Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0G036303.564ON1022102248770.0
Kpol_380.63.564ON1002100923470.0
NDAI0B062603.564ON1013104221800.0
NCAS0F039503.564ON1012102221680.0
TDEL0D063203.564ON1018102021030.0
KAFR0J001903.564ON1012103019730.0
Suva_7.203.564ON1008102419710.0
YGL241W (KAP114)3.564ON1004103019690.0
ZYRO0E09460g3.564ON1009102619640.0
Skud_7.263.564ON1015102919640.0
Smik_7.203.564ON1004102619580.0
CAGL0H07777g3.564ON1021102819560.0
TBLA0E002403.564ON1010102919340.0
SAKL0F00880g3.564ON1009102518400.0
KNAG0D029403.564ON1009102218080.0
Kwal_47.192583.564ON1011102417170.0
Ecym_25943.564ON1019101916880.0
KLTH0G00792g3.564ON1021103416770.0
AFR269W3.564ON1017103316050.0
KLLA0A00803g3.564ON9528987051e-77
KAFR0H027008.624ON10411381010.003
NDAI0E021708.624ON1029139910.048
NCAS0C014308.624ON1029135850.22
Ecym_83098.624ON102799850.22
KNAG0J014208.624ON1053135850.23
TDEL0A057008.624ON1031141830.47
SAKL0G07458g5.402ON372555830.48
AGL349C5.11ON1092131820.50
Ecym_56635.11ON1092131810.78
Kwal_26.85958.624ON1034138800.86
NDAI0A015407.408ON111483781.4
SAKL0H07876g8.624ON1032124781.4
Kpol_530.128.624ON103081781.7
KAFR0H032902.289ON24553761.8
Smik_7.223.561ON960149762.4
CAGL0M13871g5.11ON1091138762.6
Smik_6.3248.624ON1032110762.7
KLTH0C02728g1.504ON21437742.8
TBLA0J004708.624ON1036130753.2
Suva_7.223.561ON96093753.3
CAGL0J06776g8.624ON102783753.4
SAKL0F00968g3.561ON961122753.6
TPHA0F031608.624ON103187753.6
KLTH0D10010g8.624ON103488753.8
YGL238W (CSE1)3.561ON960149753.9
KNAG0I002603.561ON95493744.1
KLTH0H06182g6.133ON570119744.5
Ecym_25903.561ON955127744.7
Skud_16.1558.624ON103288745.2
Skud_7.283.561ON96093736.1
TBLA0C070905.11ON1147138727.3
Kwal_47.192473.561ON959137727.9
ACR159C8.624ON102578727.9
Suva_16.1858.624ON103288728.2
Kpol_534.376.133ON55687719.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0G03630
         (1022 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...  1883   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   908   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   844   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   839   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   814   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   764   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...   763   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...   763   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   761   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...   761   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...   758   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   758   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   749   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   713   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   701   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   665   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   654   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   650   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   622   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   276   1e-77
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    44   0.003
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    40   0.048
NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {...    37   0.22 
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    37   0.22 
KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa] ...    37   0.23 
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    37   0.47 
SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa]...    37   0.48 
AGL349C Chr7 complement(53004..56282) [3279 bp, 1092 aa] {ON} Sy...    36   0.50 
Ecym_5663 Chr5 (1341597..1344875) [3279 bp, 1092 aa] {ON} simila...    36   0.78 
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    35   0.86 
NDAI0A01540 Chr1 (344002..347346) [3345 bp, 1114 aa] {ON} Anc_7....    35   1.4  
SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highl...    35   1.4  
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    35   1.7  
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...    34   1.8  
Smik_7.22 Chr7 (44367..47249) [2883 bp, 960 aa] {ON} YGL238W (REAL)    34   2.4  
CAGL0M13871g Chr13 complement(1370295..1373570) [3276 bp, 1091 a...    34   2.6  
Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {O...    34   2.7  
KLTH0C02728g Chr3 complement(246560..247204) [645 bp, 214 aa] {O...    33   2.8  
TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.6...    33   3.2  
Suva_7.22 Chr7 (44148..47030) [2883 bp, 960 aa] {ON} YGL238W (REAL)    33   3.3  
CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} high...    33   3.4  
SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly s...    33   3.6  
TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {...    33   3.6  
KLTH0D10010g Chr4 complement(830376..833480) [3105 bp, 1034 aa] ...    33   3.8  
YGL238W Chr7 (49552..52434) [2883 bp, 960 aa] {ON}  CSE1Nuclear ...    33   3.9  
KNAG0I00260 Chr9 (32967..35831) [2865 bp, 954 aa] {ON} Anc_3.561...    33   4.1  
KLTH0H06182g Chr8 complement(542052..543392,543465..543836) [171...    33   4.5  
Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {O...    33   4.7  
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    33   5.2  
Skud_7.28 Chr7 (53753..56635) [2883 bp, 960 aa] {ON} YGL238W (REAL)    33   6.1  
TBLA0C07090 Chr3 complement(1716766..1720209) [3444 bp, 1147 aa]...    32   7.3  
Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]...    32   7.9  
ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON} ...    32   7.9  
Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL12...    32   8.2  
Kpol_534.37 s534 complement(93615..94979,95183..95488) [1671 bp,...    32   9.5  

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score = 1883 bits (4877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 951/1022 (93%), Positives = 951/1022 (93%)

Query: 1    MPDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCIL 60
            MPDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCIL
Sbjct: 1    MPDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCIL 60

Query: 61   SLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQIS 120
            SLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQIS
Sbjct: 61   SLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQIS 120

Query: 121  AIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAI 180
            AIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVIS            TIKTIFAI
Sbjct: 121  AIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAI 180

Query: 181  FTSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXV 240
            FTSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQC                V
Sbjct: 181  FTSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLLDILLTILPHLDV 240

Query: 241  NQSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDA 300
            NQSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDA
Sbjct: 241  NQSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDA 300

Query: 301  SGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTF 360
            SGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTF
Sbjct: 301  SGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTF 360

Query: 361  ISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTL 420
            ISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTL
Sbjct: 361  ISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTL 420

Query: 421  QXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAV 480
            Q            LLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAV
Sbjct: 421  QSIISSEEEFNSELLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAV 480

Query: 481  KPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKII 540
            KPMTKE              EILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKII
Sbjct: 481  KPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKII 540

Query: 541  KDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVES 600
            KDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVES
Sbjct: 541  KDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVES 600

Query: 601  QECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKP 660
            QECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKP
Sbjct: 601  QECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKP 660

Query: 661  VDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVL 720
            VDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVL
Sbjct: 661  VDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVL 720

Query: 721  SKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLM 780
            SKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLM
Sbjct: 721  SKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLM 780

Query: 781  VFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSK 840
            VFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSK
Sbjct: 781  VFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSK 840

Query: 841  IYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS 900
            IYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS
Sbjct: 841  IYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS 900

Query: 901  KNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDELA 960
            KNISDANLHSIDIQKLARAEENQVEQK                 YEKLQEYVDDDDDELA
Sbjct: 901  KNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDDDDELA 960

Query: 961  NYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLANA 1020
            NYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLANA
Sbjct: 961  NYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLANA 1020

Query: 1021 LV 1022
            LV
Sbjct: 1021 LV 1022

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1009 (47%), Positives = 675/1009 (66%), Gaps = 8/1009 (0%)

Query: 1    MPDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCIL 60
            M D+H LI  AQS DN+VRE AESELL  CDE+A +VF+S+I++ +N  E LSSR F +L
Sbjct: 1    MQDIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALL 60

Query: 61   SLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQIS 120
            +L+KLITMYWSPGF+SYR  S + EE K   RDSLLK+CL+  QD+KIK++S+YC+VQIS
Sbjct: 61   TLRKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQIS 120

Query: 121  AIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAI 180
            A+DFPD WP LL  +Y AI++ HS+ A+SLLNEIYDDV+S            TI+ IF++
Sbjct: 121  AVDFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSV 180

Query: 181  FTSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXV 240
             T   T I AK+A+SKL HS +LQMS+LD     KRK  V++C                V
Sbjct: 181  LTDNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLLQKQNV 240

Query: 241  NQSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDA 300
             +     +L++  YE+L  IK+EFP+KLF    +  F+ + + DL I    Y   + S+ 
Sbjct: 241  TEMSSEFELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNVLSSEN 300

Query: 301  SGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTF 360
            S +++  INE+ +H+I+F++++S   F   D+  I  S V L C+D NT ESW +DFN+F
Sbjct: 301  SDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADFNSF 360

Query: 361  ISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTL 420
            ISKE GL A++TIRDQ   F S++ +  YS  Y +IL E N+ + + ++W+ QES+LY L
Sbjct: 361  ISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVLYLL 420

Query: 421  QXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAV 480
            Q            L   T+ ++ ++G ++ +P +   V  R +L  PK LEKFME+   V
Sbjct: 421  QCIATSETEINESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFMETLPDV 480

Query: 481  KPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKII 540
            K  TK+              E+++SS LIAF+YY S+A+L+SVLG   C   Q+ +LK+I
Sbjct: 481  KEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKVLKLI 540

Query: 541  KDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVES 600
            ++++ND+EEDT  + VE ++NVID NS     + + + EF+ LL IS KDP NIQL VE+
Sbjct: 541  QNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLDETILEVEFDFLLTISVKDPSNIQLIVEA 600

Query: 601  QECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKP 660
            QECLEKL++ MDI+LY  YA K++P LI +I +   T Y YSPLLSL L+F+   M+ +P
Sbjct: 601  QECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINILMRNRP 660

Query: 661  VDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVL 720
             D +LP  I + +F+P+  +L+ S E+ET+QLATEAFSFL+FNS   ++   LE I+NVL
Sbjct: 661  DDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLEEIINVL 720

Query: 721  SKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLM 780
            S+LLS++ISDTAAMNVG+L++TIF+KFS+Q+QEL+P IL+ATT KF+NAKNI TSQNL+ 
Sbjct: 721  SRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNISTSQNLVS 780

Query: 781  VFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSK 840
            VFC L+C+DP +T+DFLYNL +     +++L LVL KWLE F+IIRGEK+IKENI+ALSK
Sbjct: 781  VFCLLVCTDPARTIDFLYNLEI-GTPPQSSLPLVLTKWLESFEIIRGEKKIKENILALSK 839

Query: 841  IYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS 900
            IY L D R+  + VNGDIIPY+GD IITRSMAKS+PD++T++ +Y+KIVKLF+ EL  Q+
Sbjct: 840  IYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAELGFQT 899

Query: 901  KNISDANLHSIDI-QKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDEL 959
            K    ++L    + Q+L   +  Q+                    YEKLQEY+  DDD+ 
Sbjct: 900  KEQDPSDLVDSKLKQELGIPQ--QMGAAHGDDDDDDWEDVDDVLDYEKLQEYI--DDDDE 955

Query: 960  ANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSS 1008
              Y    ++   TG  I ++ Q+  EL+I FFKE  SK+INSFQ+IY++
Sbjct: 956  EEYVGGPESQEITG--IEEVTQTTKELLIEFFKEAASKDINSFQEIYNT 1002

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1042 (43%), Positives = 664/1042 (63%), Gaps = 52/1042 (4%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D++ LI  AQS+DN VR+ AES+LLQ CD NA+ +F SL++ A + N  ++SRQF +LSL
Sbjct: 2    DINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLSL 61

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYWSPGF+SYR TS + ++TKE++R+SLL +CL+  QDSKI  S++YC+VQISA+
Sbjct: 62   RKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISAV 121

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LLV++Y+ I + HS+ AMSLLNEIYDDV+S            T++ IF + +
Sbjct: 122  DFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVLS 181

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
            + E  I+AK+AA+KL ++ +LQMS+LD S S KRK    +C                ++ 
Sbjct: 182  NNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEYYTIDT 241

Query: 243  SEDA------LQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSY---- 292
            + D+      L+L++  YE +  IK E PK+LF  +L+ +FK  +LKDL    + Y    
Sbjct: 242  TVDSKMLTSILELRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYETYC 301

Query: 293  ---LQFIDSDASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNT 349
               ++ ++SD     L   +E  +H++DF+++     FD  +++ IV  L +LCCLDN++
Sbjct: 302  LNNIEVVNSDNLHDAL---SECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDNDS 358

Query: 350  YESWESDFNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSM-ENYN 408
             E   +DFN F+SKE GLL +YTIRDQ  +F + L  P Y+     I+     +M +   
Sbjct: 359  QEELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPSR 418

Query: 409  NWKLQESLLYTLQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSS--------NIMVKS 460
            N ++ ES+LY LQ            L+   ++V N    +L++P S        N  + S
Sbjct: 419  NDRILESILYLLQS-----------LMTNEDDVTNINPNILLEPLSSLFDYETENPFLHS 467

Query: 461  RCLLLCPKYLEKFMESYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADL 520
            R +LL PK LEKFM+    VK +TK+               + K S LI ++YYA +A+L
Sbjct: 468  RLILLIPKILEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAEL 527

Query: 521  SSVLGSADCISIQQGLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEF 580
             SVLG   C  +Q+ +L +I  + +++EEDT+ + VE +++VID N        + + EF
Sbjct: 528  PSVLGRDVCTQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIAVQGILETEF 587

Query: 581  NILLEISFKDPGNIQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYD 640
             ++L IS KDP NIQ+++ S+ECLEKLL+G++   Y +Y +  +P  I +I  H+ T Y 
Sbjct: 588  YMVLSISSKDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYK 647

Query: 641  YSPLLSLTLDFLMTFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFL 700
            YSPLLSL L+F+  FMKKKP D  LP  I + +F P+  VL  S E+ET+QLAT+AFS+L
Sbjct: 648  YSPLLSLILEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYL 707

Query: 701  VFNSDVSLMQTVLENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQ 760
            ++N+D +LM   LE IV VL +LLS+N+SDTAAMNVGTLI+TIFSKFS ++Q L+P IL+
Sbjct: 708  LYNTDSTLMIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILR 767

Query: 761  ATTQKFVNAKNIITSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLE 820
            A   K V AKNI T QNL+ + CFL C+DP QT++FLY L     +  +T   V+ KW E
Sbjct: 768  AAVTKLVQAKNISTQQNLISLLCFLTCTDPLQTIEFLYGL----DETHSTFAAVMNKWFE 823

Query: 821  LFDIIRGEKRIKENIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFT 880
             F++IRGEK+IKENI+ALSK+Y   D R+  ++VNGD+IPY GD IITRSMAK++PD++T
Sbjct: 824  AFEVIRGEKKIKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYT 883

Query: 881  QMPIYEKIVKLFLGELASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXX 940
            Q+P Y KI+KLF+ EL+ Q++   +  + + D++ + + EE   +               
Sbjct: 884  QIPAYTKIIKLFVSELSFQTQQTGEPTVLNADLKGIEKEEEEVGDDD-------EWEDVD 936

Query: 941  XXXXYEKLQEYVDDDDDELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNIN 1000
                Y+KL+EYVDD+D   A +  D D D  TG  + D+ ++V+EL++ FFKEVTSK+ N
Sbjct: 937  DVLDYDKLKEYVDDEDP--AEFGED-DKDEITG--LADVKETVTELLLEFFKEVTSKDTN 991

Query: 1001 SFQDIYSSLSEDEKKLLANALV 1022
            +F  IY++LS++ KK+L+  L+
Sbjct: 992  NFHAIYNTLSDNGKKILSENLL 1013

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1022 (44%), Positives = 645/1022 (63%), Gaps = 13/1022 (1%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D++ LI  AQS+D   RE AE++L   CD+NAS +F SL+ +A +   PLS+RQF +L++
Sbjct: 2    DIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLTI 61

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +K ITMYWSPGF SYR TS +QE TKE++R+SLL+LCL+  QD+KIK+S+SYCIVQISA+
Sbjct: 62   RKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISAV 121

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL  IY AI ++HS+ A+SLLNEIYDDVIS            T++ IF + T
Sbjct: 122  DFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLLT 181

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
            +   N+KAK+A +KL ++ +LQMS++D+S    RK+FV +C                V+ 
Sbjct: 182  NNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLELYPVSN 241

Query: 243  SEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFID--SDA 300
                L L+T  YE +  I  EF +KLF  +    +K  S +DLE   + +  F++  S A
Sbjct: 242  DSLILNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACSNQFNAFLENLSQA 301

Query: 301  SGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTF 360
                L+ +NE  +H++DF++S+S   F   ++  IV SL  LCCLD++T E W  DFN F
Sbjct: 302  DNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQWSEDFNDF 361

Query: 361  ISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTL 420
            +SKE GLLA++TIRDQ  +F S L  P YS  +  I  ++  S+    N  L+ESLLY L
Sbjct: 362  VSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLRESLLYLL 421

Query: 421  QXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAV 480
            Q            +      +L     +  +      + SR +LL PK LEKFM+    V
Sbjct: 422  QTLLTNEEDNDHDINIEPSVILKQFSSVFENGLQKTFLLSRIILLTPKLLEKFMDQLQDV 481

Query: 481  KPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKII 540
            K +T                EI+KSS +IAF+YY+ +A+L SVLG   C  +Q+  LKII
Sbjct: 482  KQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELCSIVQENTLKII 541

Query: 541  KDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVES 600
             +++ +AEEDT  + +ET++ +I  N     S E+   EFN++L IS KDP N+Q++VE+
Sbjct: 542  SELSKEAEEDTNGLLMETLNQIISCNVHENLSPEILQTEFNLVLSISSKDPANVQVTVEA 601

Query: 601  QECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKP 660
            Q+CLE LL+GM+   Y++Y +  +P  I  I   A   Y Y+P+LSL L+FL  FMKKKP
Sbjct: 602  QDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLILEFLTIFMKKKP 661

Query: 661  VDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVL 720
            VD  LP  IS   F  +C +L  S E+ET+QLAT+AFS++V+N++ S M   L++I+NVL
Sbjct: 662  VDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSAMVPKLQDIINVL 721

Query: 721  SKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLM 780
             +LLS+N+SDTAAMNVGTL++T+FSKFS +IQ L+P IL+A   + + A+NI T QNL+ 
Sbjct: 722  DRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQAQNISTQQNLVS 781

Query: 781  VFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSK 840
            + CFL CSDP+Q +D LYN       + +T T V+ KW E F+ IRGEK+IKENI+ALSK
Sbjct: 782  LLCFLTCSDPKQVIDLLYNFD----SDHSTFTKVMNKWFESFETIRGEKKIKENIVALSK 837

Query: 841  IYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS 900
            +Y   D+R+  +IVNGD+IPY GD IITRSMAK +PD++TQ+P + KIVKLF  EL  Q+
Sbjct: 838  LYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKLFTTELGFQN 897

Query: 901  KNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDELA 960
            K      L   DI+ +  +     E+                  YEKL+E+VDD+D   A
Sbjct: 898  KQPDSKILLESDIKNVDTSNNKTSEEA--AGDDDEWEDVDDVLDYEKLREFVDDEDP--A 953

Query: 961  NYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLANA 1020
            ++  + D+D  TG  +  + +++ EL++ FFK+V ++++N F +IY++LSE+EK++L   
Sbjct: 954  DF-GENDSDEITG--LDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILTEN 1010

Query: 1021 LV 1022
            LV
Sbjct: 1011 LV 1012

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1020 (43%), Positives = 633/1020 (62%), Gaps = 9/1020 (0%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D   LI  AQSAD+ VR +AE++LL+  D +AS+VF S +++A++  E LSSRQF ++SL
Sbjct: 8    DSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSL 67

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYWSPGF+SYR  SN++EE KE +RD LLKLCLN ++ SK+ S+++YC+VQISA+
Sbjct: 68   RKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAV 127

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL V+Y+ IL  HS+ AMSLL EIYDDV+S            TI+ +F I  
Sbjct: 128  DFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVR 187

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
             P TN++AK+A   L H+ + Q+  +D + + KRK+   +C                + +
Sbjct: 188  DPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQSHSITE 247

Query: 243  SEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASG 302
                LQ+K   YE+L+ +K E  KKL  ++L   FK + L DLE  G  YL        G
Sbjct: 248  HSLQLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQGFVEG 307

Query: 303  SQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFIS 362
             +L  +NE  +H+I+F+++      D  ++ RI+++L  LCCLDN+T   W  DFN++IS
Sbjct: 308  YRLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDFNSYIS 367

Query: 363  KEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQX 422
             E+GL A+Y++RDQ  +  + ++   YS+    IL +++   E    WK QES L+ +Q 
Sbjct: 368  MESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWKQEWKFQESFLFLVQA 427

Query: 423  XXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAVKP 482
                        +     VL+ LG +L        V SR +LL PK LEK+M+    V+ 
Sbjct: 428  AALNESLPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDLLDDVRI 487

Query: 483  MTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKIIKD 542
            +T                +I+K+S+LIAF+Y +++A+LSSVLG   C   Q+ +L +I  
Sbjct: 488  LTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRVLGLIAR 547

Query: 543  IANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVESQE 602
            I+ DAE+DT  + +E ++NVID N+ G  ++E+   EF+++L+IS KDP NIQ+ VESQE
Sbjct: 548  ISEDAEDDTDGVLMEVLNNVIDCNTPGVPNNEIVQTEFSLVLKISAKDPANIQIVVESQE 607

Query: 603  CLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPVD 662
            CLEKLL+ +DI  Y  Y E  +P  +K I   A T Y YSPLLSL L FL TF+ KKP D
Sbjct: 608  CLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLTTFL-KKPTD 666

Query: 663  STLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVLSK 722
              LP  +  L F P+ ++LL+S ++ETIQLATEAFS+ ++N+D +++   LE IV +L +
Sbjct: 667  YQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHLEAIVAILDR 726

Query: 723  LLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLMVF 782
            LLS ++SD AAM VG+LI+T+F++FS +I+ ++P IL+A   + + AK++ TSQNLL VF
Sbjct: 727  LLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLSTSQNLLSVF 786

Query: 783  CFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSKIY 842
            CFL   DP+QTVDFL+ L L D  E N L  ++  WLE F+ IRGE+R KEN+IAL K+Y
Sbjct: 787  CFLTSVDPRQTVDFLFGLHL-DNTEHNALYSIVSIWLESFESIRGERRTKENVIALIKLY 845

Query: 843  LLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQSKN 902
            LL DKR+  + VN +IIPY G++IITRSMAK +PD+++Q+ +Y KI+KLF+ EL  Q K 
Sbjct: 846  LLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVAELNFQDKQ 905

Query: 903  ISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDELANY 962
                   + D+ K    E N                      YEKLQEYVD+ D +    
Sbjct: 906  PDPERFITSDMAK----EGNNGNSDNDTDSDGEWEDVEDVLNYEKLQEYVDESDQDGEGS 961

Query: 963  TSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLANALV 1022
             SD   D     I    N SV +++++FFKEV + N   F+DIY+SL+E EKK+L+  LV
Sbjct: 962  DSD---DFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILSENLV 1018

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1030 (42%), Positives = 647/1030 (62%), Gaps = 31/1030 (3%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D+  LI+ AQS DN++RE+AE +LLQ CD NAS++F +L ++A N +  L++RQF +LSL
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLIT YWSPGF+SYR TS +  +TK  LR+ L++L L+  QDSKIKSS+SYC+ QISA+
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL ++Y  I + +S+ A+ LLNEIYDD++S            T+  ++ +  
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 183  SPE-TNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVN 241
            S +  +I+A++A   LL++T+ QM+ +D++++ KRK  +S+                  +
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMSHRD 243

Query: 242  QSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301
             S D+L      YE L  IK E PKK F       +K I+L  L ++ + Y     ++ +
Sbjct: 244  ISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNKYASM--TEPA 301

Query: 302  GSQLQLINEYGVHLIDFISSLSVQ-GFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTF 360
             ++L+  +E  +H ++F++SLS    F + + T I++SL++LC LD  T E+W +DFN F
Sbjct: 302  ETELESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLADFNHF 361

Query: 361  ISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILE---ELNKSMENYNNWKLQESLL 417
            +SKE GLL +YTIRDQ+ +F + L    + +    I +    L  S     +    E+  
Sbjct: 362  VSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVDPSQLETTF 421

Query: 418  YTLQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESY 477
            Y LQ                  +VL  L  LL +   ++MV SR +L  PK LEKFM+  
Sbjct: 422  YLLQSILSNDDDIENVNNEEITSVLRVLPSLLTNVHDSLMV-SRIILALPKILEKFMDDL 480

Query: 478  TAVKPMTKEXXXXXXXXXXXXXXE-ILKSSMLIAFSYYASYADLSSVLGSADCISIQQGL 536
              VK M +               + I+KSS+LI+F+ Y  +A+L SVLG   C SIQ+ +
Sbjct: 481  PDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLGPELCASIQKSI 540

Query: 537  LKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQL 596
            L ++K ++N++E+DT  +  E ++N+I+ NS+ T S E+   EF++L  IS KDP N+Q+
Sbjct: 541  LTLMKQVSNESEDDTNGLLTEVLNNIIECNSTNT-SQEILQTEFSLLFSISSKDPSNVQI 599

Query: 597  SVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFM 656
             VESQE LEKLL  +   +Y+ Y +  +P  I II  +++T+Y YSPLLSL L+F+  FM
Sbjct: 600  VVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSPLLSLVLEFITIFM 659

Query: 657  KKKPVDST-LPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLEN 715
            KKKP DS  LP  I   +F P+ ++L +S E+ET+QL T+AF+++++N+D   +   LE 
Sbjct: 660  KKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIYNTDSEKVMPYLET 719

Query: 716  IVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITS 775
            +VN+L +LLSL+++DTAAMNVGTLI+TIF+KFS QI  L+P IL A   + ++ KNI T 
Sbjct: 720  VVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAAVNRLIDCKNISTQ 779

Query: 776  QNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENI 835
            QNL+ + CFL  S+ Q+TVDFL+NL      ++N +  VL KW E F+IIRGEK+IKENI
Sbjct: 780  QNLVSLLCFLFYSNTQETVDFLFNLP-----QQNIVRDVLIKWFESFEIIRGEKKIKENI 834

Query: 836  IALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGE 895
            IAL K+Y L D+++  + VNGDIIPY GD IITRS AKS+PD++TQ+ I+EKI+KLF+ E
Sbjct: 835  IALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIFEKIIKLFIAE 894

Query: 896  LASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDD 955
            L  Q+K  +  NL + +   L  + EN  E +                 Y+KL+EYV+D+
Sbjct: 895  LGFQNKQPAIENLMTNETTALGDSNENDDEWE----------DVDDVLDYDKLKEYVNDE 944

Query: 956  DD---ELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSED 1012
            D+   E +    + D +  TG  +GD++Q+V+ELII FFK+VTSKN+N+FQ IY +LSE+
Sbjct: 945  DELDGEDSREYGEGDEEEITG--LGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDTLSEN 1002

Query: 1013 EKKLLANALV 1022
            EK +L   LV
Sbjct: 1003 EKMILTQYLV 1012

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1024 (41%), Positives = 637/1024 (62%), Gaps = 21/1024 (2%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D+  LI  AQSADN+ RE AE++LLQ CD +AS VF SL  +A +    L SRQF +LSL
Sbjct: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYWSPGF+SYR TSNV    KE +R++LL LCLN  +++KIK+ +SYCIVQISA+
Sbjct: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISAV 121

