (5%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG--EFETIAITTGVK 73
           +AE++S  V GEYSKL+   +PV + + + EWT+LAG+ AIN        + ++I TGVK
Sbjct: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66

Query: 74  ATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS---- 129
           + PD++L RS+GK++HDCHAEILALR  N   L   N I + D T+    +   N     
Sbjct: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFL---NHIKDWDLTNGDDLIESNNEIPPK 123

Query: 130 YEWNKKWDLALYISKLPCGDASMDDLMK--VGDTAEFEITDDNPLQYIDPKNKTTIRGRL 187
           +    KW+LALYISKLPCGDASMD L      D    EI DD+  QY+DP  KT +RGRL
Sbjct: 124 FRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILRGRL 183

Query: 188 NYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRI 247
           N+ K+ V+RTKPGRYDS ITLSKSC+DKL M+Q   IL+S  S L   P+FL+YI+IP +
Sbjct: 184 NFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVIPNL 243

Query: 248 SGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDN 306
             K    L+ +F +RL    F    F+F++C   F DD  D   V  P+L+ S K+FM N
Sbjct: 244 DEKTRHTLEQSFHNRL---PFCSHRFEFLNCHTPFYDDKKDENSV--PSLMCSTKLFM-N 297

Query: 307 NRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFK 366
           +  +E++I+NG+KNGFY+KP KPLRK+CE  +SR+++W L  QI   + E  + SYL+FK
Sbjct: 298 DSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQI---KPEYKDTSYLQFK 354

Query: 367 STLTKRMTLQQEVRSLLSPDGWITTKKDD 395
           +  T+R  L   ++  LSPDGWI TK DD
Sbjct: 355 AQQTERNQLITLIKGALSPDGWIPTKTDD 383

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 173/388 (44%), Positives = 241/388 (62%), Gaps = 12/388 (3%)

Query: 13  DNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGV 72
           + ++ +  S  ++  Y++L+P  KP ++SN + EWTVLAGIIAIN        +++ TGV
Sbjct: 4   EEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNTMRLVSLGTGV 63

Query: 73  KATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISN--HDGTSKFVQVTKTNSY 130
           KATP+ +L RS+GKI+HDCHAEILALR FN  LL  ++ ++   H+      +     S+
Sbjct: 64  KATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDGLSF 123

Query: 131 EWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYK 190
           +    W  ALYISKLPCGD+SMD L +  D   F I + +  QY++  N T +RGR NY+
Sbjct: 124 KVPDHWSFALYISKLPCGDSSMDTLEE-EDLNSFNIENTDACQYLEQNNHTLLRGRFNYQ 182

Query: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGK 250
           K+  +RTKPGR DSKITLSKSC+DKL ++QV  +L+S    L   PI+L+YIIIP +   
Sbjct: 183 KKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIPNLDEH 242

Query: 251 ESILKHAFIDRLRGGNFP-VQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNN-R 308
             +      +RL   N P     +F+S    F DD    T  ++P+ ++SI + + NN  
Sbjct: 243 ALVGLERSFERL--CNHPSFNALRFLSGSQTFCDDK--ITQDQQPSSMSSISLNVHNNGE 298

Query: 309 VMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKST 368
             +++I+NGVKNGFY K KKPLRKNCE I+SR S+W L   I  N     + +YL+FKST
Sbjct: 299 EFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTE---HETYLQFKST 355

Query: 369 LTKRMTLQQEVRSLLSPDGWITTKKDDC 396
             +R  L+ E +  LSPDGWI T  DDC
Sbjct: 356 QVERNILKNEAKLCLSPDGWIPTGVDDC 383

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  319 bits (818), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 244/387 (63%), Gaps = 19/387 (4%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75
           +A+K+S      Y KL+PS+KPVI+SN V EW VLA +IAI  + G    +++ TGVK+T
Sbjct: 7   LADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQG-LRLVSLATGVKST 65

Query: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTN----SYE 131
           P+ +L RS G+I+HDCHAEILALR FN+ LL  I  + +         V+ ++     ++
Sbjct: 66  PNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDGKFK 125

Query: 132 WNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKK 191
               W  ALYIS++PCGDASMD L    D    E ++D   QY++P N+T +RGR NY K
Sbjct: 126 LGDDWSFALYISRIPCGDASMDLLQSESD---MEFSEDTSCQYVNPCNRTILRGRFNYNK 182

Query: 192 RDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISG-K 250
           R  +RTKPGR DS +TLSKSC+DKLC +QVM IL++    LM+ PIFL+YI++P++S   
Sbjct: 183 RGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVSNTA 242

Query: 251 ESILKHAFIDRLRGGNFP-VQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRV 309
               + AF DRLR   FP ++  + + C   F DD  +   V  P+ V+ I +  ++ + 
Sbjct: 243 RRGFESAFKDRLR--EFPGIKSVELLECPKQFPDDKFELNQV--PSSVSGILLNTNDGQP 298

Query: 310 MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQI-EFNRAELLNVSYLEFKST 368
            +QSI+NGVK+G Y +  KPLRKNCE +ISR ++W L K++ +++  +    SY  FK  
Sbjct: 299 EQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKK----SYQAFKGE 354