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL VIY+AI + HSI AMSLLNEIYDDV+S            T++ IF + T
Sbjct: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
            +  +N+ AK+AA KL  + + QMS  D      R +F++QC                VN 
Sbjct: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCLSTSLQTLGQLLTLDLVN- 240

Query: 243  SEDAL---QLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSD 299
             ED     + ++  YE L  IK  F KK F       FK +++KDL+ I S  +    ++
Sbjct: 241  -EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTE 299

Query: 300  ASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359
               S L+ +    V++++F++++    F   ++  I+ SL  LC +D++T + W  DFN 
Sbjct: 300  NEDS-LETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNY 358

Query: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419
            F+SKE GL A+Y +RDQ  +FF+ L  P  S+ + I+ +++ ++  N+    L+  L   
Sbjct: 359  FVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQT--LESLLYLL 416

Query: 420  LQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTA 479
                          ++  +++++ +L   L+    N +  +R +L+ PK L+KF++    
Sbjct: 417  QCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPD 476

Query: 480  VKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKI 539
            +K +T                E+++S++LIAF+YY  +A+L SVLG   C  +QQ +++I
Sbjct: 477  IKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVQQNIIQI 536

Query: 540  IKDIANDAEEDTYAICVETISNVIDNNSSGTG-SDEVRDNEFNILLEISFKDPGNIQLSV 598
            I +I++DAEEDT    +E ++ VI  N+ G   S+EV   EF+++  IS KDP N+Q+ V
Sbjct: 537  INEISDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVV 596

Query: 599  ESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKK 658
            +SQECLEKLLD + +  Y+ Y E  +P  I ++  +   NY Y+PLLSL L+F+  F+KK
Sbjct: 597  QSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKK 656

Query: 659  KPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVN 718
            KP    LP EI + +F P+ +VL  S E+ET+QLATEAFS+L+FN+D  +M+  L +I+ 
Sbjct: 657  KPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMK 716

Query: 719  VLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNL 778
            VL +LLSL +SD+AAMNVG+L++TIF++FS +IQ L+  ILQA   + V A+NI T QNL
Sbjct: 717  VLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNL 776

Query: 779  LMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIAL 838
              V CFL C+DP+QTVDFL +  +++    + L+LV+ KW+E F+++RGE+RIKENIIAL
Sbjct: 777  FSVLCFLTCNDPKQTVDFLCSFQIDNM---DALSLVMPKWMESFEVVRGERRIKENIIAL 833

Query: 839  SKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELAS 898
             K++LL D R+  ++VNGD+IPY GD IITRSMAK +PD++ Q+P+Y KI+KLF+ EL  
Sbjct: 834  IKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGF 893

Query: 899  QSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDE 958
            Q+K  +   L + DI   A+   N                      YEKL++Y+ DD D 
Sbjct: 894  QNKQPNPEQLITTDI---AKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYIGDDVDG 950

Query: 959  LANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLA 1018
                 S++     TG  + D+ +SV ++++ FFKEV SK+++ F  IY SLSE+E+K+L+
Sbjct: 951  GEEDDSED----ITG--LMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLS 1004

Query: 1019 NALV 1022
             AL+
Sbjct: 1005 EALL 1008

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1030 (42%), Positives = 646/1030 (62%), Gaps = 37/1030 (3%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D++ LI  AQSAD + RE AE++LLQ CD +AS VF +L  +A      L SRQF +LSL
Sbjct: 2    DINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLSL 61

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYWSPGF+SYR TSNV+ + K+F+R+ LLKLCLN  +++KIK+ +SYCIVQISA+
Sbjct: 62   RKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISAV 121

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL VIY+AI   HS+ AMSLLNEIYDDV+S            T++ +F +  
Sbjct: 122  DFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVLN 181

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
            +  + + AK+AA KLL + +LQMS  +      RK FVSQC                 N 
Sbjct: 182  TETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGNV 241

Query: 243  SE-DALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301
                 L+ K+  YE L  IK +F +K F + L   FK ++++DLE +       +++  S
Sbjct: 242  DVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINAN-VETTES 300

Query: 302  GSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFI 361
               L+ +++  +++++F++S+    F   ++ +I++SL +LC L + T E W SDFNTF+
Sbjct: 301  EPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFV 360

Query: 362  SKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQ 421
            SKE GL A+Y +RDQ  +FF+ L  P  S+ + ++  ++  S  NY       S L +L 
Sbjct: 361  SKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNY-------STLESLL 413

Query: 422  XXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVK--------SRCLLLCPKYLEKF 473
                        + G  EN+  SL ++L+    NI+V         +R +L  P+ L+KF
Sbjct: 414  YLLQCILLNDDEITG--ENIDQSL-QILIKTLENILVSQEIPELILARAILTIPRVLDKF 470

Query: 474  MESYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQ 533
            +++   +KP+T                E++KS+ LIAF+YY  +A+L SVLG   C   Q
Sbjct: 471  IDALPDIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQ 530

Query: 534  QGLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGS-DEVRDNEFNILLEISFKDPG 592
            + +++II  +++DAEEDT    +E +S VI  N     S  E+   EF+++  IS +DP 
Sbjct: 531  EKVIRIINQVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPA 590

Query: 593  NIQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFL 652
            N+Q+ V+SQECLEKLLD +++  Y  Y E  +P  I ++  + + NY YSPLLSL L+F+
Sbjct: 591  NVQVVVQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFI 650

Query: 653  MTFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTV 712
              F+KKKP D  LP EI++ +F P+ +VL  S E+ET+QLATEAFS+L+FN+D   M+  
Sbjct: 651  TVFLKKKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPR 710

Query: 713  LENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNI 772
            L +I+ VL +LLSL +SD+AAMNVG L++ IF++FS++IQ L+  IL+A   + +  +NI
Sbjct: 711  LMDIMKVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNI 770

Query: 773  ITSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIK 832
             T QNLL V CFL C+DP+QTVDFL +  +++    + LTLV++KW+E F++IRGEKRIK
Sbjct: 771  STEQNLLSVLCFLTCNDPKQTVDFLSSFQIDNT---DALTLVMRKWIEAFEVIRGEKRIK 827

Query: 833  ENIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLF 892
            ENI+ALS ++ L DKR++ V+VNG++IPY GD IITRSMAK +PD++ Q+P+Y KI+KLF
Sbjct: 828  ENIVALSNLFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLF 887

Query: 893  LGELASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYV 952
            + EL+ QSK  +   L + DI++       +V                    Y+KL+EY+
Sbjct: 888  VSELSFQSKQPNPEQLITSDIKQ-------EVVNANKDDDNDDWEDVDDVLDYDKLKEYI 940

Query: 953  DDDDDELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSED 1012
                D+  +  +D+D+D  TG  + D+ +SV +L++ FFKEV SK+++ F  IY +LS+ 
Sbjct: 941  ----DDDVDEEADDDSDDITG--LMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDS 994

Query: 1013 EKKLLANALV 1022
            E+K+L+ AL+
Sbjct: 995  ERKVLSEALL 1004

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1026 (41%), Positives = 623/1026 (60%), Gaps = 21/1026 (2%)

Query: 1    MPDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCIL 60
            M D   LI  AQS  +NVR+++E  LLQ CDE++S VF   +++A +  + L SRQF +L
Sbjct: 1    MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALL 60

Query: 61   SLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQIS 120
            +L+KL+TMYW+PGF+S+RGTS V+ E +  +RD LL+LCL+  Q SKI++ +SY +VQIS
Sbjct: 61   TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS 120

Query: 121  AIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAI 180
            A+DFPD WP LL ++YNAI+K HS+ AM LLNEIYDDVIS            T+K +F +
Sbjct: 121  AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHV 180

Query: 181  FTSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDF-VSQCXXXXXXXXXXXXXXXX 239
              S + N +AKVAA  LLH  +LQMS ++ S + KRK+  V  C                
Sbjct: 181  MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK 240

Query: 240  VNQSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSD 299
                   L      Y+ LT +K EF KK+    +   F+ I ++DLE     Y+Q ++ +
Sbjct: 241  TISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVE-N 299

Query: 300  ASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359
            +S  QL  INEY V++++F+SSL    F + +L  ++  L  LCCL+ +T +SW++DFN+
Sbjct: 300  SSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNS 359

Query: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419
            F+SKE GL+A++TIRDQ  +  S  +   Y+    +++ E+++  +  + W   ESLLY 
Sbjct: 360  FVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYL 419

Query: 420  LQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTA 479
            LQ            +   T  +   L  +L    S + V  R +LL PK LEK M+S+  
Sbjct: 420  LQSLLLNEANSLEFMDAVTR-IFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPN 478

Query: 480  VKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKI 539
            V+ + +               E++KS+ LI+F+YY+ +A+L SVLG  +CI +QQ  LK+
Sbjct: 479  VRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKL 538

Query: 540  IKDIANDAEEDTYAICVETISNVIDNNSSGT-GSDEVRDNEFNILLEISFKDPGNIQLSV 598
            I  +  +AE+DT  + +E + NVID NS     +  +   EF+++  IS KDP NIQ ++
Sbjct: 539  IAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTI 598

Query: 599  ESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKK 658
            E QECL KLL  +D+  +I + E   P ++ ++   A ++++YSPLLSLTL  L   MK+
Sbjct: 599  ELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKR 658

Query: 659  KPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVN 718
            KP+D TL + I   VF P+  +L  S +EE +Q ATEA  +L++N++  ++   L++IVN
Sbjct: 659  KPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVN 718

Query: 719  VLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNL 778
            +L  LLS  + D AA +VG+L +TIFSKFS +IQ L+P ILQA   +   A NI T+QNL
Sbjct: 719  ILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNL 778

Query: 779  LMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIAL 838
            L VFCF+  +D QQTVDFL+N ++ +Q   N L LV+ KWLE FD++RGEKR KENII L
Sbjct: 779  LSVFCFVTSADAQQTVDFLFNTTISNQ---NGLNLVMSKWLESFDVVRGEKRTKENIITL 835

Query: 839  SKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELAS 898
            SK++ L D+R+  + VNGD+IPY  D IITRSMAK +PD++TQ+ +Y KI+KLF  EL  
Sbjct: 836  SKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEF 895

Query: 899  QSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDE 958
            Q K+  D  L    +       E   E+                  YE+LQ YV++D+  
Sbjct: 896  QGKH-QDPQL----LMAGTYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDE-- 948

Query: 959  LANYTSDEDNDTPTGQIIGD--INQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKL 1016
                 +D+  +    Q + D   ++SV +L+++FFKEV +KNI+ FQ IY  LS++EK++
Sbjct: 949  -----TDDRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQI 1003

Query: 1017 LANALV 1022
            L+  L+
Sbjct: 1004 LSENLL 1009

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1029 (42%), Positives = 646/1029 (62%), Gaps = 34/1029 (3%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D++ LI  AQSADN+ RE AE++LLQ CD +AS +F +L+  A      L SRQF +LSL
Sbjct: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALLSL 71

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYWSPGF+SYR TSNV  + KEF+R++LLKLCLN  ++++IK+ +SYCIVQISA+
Sbjct: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL VIY+ I + HS+ AM LLNEIYDDV+S            T + IF +  
Sbjct: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLV 191

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
            +  +++ AK+AA KLL + +LQMS  +      RKDFVSQC                 N+
Sbjct: 192  AETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNE 251

Query: 243  SE-DALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301
                 L+LK+  YE L  IK +F KK F   L  +FK ++++DL+ I       ID++  
Sbjct: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNIS-----LIDTNDD 306

Query: 302  GSQ------LQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWES 355
            G        ++ +++  V++++F++S+    F   +++ I+ +L  LC + ++  E W S
Sbjct: 307  GDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWIS 366

Query: 356  DFNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQES 415
            DFN F+SKE GL A+Y IRDQ  +FF+ L  P  S+ +G++ + ++ +  N+  +   ES
Sbjct: 367  DFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTF---ES 423

Query: 416  LLYTLQXXXXXXXXXXXXLLGYT-ENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFM 474
            LLY LQ             +  + +N+L  L   L     + +  +R +L+ PK L+KF+
Sbjct: 424  LLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFI 483

Query: 475  ESYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQ 534
            +    +K +T                E++KS+ LIAF YY  +A+L SVLG   C  +Q+
Sbjct: 484  DVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQE 543

Query: 535  GLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSD-EVRDNEFNILLEISFKDPGN 593
             +++II +I+NDAEEDT    +E ++ VI  NS G  S  EV   E +++  IS KDP N
Sbjct: 544  KVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPAN 603

Query: 594  IQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLM 653
            +Q+ V+SQECLEKLLD +++  Y  Y E  +P  I ++  +   NY YSPLLSL L+F+ 
Sbjct: 604  VQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIA 663

Query: 654  TFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVL 713
             F+KK+P D  LP EI++ +F P+ +VL+ S E+ET+QLATEAFS+L+FN+D   MQT L
Sbjct: 664  VFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRL 723

Query: 714  ENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNII 773
             +I+ +L +LLSL +SD+AAMNVG+L++ IF++FS+++Q L+  ILQA   + V A+NI 
Sbjct: 724  MDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNIS 783

Query: 774  TSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKE 833
            T QNLL V CFL C+D +QTVDFL +  ++D++    L+LV+ KW+E F++IRGE++IKE
Sbjct: 784  TQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKE---ALSLVMSKWMEAFEVIRGERKIKE 840

Query: 834  NIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFL 893
            +I+ALSK + L D R+  ++VNGD+IPY GD IITRSMAK +PD++ Q+P+Y KI+KLF+
Sbjct: 841  SIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFI 900

Query: 894  GELASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVD 953
             EL  Q+K +    L +  IQ+ A A  +                      YEKL+EY+ 
Sbjct: 901  SELGFQAKQLDPEQLVASSIQESANANNDD--------ETGDWEDVDDVLDYEKLKEYI- 951

Query: 954  DDDDELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDE 1013
               D+  +   ++D D  TG  + D+ +SV +++++FF+EV +KN++ F  IY +LS+ E
Sbjct: 952  ---DDDVDGEEEDDRDDITG--LTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSE 1006

Query: 1014 KKLLANALV 1022
            +K L+ AL+
Sbjct: 1007 RKTLSEALL 1015

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1026 (41%), Positives = 628/1026 (61%), Gaps = 37/1026 (3%)

Query: 7    LIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLI 66
            L+  AQSAD   RE AE++LLQ CD NAS +F +L  +A     PL SRQF +LSL+KLI
Sbjct: 6    LVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLI 65

Query: 67   TMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPD 126
            TMYWSPGF+SYR TS V+   K+F+R+ LLKLCLN  +++KI + +SYCIVQISA+DFPD
Sbjct: 66   TMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD 125

Query: 127  LWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFTSPET 186
             WP LL VIY+AI   HS+ AMSLLNEIYDDV+S            T++ IF +  +  +
Sbjct: 126  QWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLATDTS 185

Query: 187  NIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQSEDA 246
             + AK AA KL  + +LQMS  +      RK F+SQC                   SE+ 
Sbjct: 186  TLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGF--HSENV 243

Query: 247  ---LQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASGS 303
               L+LK+  YE L  IK +F K  F   L   FK ++++DL  I       +D++ +  
Sbjct: 244  VSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAH-----LDTNGNSI 298

Query: 304  QLQLINEY----GVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359
            + + I+E      +++++F++S+    F   ++  I+ SL  LC +++   E W SDFNT
Sbjct: 299  EYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNT 358

Query: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419
            F+SKE GL A+Y +RDQ+ +F   L  P  S+ + +I +++ ++   Y+N  L+  L   
Sbjct: 359  FVSKETGLAASYNVRDQSSEFLISLSNPLLSLIFSVISKDIERN--TYDNQILESLLYLL 416

Query: 420  LQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTA 479
                          L    + ++ +   +L+ P    +  +R +L+ PK L+KF++    
Sbjct: 417  QSVLLNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPD 476

Query: 480  VKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKI 539
            +K +T +              E++KS+ LIAF+YY  +A+L SVLG   C  IQ  +++I
Sbjct: 477  IKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQI 536

Query: 540  IKDIANDAEEDTYAICVETISNVIDNNSSGTGS-DEVRDNEFNILLEISFKDPGNIQLSV 598
            I DI +D+EEDT    +E +S VI  N  G  S +E+   EF+++  IS KDP N+Q+ V
Sbjct: 537  INDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVV 596

Query: 599  ESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKK 658
            +SQECLEKLLD +++  Y  Y E  +P  I ++  ++  NY YSPLLSL L+F+  F+KK
Sbjct: 597  QSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKK 656

Query: 659  KPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVN 718
            KP+D  LP EI++ +F P+ +VL+ S+EEET+QLATE+FS+L+FN+D  +M+  L +I+ 
Sbjct: 657  KPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMK 716

Query: 719  VLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNL 778
            VL +LLSL +SD+AAMNVG L++TIF+KFS+ IQ L+  IL+A   + V A+NI T QNL
Sbjct: 717  VLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNL 776

Query: 779  LMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIAL 838
            L V CFL C+D +QTV+FL N  ++D+   N L+LV++KW+E F++IRGEKRIKENI+AL
Sbjct: 777  LSVLCFLTCNDSRQTVEFLSNFRIDDK---NALSLVMQKWMEAFEVIRGEKRIKENIVAL 833

Query: 839  SKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELAS 898
            S ++ L D R+  V+VNGD+IPY  D IITRSMAK +PD++ Q+P+Y KI+KLF+ EL  
Sbjct: 834  SNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGF 893

Query: 899  QSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDE 958
            Q+K      L + ++Q  A                           YEKL+EY+      
Sbjct: 894  QNKQPDPKQLITSNMQHDAAN-------LNNDEDNDDWEDVDDVLDYEKLKEYI------ 940

Query: 959  LANYTSDEDNDTPTGQIIG--DINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKL 1016
              N   D +++  +  I G  D+ +SV ++++ FFKEV +K+++ F  IY +LS+ ++K+
Sbjct: 941  --NDDVDGEDEDDSEDITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKV 998

Query: 1017 LANALV 1022
            L+ AL+
Sbjct: 999  LSEALL 1004

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1028 (42%), Positives = 632/1028 (61%), Gaps = 25/1028 (2%)

Query: 2    PDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILS 61
            P+  LLI  AQS DN VRE AE++LL  CD NA  VF SLIEL  N   PL+SR F +LS
Sbjct: 4    PEFQLLIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLS 63

Query: 62   LKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISA 121
            L+K ITMYWSPGF+SYRGTSNVQ  TKE +RD LLKL L+ +Q +K+++SSSYC+VQISA
Sbjct: 64   LRKFITMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISA 123

Query: 122  IDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIF 181
            +DFPD WP LL  +YNAI ++HS+ AMSLLNEIYDDVIS            T++ IF + 
Sbjct: 124  VDFPDEWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLL 183

Query: 182  TSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVN 241
            T+ +  + +K +A KL  + + QMS+LDN+ S KRK  VS+C                + 
Sbjct: 184  TNAQVRLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTIKLLLEQCEII 243

Query: 242  QSE-----DALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFI 296
            QS+     + L+ K N Y+++ +IK  FP+K F   +      I+++DL+ +   Y +  
Sbjct: 244  QSDLTSINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGLYQESF 303

Query: 297  DSDASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESD 356
              +     + +     +HL+DF+++  +   +   ++ I+++ + LC     T +SWESD
Sbjct: 304  KDNFDEQSMSIFENCVIHLLDFLAN-PISPLNNELISNILTASITLCEQSALTKDSWESD 362

Query: 357  FNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESL 416
            FN F SKE GL A++TIRD+  +  +  E P    ++ +I+  L+ +  + +  K+ ES 
Sbjct: 363  FNEFASKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKI-ESA 421

Query: 417  LYTLQXXXXXX-----XXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLE 471
            LY LQ                 L+ + +++L+    L      + M + R LLL PK L 
Sbjct: 422  LYLLQCLMNVEDDFSNTSLVPSLIEFIKSMLSQQNNL------DQMSQIRLLLLIPKTLA 475

Query: 472  KFMESYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCIS 531
            KFM+    VK +T E               ++  S LI+F+Y+ASYA++ SVLG+   + 
Sbjct: 476  KFMDILPNVKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLL 535

Query: 532  IQQGLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDP 591
            +Q   L +I++I+ ++ EDT  + +E ++ VID N     + E+   EF ++L IS KDP
Sbjct: 536  VQNKTLHLIQEISEESTEDTNGLLMEVLNCVIDCNDKNVANMELFKFEFKLILVISGKDP 595

Query: 592  GNIQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDF 651
             NIQ+S+ESQECLEKLL  ++ + Y+ + +  IP  I II     TNY YSPLLSL L+F
Sbjct: 596  ANIQVSIESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEF 655

Query: 652  LMTFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQT 711
            +  FMK KP ++ LP  +S+ VF+P+   LL S EEE +Q+ATEAFS+++ NS   ++  
Sbjct: 656  ITVFMKNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITP 715

Query: 712  VLENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKN 771
             LE IVN+L +LLS NISD+AAMNVGTLI+ + +++S+ +  LLP+I+ A  +K V + N
Sbjct: 716  KLETIVNILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNN 775

Query: 772  IITSQNLLMVFCFLICSDPQQTVDFLYNLSLE-DQQEENTLTLVLKKWLELFDIIRGEKR 830
            I T QNL+ + CFL+C DP+QTVDFL  L+++ D+ E+  L ++++KWL+ F ++RGE R
Sbjct: 776  ITTQQNLVTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENR 835

Query: 831  IKENIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVK 890
            IKENI+ALS+++LL D R+  V VNG+IIPY GD IITRSMAKS+PD++T +   EKIVK
Sbjct: 836  IKENIVALSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVK 895

Query: 891  LFLGELASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQE 950
            +FLGEL  Q +N +   L + D  K    + NQ  Q                  YEKLQE
Sbjct: 896  MFLGELGFQGRNKNPEELLTTDDMKGMGLKPNQ--QSNNDEGDDDWEDVDDVVDYEKLQE 953

Query: 951  YVDDDDDELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLS 1010
            Y+DD+DD   N   +   +T TGQ    I QS+ EL+ +FF     KN+  FQ+IY++LS
Sbjct: 954  YIDDEDDLDDNSVGEL--ETITGQ--QHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLS 1009

Query: 1011 EDEKKLLA 1018
            E+E+K ++
Sbjct: 1010 EEERKCIS 1017

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1029 (40%), Positives = 632/1029 (61%), Gaps = 31/1029 (3%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D+  LI  AQS + ++RE+AE+ LL+ C+ +A   F +L  +A N  E LSSRQ+ +L+L
Sbjct: 4    DIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLLAL 63

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYWSPGF+SY  TSN+ E  K  +R ++L+L L+  QDSKI+ S SYCIVQ+SA+
Sbjct: 64   RKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPDLWP LLV +Y +IL+ HS+EA+S+LNEIYDD+IS            T++ IF I  
Sbjct: 124  DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILD 183

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFV----SQCXXXXXXXXXXXXXXX 238
                 ++ K+AA+KL +  ++QMS++  + S KR + V     +                
Sbjct: 184  DKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDA 243

Query: 239  XVNQSEDAL---QLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQF 295
             +   E+A+   + + + YE L  + + F KK+   + +  F+  SL+DL    + Y+  
Sbjct: 244  LLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM 303

Query: 296  IDSDASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWES 355
            I  D        +N+Y +H+ +++S++S   +++ +L  I+ S+  LCCLDN   E+W S
Sbjct: 304  ISGDNIA--FNALNKYIIHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVETWNS 361

Query: 356  DFNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQES 415
            +FN F+SKE GL+A+Y++RDQ   F   L    ++I +   +  LN  +    +W+  ES
Sbjct: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCL-IIEDWRQLES 420

Query: 416  LLYTLQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFME 475
            +LY  Q                 EN+L+SL K      +N ++ SR +LL PK LEKFM+
Sbjct: 421  MLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMD 480

Query: 476  SYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQG 535
                +K +T E               ++KSS L+  + Y S+A+L +VLG   C  +QQ 
Sbjct: 481  DIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVQQI 540

Query: 536  LLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQ 595
             LKII  I +D+E+DTY + +E I+N+ID N       E+   EFN++L I+ +DP N+Q
Sbjct: 541  TLKIILQILDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQ 600

Query: 596  LSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTF 655
            ++VESQECL+KLL+G++   Y +Y E   P ++K++   + T Y YS LLSL L+F+  F
Sbjct: 601  MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF 660

Query: 656  MKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLEN 715
            MKKKP D  LP+EI K +FNP+ +VLL SNE+ET+QL+++AFS+L++N+D  +M   L  
Sbjct: 661  MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG 720

Query: 716  IVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITS 775
            I+ V+ +LLSL+++D+AAMN G+L++T+F+ F  +I+  +  IL  TT++ + AKNI T 
Sbjct: 721  ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI 780

Query: 776  QNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENI 835
            QNL+ V C+LICS+ + T++ L  L  E     + L LVL KW+  F+IIRGE+RIK+NI
Sbjct: 781  QNLISVICYLICSNTEDTINLLSRLGTEG----DILKLVLNKWISNFEIIRGERRIKQNI 836

Query: 836  IALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGE 895
            +AL+K+Y L +  I+ ++V+ ++IPY GD+IITRSMAK +PD++TQ+P+Y KI+KLF+ E
Sbjct: 837  LALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQE 896

Query: 896  LASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDD 955
            L+ Q K       H++ I++        +                    YEKLQEYVDD+
Sbjct: 897  LSEQMKQPE----HNLKIEETVET----IGDGNAAAADDDWEDVEDVLDYEKLQEYVDDE 948

Query: 956  DDELANYTSDEDNDTPTGQIIG--DINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDE 1013
            DDEL ++  DED+      I+G  DI   V EL+I   KE  SKN++ F  IY++LSEDE
Sbjct: 949  DDEL-HFGEDEDD------ILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDE 1001

Query: 1014 KKLLANALV 1022
            K++L+  LV
Sbjct: 1002 KRILSECLV 1010

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1025 (40%), Positives = 617/1025 (60%), Gaps = 24/1025 (2%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            +V  L+  AQSAD   RE AES LLQ   +    +F SLI++A N + PL+SRQF +L L
Sbjct: 4    NVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIACN-SYPLTSRQFSLLFL 62

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            ++L+TMYWS GF+SY G   V    K  +R+SLL+L L+  QD K K+SSSYC+VQISA+
Sbjct: 63   RRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAV 122

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP+LL+ IY AI++ +S+ AMSLL EI+DDV+S            TI+ +  + T
Sbjct: 123  DFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLT 182

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQ 242
            S  +++++K AA  L H+ VLQ+     + + +RK  +++                  +Q
Sbjct: 183  SSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQSSQ 242

Query: 243  SE---DALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSD 299
             E     L+LK + YE L  +K+ F K+ F        K + LKDL  I + Y + ++ +
Sbjct: 243  DEIQPTLLKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLN-N 301