Query: 369 LTKRMTLQQEVRSLLSPDGWITTKKDD 395
              R  L+ +VRS LS DGWI+T  DD
Sbjct: 355 QVARNVLKNKVRSSLSSDGWISTGPDD 381

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  313 bits (801), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 165/392 (42%), Positives = 244/392 (62%), Gaps = 17/392 (4%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINN-ETGEFETIAITTGVKA 74
           + +K++A +  EY+KL+ S+KP+ KSN + EWT+++GI+A++N +T   + I++ TGVKA
Sbjct: 6   LGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLATGVKA 65

Query: 75  TPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTS----KFVQVTKTNSY 130
           TPD++L RSQG I+HDCHAEILA+R FN  LL  I      D  S      V+ +K   Y
Sbjct: 66  TPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKKY 125

Query: 131 EWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYK 190
            WN ++DL LYISKLPCGD+SM++   +   +  +  +++  QY+DP  +T +RGR+NY 
Sbjct: 126 SWNDEYDLGLYISKLPCGDSSMEEENSLESNSLIQFQENDLTQYVDPTIRTILRGRINYN 185

Query: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGK 250
           K   +RTKPGR DS+IT SKSC+DK+C+KQV+ +L+S  + L++ PI+++Y++ P I  +
Sbjct: 186 KSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPDIKPQ 245

Query: 251 ESILKHAFIDRLR------GGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFM 304
             IL     +R+         ++      FI     F D    T  ++EP+  + +KIF 
Sbjct: 246 NLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGK--TNDLQEPSFTSVVKIFN 303

Query: 305 DNNRV-MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYL 363
            N++  +EQSI+NGVK G Y+K  KPL KN   I+SR  +WN+ K I     E    SYL
Sbjct: 304 SNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNI---MPEFEQYSYL 360

Query: 364 EFKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395
            FK   T R+  +  +R  LS DGWI+T  DD
Sbjct: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  310 bits (794), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 243/387 (62%), Gaps = 14/387 (3%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75
           +AE VS  V  +Y  L+ S+KP IKSN + EWTVLAGI+AI+  T E   I++ TGVKA 
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67

Query: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRI-SNHDGTSKFVQ-VTKTNSYEWN 133
           P+ +L+RS G+++HD HAEILALR FN+ LL  +  + +N   T   V+    T+ Y   
Sbjct: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127

Query: 134 KKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKKRD 193
           K+W +ALYIS+ PCGD SM D++   DT   + + D+  QYI+P  +TT+RGR NY  + 
Sbjct: 128 KRWKIALYISRPPCGDCSM-DILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKG 186

Query: 194 VIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIP---RISGK 250
           V RTKPGR DSKITLSKSC+DKL  KQV+ IL+ST   L++ P+FL Y+++P   R    
Sbjct: 187 VTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKAS 246

Query: 251 ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRV- 309
           +  L++ F  RL G N  V   + I C   F  D  + +  + P  ++ + I +    + 
Sbjct: 247 DGCLRN-FHYRLLGLN-EVHSIEMIFCSKKFNGDKEEES--QTPCPISGVYINIKPMEMD 302

Query: 310 MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTL 369
           +E+ I+NGV NGFY K  +PLRKNCE I+SR S W L  Q+ +    + + SYL+FKS  
Sbjct: 303 IEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGY---YVNSNSYLDFKSKQ 359

Query: 370 TKRMTLQQEVRSLLSPDGWITTKKDDC 396
           T R  L+++VR  LS DGWI T  DDC
Sbjct: 360 TSRNQLKEQVRLHLSSDGWIPTSADDC 386

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  306 bits (783), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 242/387 (62%), Gaps = 17/387 (4%)

Query: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75
           IA++++A+V   Y KL  S KP I+SN V EWTVL+GI+A +     +E I++ TGVKAT
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEPISLGTGVKAT 63

Query: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEWNKK 135
           P+ +L RS G+I+HDCHAE++ LR FN  LL  I  + N  G   F+     + Y+    
Sbjct: 64  PNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQN--GQKSFLIEKSADGYKVKDV 121

Query: 136 WDLALYISKLPCGDASMDDLMKVGDTAEFEITDD--NPL---QYIDPKNKTTIRGRLNYK 190
           W  A+YIS++PCGDASM +L++  D +E E      N     QY+ P+  T IRGR NYK
Sbjct: 122 WKFAMYISRIPCGDASM-NLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGRANYK 180

Query: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGK 250
            R V+RTKPGR DSKITLSKSC+DKL MKQ++ I ++    L++ P++L++I++P+    
Sbjct: 181 LRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPKQYQY 240

Query: 251 ESI-LKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRV 309
           E + L+  F  RL+   F    FKF+ C   F  D   T + ++P+L + + ++  N  V
Sbjct: 241 EQVQLEDTFWLRLKNQQF--LPFKFLFCNETFSADR--TNLSQQPSLSSCVSLYGSNEAV 296

Query: 310 MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTL 369
            E  I+NGVKNGFY K KKPLRK C+ IISR ++W+  K+I   +A   +  Y  FKS++
Sbjct: 297 SE-VILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKI---KAMPSDTDYYGFKSSV 352