Query: 300  ASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359
                 +  ++E  +H+I F+SSL    F   +   ++ SL  +CCL +     W++ FN 
Sbjct: 302  TDDKDIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDWDNYFNI 361

Query: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419
            F++KE GL A+Y+ RD++ QFFS+L    Y+     + + ++ S     +WK QESL+Y 
Sbjct: 362  FVTKETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHAS--GIEDWKYQESLMYL 419

Query: 420  LQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTA 479
            ++                 +  L++  +LL    +N  VK R +L+ PK LEKFM+S   
Sbjct: 420  MEAAVNNDEEITNDFQPVLQ-TLDAFSELLASCETNEFVKVRVILILPKILEKFMDSLED 478

Query: 480  VKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKI 539
            +K + K+              +ILK + LI+F+YY+S+A+L SVLG+     +++ +LKI
Sbjct: 479  IKLLVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEAVLKI 538

Query: 540  IKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVE 599
            I +I  DAE+DT A+ +ET++ +I + S+      VR +E  ++L+IS KDP NIQ+ +E
Sbjct: 539  INEIYEDAEDDTPALLLETLNQIIGSTSNAEVIASVRFDELQLILKISAKDPSNIQVVLE 598

Query: 600  SQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKK 659
            +QECL+ LL  + + +Y+ YAE  IP  + ++    S+ ++YSP+LSL+L+ L  FMKKK
Sbjct: 599  AQECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTVFMKKK 658

Query: 660  PVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNV 719
            P + TLP  I+  VF P+ E L+ S ++E +QL T+ +SFL+ NS+ S +   L  I++V
Sbjct: 659  PTNGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHLNTILSV 718

Query: 720  LSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLL 779
            L KLLS+N SD+AAMNVG+LII IF K S Q+QE +P IL+A  ++ V   NI T++NL+
Sbjct: 719  LEKLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIATAENLI 778

Query: 780  MVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALS 839
             VFC+L  ++P QTVDFL +L L D +  + L L+L KWLE F+IIRGEKRIKENI+ALS
Sbjct: 779  FVFCYLTSTNPNQTVDFLSSLVL-DSEGNSALKLILPKWLESFEIIRGEKRIKENILALS 837

Query: 840  KIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQ 899
            K++ L D+RI  +IVNGD IPY GD +ITRSM+K +P+++TQ+  YEKIVKLF+ EL+ Q
Sbjct: 838  KLFFLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAELSFQ 897

Query: 900  SKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDEL 959
                        D++K     ++Q  +                  YEKLQEYV       
Sbjct: 898  GNQPGLEKYIPHDLKKY----DDQAIKAANDANDDDWEDVDDVLEYEKLQEYV------- 946

Query: 960  ANYTSDEDNDTPTGQIIG--DINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLL 1017
                  +  D   G +IG  +++QS  EL+I FF+E  +KN++ FQ+IY+ L+++EK++L
Sbjct: 947  --DDESDLEDDEEGDVIGVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVL 1004

Query: 1018 ANALV 1022
               LV
Sbjct: 1005 TENLV 1009

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1022 (40%), Positives = 618/1022 (60%), Gaps = 24/1022 (2%)

Query: 7    LIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELA-NNINEPLSSRQFCILSLKKL 65
            LIA  QS DN+VR  AES L+   DE+AS V  SLI +A N+  +PL+ RQF +LS++KL
Sbjct: 6    LIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALLSMRKL 65

Query: 66   ITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFP 125
            IT YWSP F+SYR T+ +   TK+++RDSLL+L LN  QD+KIK S+SYCIVQISA+DFP
Sbjct: 66   ITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQISAVDFP 125

Query: 126  DLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFTSPE 185
            D WP LL  +Y AI   HS+ A+SLLNEIYDDVIS            T++ IF + +S  
Sbjct: 126  DEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQLLSSDA 185

Query: 186  TNIKAKVAASKLLHSTVLQMSILD-NSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQSE 244
            + I+AK+AA  L H+T+LQMS +D ++   KRK+ V  C                   S 
Sbjct: 186  STIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLADINSA 245

Query: 245  DALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASGSQ 304
              LQLK + Y+ L  IK +FP +LF +  V  FK  +++DL  +  +     DS A  + 
Sbjct: 246  LPLQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDLVALQINQ----DSFADDTV 301

Query: 305  LQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFISKE 364
            ++  NE  +H+I+ ISS+ +  +   D   I+ +L+ L  LD NT ESW +DFN F+SKE
Sbjct: 302  VEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDFNDFVSKE 361

Query: 365  AGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQXXX 424
             GL A++TIRDQ   +            +  IL+ ++  + +  +    ES L+ LQ   
Sbjct: 362  TGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNADPTTIESSLFLLQSVL 421

Query: 425  XXXXXXXXXLLGYTENVLNSL-GKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAVKPM 483
                            ++++L G   ++  ++ +++SR +L  PK L+ FM+S   +K +
Sbjct: 422  AEDTDFSVSSPQTLVQLISALIGPQTINTHNDSILRSRIILTIPKILDVFMDSLPNIKQL 481

Query: 484  TKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKIIKDI 543
            TK+              E++  S LIAF+YY  +A+L SVLGS  C  +Q+ +L I+  +
Sbjct: 482  TKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRELQEAVLGIVNHV 541

Query: 544  ANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVESQEC 603
            A++AEEDT  + +E +++VI  N + T   ++   E   +L IS KDP NI++SVESQEC
Sbjct: 542  ASEAEEDTNGLLIEVLNHVISCNVASTDF-KLLQKELTAMLSISSKDPSNIEVSVESQEC 600

Query: 604  LEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPVDS 663
            LEKLLD ++   Y  +    +P  + II  +    Y Y+PLLSL L+F+  FMKKKP + 
Sbjct: 601  LEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFVRIFMKKKPTNG 660

Query: 664  TLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVLSKL 723
             LP   S+ +   + ++L  S E+ET+QLAT AFS L+ N+D +++   L  ++ VL +L
Sbjct: 661  MLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVIQHLTVVIKVLKRL 720

Query: 724  LSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLMVFC 783
            LS+ +SDTAA NVGTLI+T+F+K+S+++  L+P IL++   + ++AKN+ T +NL+ + C
Sbjct: 721  LSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNVTTQENLISLIC 780

Query: 784  FLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSKIYL 843
            ++ C DP Q V+FL+  S  + +  +  +L+  KW E F+I+RGE++IK+NIIALSKI+ 
Sbjct: 781  YVTCCDPLQMVNFLFKFS--ESERRDIPSLMFNKWFETFEIVRGERKIKDNIIALSKIFF 838

Query: 844  LLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQSKNI 903
            L D R+  V VNGD++PY GD+IITRSMAK +PD++TQ+ +Y KIVK+F+ EL  ++K  
Sbjct: 839  LSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVFVTELQFRNKQP 898

Query: 904  SDANLHSIDIQ---KLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDELA 960
                L + DI+   +LA AE N  +                   YEKL+E+VDDDDD   
Sbjct: 899  DAERLITSDIKHSDELAAAEGNDDDGW---------EDVDDVLDYEKLKEFVDDDDDRED 949

Query: 961  NYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLANA 1020
            +     D D  TG  I  + QS ++L+  FFKE  + N+N FQ++Y++LSE E+ +L+  
Sbjct: 950  SVGLGNDADEITG--IDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTILSQC 1007

Query: 1021 LV 1022
            L+
Sbjct: 1008 LL 1009

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1024 (37%), Positives = 602/1024 (58%), Gaps = 30/1024 (2%)

Query: 8    IAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLIT 67
            IA AQS D   RE  E+ + + C E+ S     L++LA   +  + +R F +LSL+KLIT
Sbjct: 9    IASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLRKLIT 68

Query: 68   MYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDL 127
            MYWS GF+SYRG   V E+ KE +R+SLL+L L+  QD++I+  SSYCIVQI+A+DFPD 
Sbjct: 69   MYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVDFPDE 128

Query: 128  WPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFTSPETN 187
            WP L+ ++YNAIL+ HS+ A+ +LNEI+DDV+S            TI+ I  I   P  +
Sbjct: 129  WPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILNDPGCS 188

Query: 188  IKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXXVNQSE--D 245
            I AK +A+KL  + +LQ+     S + + +  ++                    Q E  D
Sbjct: 189  ILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQDEAID 248

Query: 246  ALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASGSQL 305
             L+L     + LTTI+T FPKKL  +++      + +++   + +      + + S    
Sbjct: 249  LLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAALSNDNTEEEKSSE-- 306

Query: 306  QLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFISKEA 365
              INE G+ ++  ++++  +      L+++V   V+  CL     E+WESDFN F+SKE 
Sbjct: 307  --INEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVSKEV 364

Query: 366  GLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQXXXX 425
            GL ++Y IRD+  QF  ++    Y   + I++  L+K   +   W+L+E++ Y +Q    
Sbjct: 365  GLASSYYIRDECSQFLQEISGARYQSIFEILVSALSKV--DPLEWRLKEAVFYLIQSLCI 422

Query: 426  XXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAVKPMTK 485
                          ++LN L + +   +  + V++R +L  PK +EKFM+    VK + K
Sbjct: 423  NEDEVTVFNNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVKDIVK 482

Query: 486  EXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLG-----SADCISIQQGLLKII 540
            E                LK+S LIAFS YAS+A+L SVLG      A C+     +L +I
Sbjct: 483  ELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCL-----VLNLI 537

Query: 541  KDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVES 600
            +D+  D+E+DT A+ +E ++  +   S+ T          N++L+IS KDP N+Q+ +E+
Sbjct: 538  QDVLEDSEDDTPAVLLEALNPALAKQSNTTKDTLFYQQALNLVLKISAKDPSNLQVVLEA 597

Query: 601  QECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKP 660
            Q+C+  LL G     Y+  ++  IPL + I+    + NY Y+P++SL+L+ L  FMKKKP
Sbjct: 598  QDCISALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKKKP 657

Query: 661  VDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVL 720
             D  LP  IS  VF P+ ++L++S+++E +Q+A++A ++L+ NS  S ++ +L  ++++L
Sbjct: 658  SDGFLPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLSIL 717

Query: 721  SKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLM 780
             KLLS+N SD+ AMNVG+L++    K+S Q+QE+ P IL+A T++FV+AKN+ T++NL+ 
Sbjct: 718  EKLLSVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENLVF 777

Query: 781  VFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSK 840
            VFC+L   +P + ++FL + ++ +++E N+L  VL KWLE F+++RGE+RIKENI+ALSK
Sbjct: 778  VFCYLTSINPAEAINFLSSFTI-NEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALSK 836

Query: 841  IYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS 900
            I+   D R+  VIVNGD +PY GD I+TRSMAK +P ++T++  +EKIVKLF+ EL  QS
Sbjct: 837  IFFQSDPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQS 896

Query: 901  KNISDANLHSIDIQKLARAEE--NQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDE 958
               S      ++ +K   +    N  E +                 Y++LQ++V +D + 
Sbjct: 897  SQPSLDKFLPVNARKFDTSSSFNNNAEDE---QDDGEWEDVDDVLEYDQLQQFVVEDGER 953

Query: 959  LANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLA 1018
              N + DED+       I DI QS  EL+I+FFKE  +KNIN+ +D+Y +LSE EKK+L+
Sbjct: 954  --NDSDDEDSLAN----IQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILS 1007

Query: 1019 NALV 1022
              L+
Sbjct: 1008 ENLM 1011

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1019 (37%), Positives = 597/1019 (58%), Gaps = 20/1019 (1%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D+  LI HAQS   + RE+AE+ LL  C  +   VF SLI +A++ +  ++S+QFC++S+
Sbjct: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYW+ GF+SY G   V E  KE +R++LLKL L   Q+SKI S+SSYCIVQI+A+
Sbjct: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP+LL  +Y+AI  D+S  A+SLL+EI+DDV+S            T++ +F++ +
Sbjct: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLS 193

Query: 183  SPETNIKAKVAASKLLHSTVLQM---SILDNSMSFKRKDFVSQCXXXXXXXXXXXXXXXX 239
            +  ++   K AA KL HS +LQ+     L++  +  R                       
Sbjct: 194  NTSSSFGIKDAAMKLYHSCLLQLLSPHALESDEN--RSQIAQHVNETLHIFLQLLGNHNL 251

Query: 240  VNQSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSD 299
             + S + L LK + YE LT +KT+FPKKLF + L  +FK ++LKDL+ +G  Y Q + S 
Sbjct: 252  ADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILAS- 310

Query: 300  ASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359
               + LQ ++E  +++I F+SSL     +  ++  ++ SLV LC L  +  +   +D N+
Sbjct: 311  VDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNS 370

Query: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419
            F+SKE G+   YTIRD+  QF SD+    Y   +  +LE+    M  + +W+ QES+LY 
Sbjct: 371  FVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVM--HLDWEKQESMLYL 428

Query: 420  LQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTA 479
            LQ              G  E +L  L  +L   + + +V SR  +   K LEKF+     
Sbjct: 429  LQSCQGNTEEFEVNSQGLVELLLR-LQNILESQNIHCLVWSRLSITIAKILEKFVCKLEN 487

Query: 480  VKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKI 539
            +K + KE                +K+  LI++  Y+S+  L SVLG  DC  +++ +L I
Sbjct: 488  IKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDI 547

Query: 540  IKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVE 599
            I DI  + ++DT    +E +S VI +N   T +  ++ +E   +L++S  DP ++Q+ VE
Sbjct: 548  INDIYAEVDDDTPGFLLEVLSGVIASNPEST-NKSLKASELEFVLKLSTSDPYSVQVVVE 606

Query: 600  SQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKK 659
            +Q+CL  LL  +    YIYYAE  IP  + ++    +  + Y+PL+SL+L+ L  F+KK 
Sbjct: 607  AQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKN 666

Query: 660  PVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNV 719
            P D  LP  + + VF P+  +++SS ++E +QL+TEAF+FL+ NS    + + L+  + +
Sbjct: 667  PSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMI 726

Query: 720  LSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLL 779
            L +LL+ + S +A+  VG+L++++ +KF+ QIQ+++P +L+A  ++ V   NI T +NL+
Sbjct: 727  LERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLI 786

Query: 780  MVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALS 839
            +VFC L   D +QTVDFL +L L D    + L L++ KWL+ F+IIRGEK+IKENI+ALS
Sbjct: 787  LVFCHLTSVDVKQTVDFLSSLIL-DSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALS 845

Query: 840  KIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQ 899
            K++ L D R+  ++VNGD+IPY GD IITRSMAKS+PD++T++  YEKI+KL + EL  Q
Sbjct: 846  KLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQ 905

Query: 900  SKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVDDDDDEL 959
                      S   +KL +  ++                      YEKLQEY++      
Sbjct: 906  YNQPDPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEYIEG----- 960

Query: 960  ANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLA 1018
                SD D+D     I+ +I ++ SEL+  FFKE   K+I+ F+DIY+ L+E EK+ L+
Sbjct: 961  ----SDIDDDDDDLLIMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1034 (37%), Positives = 594/1034 (57%), Gaps = 51/1034 (4%)

Query: 8    IAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLIT 67
            I  AQS +  VREN+E+ L   C EN S    SL++LA  I   +  R F +LSL+KLIT
Sbjct: 20   IVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLRKLIT 79

Query: 68   MYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDL 127
            MYWS GF+SYRG   + +E K  +R+SLL L L+  QD+++K+ SSYCIVQI+A+DFPD 
Sbjct: 80   MYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDE 139

Query: 128  WPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFTSPETN 187
            WP L+  I++AIL+  S+ A+ +LNEI+DDV+S            TI+ IF I ++ +++
Sbjct: 140  WPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSS 199

Query: 188  IKAKVAASKLLHSTVLQMSILDNSMSFKRKDF-------VSQCXXXXXXXXXXXXXXXXV 240
             +AK A++KL  + +LQ   L + M+   +D+       + +                 +
Sbjct: 200  TQAKTASAKLYQACLLQ---LQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKGI 256

Query: 241  NQSEDALQLKTNFYEELTTIKTEFPKKLFH--------NSLVTNFKAISLKDLEIIGSSY 292
            N S  AL L+      L TIKT F KKLF           L  NF+ I+   +++     
Sbjct: 257  NTS--ALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELCIDVT---- 310

Query: 293  LQFIDSDASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYES 352
               ID D   +     NE G+ ++   ++L     +  +   IV S V+   + +   E 
Sbjct: 311  ---IDPDMKLAA----NEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAEC 363

Query: 353  WESDFNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYN---N 409
            W++DFN F SKE GL  ++T+RD+  QF   L       AY  +   L  ++  YN   N
Sbjct: 364  WDNDFNVFASKETGLSTSFTVRDECEQFMQGLS----GFAYNSVFNALTSAL-IYNESPN 418

Query: 410  WKLQESLLYTLQXXXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKY 469
            WK+QES+L+ +Q                T+++LN+L ++L    S+I+VK+R L+  PK 
Sbjct: 419  WKVQESILFFIQALCGNEDDEVSFNFEKTQSLLNTLRQILELEDSHILVKTRSLIALPKV 478

Query: 470  LEKFMESYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADC 529
            +E+FME+  +VK + K+                +K   LI+F+YYAS+A+L SVLG    
Sbjct: 479  IERFMETLESVKALVKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFY 538

Query: 530  ISIQQGLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFK 589
               Q+ +  II+++  +AEEDT +I +E ++  + +N   T +         ++L+IS K
Sbjct: 539  GEAQRSVSAIIQELLEEAEEDTPSILLEALAPTLSSNHKTTETISFYQLALQLILKISSK 598

Query: 590  DPGNIQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTL 649
             P NIQ+ +E+Q+CL  LL       Y+ Y++  IPL   ++       + Y+P++ L+L
Sbjct: 599  HPSNIQVGLEAQDCLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSL 658

Query: 650  DFLMTFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLM 709
            + L  F+K+KP D  LP +I+  VFNP+ ++L++S+++E +QL ++A  +L+ NS+   +
Sbjct: 659  EMLTVFIKRKPRDGCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQL 718

Query: 710  QTVLENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNA 769
               L  ++  L KLLS   SD+ A++VG L++ +  KFS+Q+QE+ P IL+A T+KF+ A
Sbjct: 719  FPHLNVVLCDLEKLLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGA 778

Query: 770  KNIITSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEK 829
             N+ T++NL  VFC+L+  +P + ++FL + S+ DQQE++ L  VL KWLE F+++RGEK
Sbjct: 779  HNVFTTENLANVFCYLVSLNPAEVINFLSSFSI-DQQEQSVLCPVLSKWLESFEVLRGEK 837

Query: 830  RIKENIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIV 889
            RIKENI+ALSK++   D RI+ + VNGD IPYSGD IITRSMAKS+P+++T++  Y+KIV
Sbjct: 838  RIKENIMALSKLFFQADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIV 897

Query: 890  KLFLGELASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQ 949
            KLF+ EL  Q+   S  +L         + E + +                    YE+LQ
Sbjct: 898  KLFVAELDFQT---SQTDLEKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQ 954

Query: 950  EYVDDDDDELANYTSDED-NDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSS 1008
             +VD D      ++SD D  D   G  I ++ QS  EL+I+FFKE  S+NIN F+ IY +
Sbjct: 955  HFVDQD-----TFSSDRDEEDVIPG--IKNVQQSTRELLISFFKEAASQNINDFKTIYDN 1007

Query: 1009 LSEDEKKLLANALV 1022
            LSE+EK++L+  LV
Sbjct: 1008 LSENEKRILSENLV 1021

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1033 (36%), Positives = 585/1033 (56%), Gaps = 48/1033 (4%)

Query: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62
            D+  L+  AQSA    RE+AE  LL+ C  + + V   L+++A   N  L+SRQFC+ +L
Sbjct: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79

Query: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122
            +KLITMYW+ GF+SY G   V+E+ KE +RD+LL++ ++  QDSKI S+S+YC+VQI+A 
Sbjct: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139

Query: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFT 182
            DFPD WP LL  +Y +I  + S+ A+ LL+EI+DDV+S            TI+ IF +  
Sbjct: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199

Query: 183  SPETNIKAKVAASKLLHSTVLQMSILDN-SMSFKRKDFVSQCXXXXXXXXXXXXXXXXVN 241
              +  +  K AA KL HS +LQ++       +  R    +                  + 
Sbjct: 200  D-DGPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRSLE 258

Query: 242  QSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301
               D LQ + + YE L  IKT+ PK+ F  +L        L+DL ++G+ Y Q +   A 
Sbjct: 259  PHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHL---AE 315

Query: 302  GSQ--LQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359
            G +  L+ + E  +H++ F+SS+     +   +  ++ SL  L CL     E+W+ D+N+
Sbjct: 316  GDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNS 375

Query: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEEL--NKSMENYNNWKLQESLL 417
            FISKE GL ++YT RD+  Q+ SDL    Y     ++ E+L   +SM     W+ QESLL
Sbjct: 376  FISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESM----AWRSQESLL 431

Query: 418  YTLQXXXXXXXXXXXXLLGYTENVLNSL----GKLLMDPSSNIMVKSRCLLLCPKYLEKF 473
            + LQ               + E  +  L     +LL     + +V+ R  +  P+ LEK+
Sbjct: 432  FLLQSCQLNSEGPQ-----FDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKY 486

Query: 474  MESYTAVKPMTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQ 533
            M+S   VK + +E              ++L +S LIAF+YY+S+ D  SVLG      ++
Sbjct: 487  MDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELE 546

Query: 534  QGLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGN 593
            + +L  IK+I +  +EDT    +E +S V   N   + + E++  E  ++  ++  DP N
Sbjct: 547  KLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKE-SRNRELKLYELQLVQNVATADPSN 605

Query: 594  IQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLM 653
            IQ+ VE+QECL+ LL   D   Y+ YAE  IP  ++++   +S  Y Y+PL+SL+L+ L+
Sbjct: 606  IQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLV 664

Query: 654  TFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVL 713
             FM+KKPVDS LP  +   +F+P+  +LL++ ++E +QL+TEAF+ L+ +S    +   +
Sbjct: 665  VFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRI 724

Query: 714  ENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNII 773
              I+ +L KLLS   S +AA+N GTL+I + +KF+ QIQ+++P IL+A  ++ V  KN+ 
Sbjct: 725  PVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLH 784

Query: 774  TSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKE 833
            T++NLL VFC+L   D +QTVDFL + ++ D+     L  ++ +WLE F+++RGE +IKE
Sbjct: 785  TAENLLFVFCYLTSIDARQTVDFLSS-TIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKE 843

Query: 834  NIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFL 893
            NI++LSK++ L D RI  + VNGD+IP+ GD IITRSMAK +PD++TQ+   EKIVKLF+
Sbjct: 844  NILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFV 903

Query: 894  GELASQSKNISDANLHSIDIQKLARAEENQVEQKXXXXXXXXXXXXXXXXXYEKLQEYVD 953
             ELA Q +N  D   +  D    A   +++ +                   YEKLQEY D
Sbjct: 904  AELAFQ-QNQPDPGRYPKDGSGPADPHDSEGDS-----ADEDWEDVDDILDYEKLQEYAD 957

Query: 954  DDDDELAN----YTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSL 1009
            D D +       +TS+ + D  T             L+  FFKE  ++N + FQ+IYS L
Sbjct: 958  DSDIDDTGDSLLFTSNIEEDATT-------------LLTQFFKEAVARNASGFQEIYSRL 1004

Query: 1010 SEDEKKLLANALV 1022
            +E EKK L+  +V
Sbjct: 1005 TEQEKKSLSACMV 1017

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score =  276 bits (705), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 227/898 (25%), Positives = 413/898 (45%), Gaps = 40/898 (4%)

Query: 7   LIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLI 66
           L+   QS     RE+AE+ LL++C  +    F  LI+ A N N   S+RQ  +L L+K  
Sbjct: 6   LLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRKFT 65

Query: 67  TMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPD 126
           TMYWS GF S+ G   V E+ K+ +R  LL L  N + + K+ S+ +YCIVQI A+DFPD
Sbjct: 66  TMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDFPD 125

Query: 127 LWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISXXXXXXXXXXXXTIKTIFAIFTSPET 186
            WP LL  +   IL  HS  A+SLL E+  D+I+             + T+         
Sbjct: 126 EWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDDTL 185

Query: 187 NIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCXXXXXXXXX----XXXXXXXVNQ 242
            ++AK    +L H  + Q   L N   F   + +S+                      N 
Sbjct: 186 RLQAKSKLLQLYHHCISQ---LRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGNNM 242

Query: 243 SEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASG 302
             + + LK   +  L+ +       L  N  ++    I+L  ++   +SY + + ++   
Sbjct: 243 ESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARAL-TNNDE 301

Query: 303 SQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFIS 362
            +L++IN   ++ + +++ +     +   L       + LC L  + ++   SDFN FIS
Sbjct: 302 LRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKL--SDFNEFIS 359

Query: 363 KEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQX 422
           KE GL A+Y  RD+  Q+ S      Y      +L++  +   N   +  QE+ L+  Q 
Sbjct: 360 KETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQY--QEACLFLFQE 417

Query: 423 XXXXXXXXXXXLLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAVKP 482
                       +   ++ L+    +L D +    VKSR +L  PK+ E  ME+   +K 
Sbjct: 418 LCSNETSMN---VPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPEIKQ 474

Query: 483 MTKEXXXXXXXXXXXXXXEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKIIKD 542
           + ++              + L +S++I+F+YY S+A+L S+L     + +QQ LLK IK 
Sbjct: 475 LVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKAIKT 534

Query: 543 IANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVESQE 602
           +  D+EED+  + +E +  ++            +    N+LL++S  +P N+++  ES  
Sbjct: 535 LYVDSEEDSLGLLLEAMHEIV-KTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFESVR 593

Query: 603 CLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPVD 662
            L  LL  ++ + Y    E   P  I+ ++    +   YSPL+ L L+FL  F+K  PV 
Sbjct: 594 SLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPPVG 653

Query: 663 STLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVLSK 722
           + +  E+++ V NP+ + +    +E   + A +AF +L  NS+    +   +++ ++ S 
Sbjct: 654 NHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWK---DSMFDLCSL 710

Query: 723 LLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLMVF 782
           +     S    ++V  +++             +  I++ T  K V+   +    + +++ 
Sbjct: 711 VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLHPVDSFIIIS 770

Query: 783 CFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSKIY 842
           C +I  D Q  + +++++ +    EE+    ++++  + F+  R +  +KE  ++LS+++
Sbjct: 771 CEVILKDIQSFLAYIFSIPI--SAEESIPNKLIRELFDCFEENRSKNMLKEVALSLSELF 828

Query: 843 LLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQS 900
                             +S D+ +TRS      D   + P  E IVK+F  EL  Q+
Sbjct: 829 ------------------FSNDQRLTRSSYHDESDGVVR-PFKEYIVKMFADELTRQT 867

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
           YPL125W
          Length = 1041

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 9   AHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITM 68
            + Q A + +++ AE +L  K  E      + L  +  +++ PL  R   ++  K  I  
Sbjct: 21  GNPQHAGSEIQKLAEQQL--KAWEIKPGFHHLLQSVYLDLSNPLQVRWLAVIQFKNGIDK 78