Query: 370 TKRMTLQQEVRSLLSPDGWITTKKDDC 396
             R  +  + ++ LS  GWI+T +D+C
Sbjct: 353 VDRNHIISKAKATLSASGWISTCRDNC 379

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  293 bits (749), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 235/387 (60%), Gaps = 12/387 (3%)

Query: 13  DNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGV 72
           D+Y   K++  V  EY KL    +PV +SN   E T++A +IA +  T +   + ITTGV
Sbjct: 5   DDY-GTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGV 63

Query: 73  KATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEW 132
           K+TP+ +L RS+GKI+HDCHAEILALR FN  LL+ I R  + +G    +     N +EW
Sbjct: 64  KSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKR--SMEGIESNLIHNTPNGFEW 121

Query: 133 NKKWDLALYISKLPCGDASMDDL--MKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYK 190
           N + +L L+ISKLPCG+ SM  L  MK  D       +D+  QYI P+ KT +RGR N+ 
Sbjct: 122 NNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFN 181

Query: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGK 250
           KR+ +RTKPGR DSK T SKSC+DKL ++    +L+S  S +M  P+++   +IP I+  
Sbjct: 182 KRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSH 241

Query: 251 ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVM 310
           +    + + +R    +   +     +    F DD    T    P+ ++++KI  ++N + 
Sbjct: 242 QIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPET---PPSSMSALKILFNDNDIQ 298

Query: 311 EQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTL- 369
           E+ I+NGVKNG+Y+K  KPLRKNCE  +SRYS W+L   I  +R E  +++YLEFK    
Sbjct: 299 EEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLF--ITMHR-EFKDLTYLEFKRRYC 355

Query: 370 TKRMTLQQEVRSLLSPDGWITTKKDDC 396
            +R  L + ++S LS DGW++T +DDC
Sbjct: 356 AERAELIRSIKSSLSSDGWLSTAEDDC 382

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  289 bits (740), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 156/393 (39%), Positives = 224/393 (56%), Gaps = 22/393 (5%)

Query: 11  ISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITT 70
           + D+ +AE + A V  +Y   +PSSKP  +SN   EWTVLAG++ ++ +T E   ++  T
Sbjct: 1   MDDDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAECRLVSAAT 60

Query: 71  GVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSK---FVQVTKT 127
           GVKA PD +L+RS G+++HD HAEILALR FN  LL     ++  DG S     V+  KT
Sbjct: 61  GVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVT--DGRSAECDLVEQAKT 118

Query: 128 -NSYEWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGR 186
            + +    +W  ALYISK PCGD SMD         E   + D+P+QY+   N T +RGR
Sbjct: 119 QDRFRLASRWQAALYISKAPCGDCSMDMADDD--ADEMTFSPDDPIQYVAEHNYTMLRGR 176

Query: 187 LNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPR 246
            NY ++ V RTKPGR DS+ITLSKSC+DKL  K VM +L S    L ++P+FL Y+++P 
Sbjct: 177 FNYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPH 236

Query: 247 ISGKESILKHAFIDR---LRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIF 303
                   +  F +R   L G + P    + + C   F  D       + PAL  S+ + 
Sbjct: 237 TIATAG-FERCFAERLAGLEGTHMP----RLLCCHTAFPGDR--AAPQQPPALTASVYLN 289

Query: 304 MDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYL 363
           +   + +EQ+++NGV+NG Y +P + L  + E I+SR + W +  Q+     +   +SY 
Sbjct: 290 ITAKKHVEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH----QAPPLSYA 345

Query: 364 EFKSTLTKRMTLQQEVRSLLSPDGWITTKKDDC 396
            FK     R  L++ VR  LSPDGW TT+ DDC
Sbjct: 346 AFKRQQHARNRLKRHVRHRLSPDGWPTTRVDDC 378

>KAFR0J00240 Chr10 (40222..40923) [702 bp, 233 aa] {ON} Anc_3.550
           YFR043C
          Length = 233

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 12/113 (10%)

Query: 27  EYSKLRPSSKPVIKSNSVPEWTVLAGIIAINN-----ETGEFETIAITTGVKATPDADLD 81
           +Y  L    K ++   S P   VLAG+I I++       G+F+ I+     K   D+ L 
Sbjct: 63  QYDTLSEWIKELLSEESTPLLEVLAGVIVIDDADITEHKGKFDQIS----TKIHDDSFLL 118

Query: 82  RS-QGKIIHDCHAEIL--ALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYE 131
           R    + I D   E+L   L   ++  L T+N      G  +  ++  T++++
Sbjct: 119 RCINSEKIQDSQDEVLNDVLETVHLGSLGTVNEFGEKLGIERIKEILDTHAWD 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,842,399
Number of extensions: 1963142
Number of successful extensions: 5539
Number of sequences better than 10.0: 28
Number of HSP's gapped: 5612
Number of HSP's successfully gapped: 28
Length of query: 396
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 284
Effective length of database: 40,638,807
Effective search space: 11541421188
Effective search space used: 11541421188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)