Query: 69  YWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLW 128
           YW     S R    + +E K  +R  L +L    EQ++++   ++    +IS +DFP  W
Sbjct: 79  YWR----STR-VHAISKEEKSLIRSRLFELI--DEQNNQLTIQNAQAASKISRLDFPGEW 131

Query: 129 PNLLVVIYNAILKDHSIE 146
           PNL   +   +LKD+ I 
Sbjct: 132 PNLFEQL-EHLLKDNHIR 148

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 9   AHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITM 68
            + Q A + V+++AE +L Q   +     +   I L  +++  L SR    +  K  +  
Sbjct: 20  GNPQQAGSQVQKSAEQQLKQWEIQPGYHYYLQSIYL--DLSNTLQSRWLAAIQFKNGVDR 77

Query: 69  YWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLW 128
           YW            + ++ K  +R  L +L    EQ++++    +  I +I+ +DFP  W
Sbjct: 78  YWRSS-----RVHAINKDEKASIRARLFELI--DEQNNQLGIQYAQAIAKIARLDFPAEW 130

Query: 129 PNLLVVIYNAILKDHSIEA 147
           P+L   +  ++L DH++  
Sbjct: 131 PDLFEHL-ESLLSDHNVRC 148

>NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 62/135 (45%), Gaps = 9/135 (6%)

Query: 9   AHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITM 68
            + Q A + V++ AES+L Q   ++        I L  +++  L +R   ++  K  +  
Sbjct: 20  GNPQQAGSQVQKLAESQLKQWEVQSGYHFLLQTIYL--DLSNSLQTRWLAVIQFKNGVDK 77

Query: 69  YWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLW 128
           YW     S R    + ++ K  +R  L  +    EQ++++    +    +I+ +DFP  W
Sbjct: 78  YWR----STR-VHCINKDEKASIRTRLFDMI--DEQNNQLGIQYAQATARIARLDFPVEW 130

Query: 129 PNLLVVIYNAILKDH 143
           PNL   + + +  DH
Sbjct: 131 PNLFETLKSLLENDH 145

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 47  NINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDS 106
           N++  L  R   I+  K     +W P        + + ++ K  +RD L  +    E+++
Sbjct: 54  NLSWSLQVRWLAIIQFKNSTDKFWRPT-----RMNCISKDEKSSIRDRLFHMV--NEENN 106

Query: 107 KIKSSSSYCIVQISAIDFPDLWPNLLVVIYNAILKDHSI 145
           ++   +++   +I+ +D+P  WPN+    +   L DH +
Sbjct: 107 QLAIQNAHATAKIARLDYPQNWPNMFEY-FEIALADHQV 144

>KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1053

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 65/135 (48%), Gaps = 9/135 (6%)

Query: 9   AHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITM 68
           ++ Q A + V+  AE++L  K  E  S     L  +  +++ PL  R   ++  K  I  
Sbjct: 21  SNPQHAGSEVQRLAETQL--KEWEIQSGFHYILQTIYLDLSNPLQVRWLAVIQFKNGIER 78

Query: 69  YWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLW 128
           YW     S R  + ++++ K  +R  L  L    EQ++++   ++    +I+ +DFP  W
Sbjct: 79  YWR----STR-VNAIRKDEKASIRARLFDLI--DEQNNQLCIQNAQATSKIARLDFPAEW 131

Query: 129 PNLLVVIYNAILKDH 143
           PNL  ++   +  DH
Sbjct: 132 PNLFELLEKLLENDH 146

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 66/141 (46%), Gaps = 15/141 (10%)

Query: 9   AHAQSADNNVRENAESELLQKCDENASVVFNSLIE-LANNINEPLSSRQFCILSLKKLIT 67
           ++ Q A + V++ AE +L +   +     F+ L++ +  N++  L  R   ++  K  + 
Sbjct: 20  SNPQHAGSEVQKAAEQQLREWQQQPG---FHFLLQSIYLNLSNSLQIRWLAVIQFKNGVE 76

Query: 68  MYWSPGFDSYRGT--SNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFP 125
            YW       R T  + + ++ K  +R  L  L    EQ++++   ++    +I+ +DFP
Sbjct: 77  KYW-------RSTRINAINKDEKISIRGRLFDLI--DEQNNQLSIQNAQAAAKIARLDFP 127

Query: 126 DLWPNLLVVIYNAILKDHSIE 146
             WPNL   +   +  DH + 
Sbjct: 128 VEWPNLFEQLEQLLSNDHIVR 148

>SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3725

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 711  TVLENIVNVLSKLLSLNISDTAAMNVG-TLIITIFSKFSQQIQELLPAILQATTQ 764
            TV +N V  LS +++ ++  T+++  G TL  T+F  F Q I  LLPAI++  ++
Sbjct: 2208 TVGKNFVVTLSSIIAEDLQGTSSVAAGVTLTWTLFMHFPQSIDSLLPAIMKTFSK 2262

>AGL349C Chr7 complement(53004..56282) [3279 bp, 1092 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR308C
           (PSE1)
          Length = 1092

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 13  SADNNVRENAESELLQK--CDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITMYW 70
           SADNN+R  AE  L  +   +EN  V+   L E A + +E L+      +  +KL  +  
Sbjct: 21  SADNNIRAAAEETLNNQWITEENIHVLLVFLAEQA-SFSEDLTLAGLSAVLFRKL-ALRA 78

Query: 71  SPGFDSY---RGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDL 127
            P   +    +  +++ +E  E +R +LLK    +E+ + I+   S  I + +  D P  
Sbjct: 79  PPSSKAVIIAKNITHISKEALEQIRTTLLK-GFVSERSNGIRHKLSDAIAECAQDDLP-A 136

Query: 128 WPNLLVVIYNA 138
           WP LL  ++ A
Sbjct: 137 WPELLRTLFEA 147

>Ecym_5663 Chr5 (1341597..1344875) [3279 bp, 1092 aa] {ON} similar
           to Ashbya gossypii AGL349C
          Length = 1092

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 60/131 (45%), Gaps = 9/131 (6%)

Query: 13  SADNNVRENAESELLQK--CDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITMYW 70
           SADNNVR  AE  L  +   +EN  V+   L E A   +E L+      +  +KL  +  
Sbjct: 21  SADNNVRAAAEETLNSQWITEENIQVLLVFLAEQA-AYSEDLTLASLSAVLFRKL-ALRA 78

Query: 71  SPGFDSYRGTSNVQEETKEFL---RDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDL 127
            P   +     N+   +KE L   R +LLK    +E+   I+   S  I + +  D P+ 
Sbjct: 79  PPSSKTVIIAKNITHISKEALTQIRGTLLK-GFVSERSDGIRHKLSDAIAECAQDDLPE- 136

Query: 128 WPNLLVVIYNA 138
           WP LL  ++ A
Sbjct: 137 WPELLQTLFEA 147

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 69/138 (50%), Gaps = 16/138 (11%)

Query: 12  QSADNNVRENAESELLQKCDENASVVFNSLIE-LANNINEPLSSRQFCILSLKKLITMYW 70
           + A + +++ AE +L Q   +     F+ L++ +  +++ PL+ R   I+  K  +  +W
Sbjct: 23  RHAGSQIQKQAEQQLKQWETQEG---FHYLLQSIYLDLSCPLNVRWLAIIQFKNGVEKFW 79

Query: 71  SPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLWPN 130
                S R  + +++E K  +R  L  L    E+++++   +S    +I+ +DFP  WP 
Sbjct: 80  R----STR-VNAIRKEEKVSIRTRLFDLI--DEKNNQLCIQNSQATARIARLDFPGEWPG 132

Query: 131 LL-----VVIYNAILKDH 143
           L      ++ Y+ I +D+
Sbjct: 133 LFDQLEKLLSYDKIWQDN 150

>NDAI0A01540 Chr1 (344002..347346) [3345 bp, 1114 aa] {ON} Anc_7.408
           YER110C
          Length = 1114

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 16/83 (19%)

Query: 55  RQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSY 114
           RQ   + ++KLI  +W+          ++ + TK  ++ SLL+    TE+   I+ ++++
Sbjct: 59  RQLAGIEVRKLIPKHWN----------SLDDATKTQIKTSLLQNAF-TEEKQIIRHANAH 107

Query: 115 CIVQIS-----AIDFPDLWPNLL 132
            I  IS     A  +PDL PNL+
Sbjct: 108 VIAAISIEELEANKWPDLIPNLI 130

>SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1032

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 9   AHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITM 68
           ++ Q A + V+  AE +L  K  E  S     L  +  +++  L  R   I+  K  I  
Sbjct: 21  SNPQHAGSQVQRLAEQQL--KTWETQSGYHYLLQSIYLDLSCSLQIRWLAIIQFKNGIER 78

Query: 69  YWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLW 128
           YW     S R  + + ++ K  +R  L  +    EQ++++   ++    +I+ +DFP+ W
Sbjct: 79  YWR----STRVNA-ISKDEKASIRSRLFDMI--DEQNNQLCIQNAQASARIARLDFPNEW 131

Query: 129 PNLL 132
           PNL 
Sbjct: 132 PNLF 135

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 52  LSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSS 111
           L  R   ++  K  I  +W         T+ ++++ K  +R  L +L    EQ++++   
Sbjct: 58  LQIRWMAVIQFKNGIEKFWRSS-----RTNAIKKDEKASIRARLFELI--DEQNNQLAIQ 110

Query: 112 SSYCIVQISAIDFPDLWPNLL 132
           +S    +I+ +DFP  WPNL 
Sbjct: 111 NSQAAAKIARLDFPVDWPNLF 131

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 619 YAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPVDSTLPVEISK 671
           YAEK  PLL KI+ D   TN D  P++      LM + K++  D    V I K
Sbjct: 172 YAEKAFPLLEKILLD--LTNCDNPPII------LMAYRKRRKADKRFFVRIRK 216

>Smik_7.22 Chr7 (44367..47249) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 59/149 (39%), Gaps = 6/149 (4%)

Query: 40  SLIELANNINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLC 99
           +L+ +  + N PLS+R    L  K  I   W        G   +     E ++  ++ L 
Sbjct: 39  TLLHVIASTNLPLSTRLAGALFFKNFIKRKWV----DENGNHLLPANNVELIKKEIVPLM 94

Query: 100 LNTEQDSKIKSSSSYCIVQISAIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVI 159
           ++   + +++   +  I  I+  DFPD WP LL  + + +  D  +    +L   +    
Sbjct: 95  ISLPNNLQVQIGEA--ISGIAESDFPDRWPTLLNDLASRLSNDDMVTNKGVLTVAHSIFR 152

Query: 160 SXXXXXXXXXXXXTIKTIFAIFTSPETNI 188
                         IK +  +FTSP  N+
Sbjct: 153 RWRPLFRSDELFLEIKLVLDVFTSPFLNL 181

>CAGL0M13871g Chr13 complement(1370295..1373570) [3276 bp, 1091 aa]
           {ON} highly similar to uniprot|P32337 Saccharomyces
           cerevisiae YMR308c PSE1 beta karyopherin
          Length = 1091

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 9/138 (6%)

Query: 7   LIAHAQSADNNVRENAESELLQK--CDENASVVFNSLIELANNINEPLSSRQFCILSLKK 64
           LI    SADNNVR  AE  L Q+    EN  V+   L E A ++++ L++     +  +K
Sbjct: 15  LIQGFASADNNVRSEAERTLNQEWITPENVEVLLIFLSEQA-SLSQDLTASALSAVLFRK 73

Query: 65  LITMYWSPGFDSYRGTSNVQEETKEFL---RDSLLKLCLNTEQDSKIKSSSSYCIVQISA 121
           L  +   P   +     N+   +   L   R +L+K  +  E+ S I+   S  I + + 
Sbjct: 74  L-ALRAPPSSKTVIIAKNITHISTNALLQIRATLIKGFM-AERPSSIRHKLSDAIAECAQ 131

Query: 122 IDFPDLWPNLLVVIYNAI 139
            D P+ WP LL  I  ++
Sbjct: 132 EDLPE-WPELLHTIVESL 148

>Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {ON}
           YPL125W (REAL)
          Length = 1032

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 47  NINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDS 106
           N++  L  R   ++  K  +  YW          + + ++ K  +R  L ++    EQ++
Sbjct: 54  NLSNSLQIRWLAVIQFKNGVDKYWRSS-----RVNAIPKDEKASIRGRLFEMI--DEQNN 106

Query: 107 KIKSSSSYCIVQISAIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYD 156
           ++   ++    +I+ +DFP  WPNL   + N +L D +I   S+  +IY+
Sbjct: 107 QLCIQNAQAAARIARLDFPVEWPNLFEDLEN-LLNDETIRKDSI--KIYN 153

>KLTH0C02728g Chr3 complement(246560..247204) [645 bp, 214 aa] {ON}
           similar to uniprot|P00572 Saccharomyces cerevisiae
           YJR057W CDC8 Thymidylate and uridylate kinase functions
           in de novo biosynthesis of pyrimidine
           deoxyribonucleotides converts dTMP to dTDP and dUMP to
           dUTP essential for mitotic and meiotic DNA replication
           homologous to S. pombe Tmp1p
          Length = 214

 Score = 33.1 bits (74), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 373 IRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNN 409
           +R+Q   FF+D E P YS A+  +LE   KS+E  ++
Sbjct: 156 VREQFSTFFNDFEDPDYSQAHIKVLETSGKSIEQVHD 192

>TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.624
           YPL125W
          Length = 1036

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 14/130 (10%)

Query: 14  ADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITMYWSPG 73
           A+ N +  AE +L  K  E A      L  +  +++ PL  R   ++  K  +  YW   
Sbjct: 26  ANPNAQRLAEQQL--KLWETALGFHYLLQSIYLDLSNPLQVRWLAVIQFKNGVERYW--- 80

Query: 74  FDSYRGT--SNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLWPNL 131
               R T  + + ++ K  +R+ L ++    EQ++++   ++    +I+ +DFP  W NL
Sbjct: 81  ----RSTRINAISKDEKASIRNRLFEVL--DEQNNQLCIQNAQATARIARLDFPSDWTNL 134

Query: 132 LVVIYNAILK 141
              I + ILK
Sbjct: 135 FETI-DYILK 143

>Suva_7.22 Chr7 (44148..47030) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 40  SLIELANNINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLC 99
           +L+ +  + N PLS+R    L  K  I   W        G   +  +  E ++  ++ L 
Sbjct: 39  TLLHVIASTNLPLSTRLAGALFFKNFIKRKWV----DENGNHLLPADNVELIKKEIVPLM 94

Query: 100 LNTEQDSKIKSSSSYCIVQISAIDFPDLWPNLL 132
           +    + +++   +  I  I+  DFPD WP LL
Sbjct: 95  ITLPNNLQVQIGEA--ISSIADSDFPDRWPTLL 125

>CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125w KAP120 nuclear transport factor
          Length = 1027

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 11/83 (13%)

Query: 52  LSSRQFCILSLKKLITMYWSPGFDSYRGT--SNVQEETKEFLRDSLLKLCLNTEQDSKIK 109
           L  R   ++  K  +  YW       R T  +++ ++ K  +R  L  +    EQ++++ 
Sbjct: 60  LHVRWLAVIQFKNGVEKYW-------RATRINSIGKDEKASIRKRLFDVV--DEQNNQLC 110

Query: 110 SSSSYCIVQISAIDFPDLWPNLL 132
             ++    +IS IDFP  WPNL 
Sbjct: 111 IQNAQATARISRIDFPVEWPNLF 133

>SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly
           similar to uniprot|P33307 Saccharomyces cerevisiae
           YGL238W CSE1 Nuclear envelope protein that mediates the
           nuclear export of importin alpha (Srp1p) homolog of
           metazoan CAS protein required for accurate chromosome
           segregation
          Length = 961

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 11  AQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLITMYW 70
           AQS   +  + AE  L  K  EN      +L+ +  + N P+S+R    L  K  I   W
Sbjct: 12  AQSVVASTAKVAEQNL--KSLENQESFPLTLLHIVASTNLPISTRLAGALFFKNFIKRKW 69

Query: 71  SPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLWPN 130
                   G   +     E L+  ++ L ++   + +++   +  ++  S  DFP  WP 
Sbjct: 70  V----DENGNHMISSNDVELLKKEIIPLMISLPNNLQLQIGEAISVIADS--DFPHKWPT 123

Query: 131 LL 132
           LL
Sbjct: 124 LL 125

>TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1031

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 47  NINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTS-NVQEETKEFLRDSLLKLCLNTEQD 105
           N++  L  R   I+  K  I  YW     S R  + N  E+ K  +R+ L  L    E++
Sbjct: 53  NMDNSLQIRWISIIQFKNGIEKYWR----STRSNAINKNEKLK--IRERLFNLV--NEKN 104

Query: 106 SKIKSSSSYCIVQISAIDFPDLWPNLL 132
           +++   ++    +I+  DFP  WP+L 
Sbjct: 105 NQLSIQNAQATAKIARFDFPGHWPDLF 131

>KLTH0D10010g Chr4 complement(830376..833480) [3105 bp, 1034 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1034

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 11/88 (12%)

Query: 47  NINEPLSSRQFCILSLKKLITMYWSPGFDSYRGT--SNVQEETKEFLRDSLLKLCLNTEQ 104
           N++ PL  R   I+  K  +  YW       R T  + + ++ K  +R  L  L    E 
Sbjct: 57  NLSCPLDVRWLAIIQFKNGVEKYW-------RSTRINAIGKDEKASIRARLFDLI--DEN 107

Query: 105 DSKIKSSSSYCIVQISAIDFPDLWPNLL 132
           ++++   +S    +I+ +DFP  WP L 
Sbjct: 108 NNQLGIQNSQAAARIARLDFPGDWPTLF 135

>YGL238W Chr7 (49552..52434) [2883 bp, 960 aa] {ON}  CSE1Nuclear
           envelope protein that mediates the nuclear export of
           importin alpha (Srp1p), homolog of metazoan CAS protein,
           required for accurate chromosome segregation
          Length = 960

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 58/149 (38%), Gaps = 6/149 (4%)

Query: 40  SLIELANNINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLC 99
           +L+ +  + N PLS+R    L  K  I   W        G   +     E ++  ++ L 
Sbjct: 39  TLLHVIASTNLPLSTRLAGALFFKNFIKRKWV----DENGNHLLPANNVELIKKEIVPLM 94

Query: 100 LNTEQDSKIKSSSSYCIVQISAIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVI 159
           ++   + +++      I  I+  DFPD WP LL  + + +  D  +    +L   +    
Sbjct: 95  ISLPNNLQVQIGE--AISSIADSDFPDRWPTLLSDLASRLSNDDMVTNKGVLTVAHSIFK 152

Query: 160 SXXXXXXXXXXXXTIKTIFAIFTSPETNI 188
                         IK +  +FT+P  N+
Sbjct: 153 RWRPLFRSDELFLEIKLVLDVFTAPFLNL 181

>KNAG0I00260 Chr9 (32967..35831) [2865 bp, 954 aa] {ON} Anc_3.561
           YGL238W
          Length = 954

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 40  SLIELANNINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLC 99
           +L+ +  + N P+S+R    L  K  I   W        G   + E + E ++  ++ L 
Sbjct: 39  TLLHVVASTNLPISTRLAGALFFKNFIRRKWV----DENGNHLLSENSIELIKKEIVPLM 94

Query: 100 LNTEQDSKIKSSSSYCIVQISAIDFPDLWPNLL 132
           ++   +  ++S     I  I+  DFP  WP LL
Sbjct: 95  ISLPNN--LQSQIGEAISLIADSDFPGRWPGLL 125

>KLTH0H06182g Chr8 complement(542052..543392,543465..543836) [1713
           bp, 570 aa] {ON} similar to uniprot|P27697 Saccharomyces
           cerevisiae YGL119W ABC1 Protein required for ubiquinone
           (coenzyme Q) biosynthesis, which in turn is required for
           respiratory growth; has similarity to prokaryotic
           proteins involved in early steps of ubiquinone
           biosynthesis
          Length = 570

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 21  NAESELLQKCD-ENASVVFNSLIELANNINEPLSSRQFCILSLKKLITMYWSPGFDSYRG 79
           NA +EL  +CD +  +       +L  N  + ++ R +  L+   +ITM    G +  + 
Sbjct: 323 NARTELRWECDYKREAAALQKFEQLLKNEPDLVTPRVYEDLTTDSIITMSKMHGKEIMKL 382

Query: 80  TSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPDLWPNLLVVIYNA 138
              V +ET+ F+ +++++LCL                 +I+   F    PN    +YN 
Sbjct: 383 PLTVSQETRNFISETIMRLCLR----------------EIAEFQFMQTDPNWANFLYNG 425

>Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {ON}
           similar to Ashbya gossypii AFR273W
          Length = 955

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 10/127 (7%)

Query: 8   IAH--AQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKL 65
           I+H  AQS       ++E  L  K  EN       L+ +  + N P S+R    L  K  
Sbjct: 7   ISHYLAQSVVAATARSSEHSL--KALENQDGFALMLLHIVASTNLPASTRLAGALFFKNF 64

Query: 66  ITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFP 125
           I   W     +  G   + E   E ++  +L L +    + + +   S  I+  S  DFP
Sbjct: 65  IKRKWV----NENGDHILSENDVELVKKEILPLMIKLPGNLQAQVGESISIIADS--DFP 118

Query: 126 DLWPNLL 132
           D W NLL
Sbjct: 119 DKWTNLL 125

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 47  NINEPLSSRQFCILSLKKLITMYWSPGFDSYRGT--SNVQEETKEFLRDSLLKLCLNTEQ 104
           N++  L  R   ++  K  +  YW       R T  + + ++ K  +R  L ++    EQ
Sbjct: 54  NLSNSLQIRWLAVIQFKNGVDKYW-------RSTRINAISKDEKASIRGRLFEMI--DEQ 104

Query: 105 DSKIKSSSSYCIVQISAIDFPDLWPNLL 132
           ++++   ++    +I+ +DFP  WPNL 
Sbjct: 105 NNQLCIQNAQAAARIARLDFPVEWPNLF 132

>Skud_7.28 Chr7 (53753..56635) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 6/93 (6%)

Query: 40  SLIELANNINEPLSSRQFCILSLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLC 99
           +L+ +  + N PLS+R    L  K  I   W        G   +     E ++  ++ L 
Sbjct: 39  TLLHVIASTNLPLSTRLAGALFFKNFIKRKWV----DENGNHLLPANNVELIKKEIVPLM 94

Query: 100 LNTEQDSKIKSSSSYCIVQISAIDFPDLWPNLL 132
           +    + +++   +  I  I+  DFPD WP LL
Sbjct: 95  ITLPNNLQVQIGEA--ISSIADSDFPDRWPTLL 125

>TBLA0C07090 Chr3 complement(1716766..1720209) [3444 bp, 1147 aa]
           {ON} Anc_5.11 YMR308C
          Length = 1147

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 66/138 (47%), Gaps = 11/138 (7%)

Query: 13  SADNNVRENAESELLQK--CDENASVVFNSLIE-LANNINEPLSSRQFCILSLKKLITMY 69
           S DNN+R +AE++L       EN  ++   L E  A + +E LS+    +    + + + 
Sbjct: 21  SPDNNIRSDAENQLNNNWITKENIHILLIFLSEQAAYSTDETLSALSAVLF---RKLALR 77

Query: 70  WSPGFDSYRGTSNVQEETKEFL---RDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPD 126
             P   +   + N+ E  ++ L   R +LLK  ++  + + ++   S  I + S  D P+
Sbjct: 78  APPDSKTILISKNITELPQDILAQIRSTLLKGFIDYNKPNNLRHKLSDAIAECSQPDLPN 137

Query: 127 LWPNLLVVIYNAILKDHS 144
            WP LL  +  A LKD +
Sbjct: 138 -WPELLQTLLQA-LKDEN 153

>Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]
           {ON} YGL238W (CSE1) - (putative) kinetochore protein
           [contig 344] FULL
          Length = 959

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 61/137 (44%), Gaps = 10/137 (7%)

Query: 8   IAH--AQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKL 65
           IAH  +QS + +  +NAE+ L  K  E       +L+ +  + N P+++R    L  K  
Sbjct: 7   IAHFLSQSIEASNSKNAEAHL--KSLETQPGFAVTLMHVIASSNLPVATRLAGALFFKNF 64

Query: 66  ITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFP 125
           I   W     +  G   + E     ++  ++ L +    + +++   +  ++  S  DFP
Sbjct: 65  IKRKWI----NENGVYMIAESDVAAVKREIVPLMIALPSNLQVQIGEAISVIADS--DFP 118

Query: 126 DLWPNLLVVIYNAILKD 142
             WP+LL ++   +  D
Sbjct: 119 HRWPDLLDILIGKLSTD 135

>ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL125W
           (KAP120)
          Length = 1025

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 58  CILSLKKLITMYWSPGFDSYRGTSNVQ---EETKEFLRDSLLKLCLNTEQDSKIKSSSSY 114
           C L ++ L  + +  G D Y   + V    ++ K+ +R  L ++    EQ++++   +++
Sbjct: 57  CSLQIRWLAIIQFKNGLDKYWRATRVNAISKDEKQSIRARLFEMV--DEQNNQLCIQNAH 114

Query: 115 CIVQISAIDFPDLWPNLL 132
              +I+  D+P  WP+L 
Sbjct: 115 ACARIARSDYPHDWPDLF 132

>Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 32.3 bits (72), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 47  NINEPLSSRQFCILSLKKLITMYWSPGFDSYRGT--SNVQEETKEFLRDSLLKLCLNTEQ 104
           N++  L  R   ++  K  +  YW       R T  + + ++ K  +R  L ++    EQ
Sbjct: 54  NLSNSLQIRWLAVIQFKNGVDKYW-------RSTRINAIPKDEKASIRGRLFEMI--DEQ 104

Query: 105 DSKIKSSSSYCIVQISAIDFPDLWPNLL 132
           ++++   ++    +I+ +DFP  WPNL 
Sbjct: 105 NNQLCIQNAQAAARIARLDFPVDWPNLF 132

>Kpol_534.37 s534 complement(93615..94979,95183..95488) [1671 bp,
           556 aa] {ON} complement(93615..94979,95183..95488) [1671
           nt, 557 aa]
          Length = 556

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 11/87 (12%)

Query: 20  ENAESELLQKCD----ENASVVFNSLIELANNINEPL--SSRQFCILSLKKLITMYWSPG 73
           ENA  EL  +CD     NA   F  LI+     ++P+    + +  L+ + ++TM    G
Sbjct: 309 ENARRELKWECDYIREANAMKKFGELIK-----DDPVFEVPKVYDELTTESVLTMQRMEG 363

Query: 74  FDSYRGTSNVQEETKEFLRDSLLKLCL 100
            +  +  S + +E + FL D++++LCL
Sbjct: 364 TEIMKLPSTINQELRNFLGDNVMRLCL 390

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,619,952
Number of extensions: 4297911
Number of successful extensions: 20453
Number of sequences better than 10.0: 118
Number of HSP's gapped: 20922
Number of HSP's successfully gapped: 119
Length of query: 1022
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 902
Effective length of database: 39,721,479
Effective search space: 35828774058
Effective search space used: 35828774058
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)