Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0G035202.534ON2042049221e-128
SAKL0A09504g2.534ON1671686644e-89
NCAS0F008902.534ON1671686507e-87
YMR071C (TVP18)2.534ON1671686463e-86
Skud_13.2272.534ON1671686437e-86
Suva_13.2482.534ON1671686385e-85
KLTH0D06864g2.534ON1671686282e-83
KNAG0C058002.534ON1671686272e-83
TDEL0A030802.534ON1671686263e-83
CAGL0K03025g2.534ON1671686151e-81
TBLA0G022402.534ON1671686142e-81
NDAI0H013902.534ON1671686046e-80
KAFR0A018702.534ON1671686003e-79
Smik_13.2502.534ON1671685916e-78
Kpol_348.92.534ON1301305322e-69
AGL072W2.534ON1671685135e-66
Ecym_72542.534ON1671684805e-61
ZYRO0B02024g2.534ON1661584667e-59
KLLA0E18525g2.534ON1711654441e-55
Kwal_26.80252.534ON64652041e-20
KNAG0J009903.242ON29065638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0G03520
         (204 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   359   e-128
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   260   4e-89
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   254   7e-87
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   253   3e-86
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   252   7e-86
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   250   5e-85
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   246   2e-83
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   246   2e-83
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   245   3e-83
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   241   1e-81
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   241   2e-81
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   237   6e-80
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   235   3e-79
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   232   6e-78
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   209   2e-69
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   202   5e-66
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   189   5e-61
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   184   7e-59
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   175   1e-55
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...    83   1e-20
KNAG0J00990 Chr10 complement(173785..174657) [873 bp, 290 aa] {O...    29   8.6  

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  359 bits (922), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 180/204 (88%)

Query: 1   MAICTCVRVPLKLHPVLSRTQYLSXXXXXXXXXXXXMALSIKQFINGAGMLKDLKSFNFS 60
           MAICTCVRVPLKLHPVLSRTQYLS            MALSIKQFINGAGMLKDLKSFNFS
Sbjct: 1   MAICTCVRVPLKLHPVLSRTQYLSLHTPLPPHTHLLMALSIKQFINGAGMLKDLKSFNFS 60

Query: 61  VYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSLVILFIEIPFLLKICPLSDNF 120
           VYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSLVILFIEIPFLLKICPLSDNF
Sbjct: 61  VYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSLVILFIEIPFLLKICPLSDNF 120

Query: 121 VNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLIVVAIGLXXXXXXXXXXXXKKQEFQ 180
           VNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLIVVAIGL            KKQEFQ
Sbjct: 121 VNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLIVVAIGLSISAAFYAIAFFKKQEFQ 180

Query: 181 HTSNVIKNPTDDDFPHEAVVREML 204
           HTSNVIKNPTDDDFPHEAVVREML
Sbjct: 181 HTSNVIKNPTDDDFPHEAVVREML 204

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  260 bits (664), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 144/168 (85%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MAL IKQFIN AG++KDLKSFNFSVYGQ+FGYINIILC+ALGIANLFHVNAV+AFG+++I
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +QSLVILFIE+PFLLKICPLSDNF+ F+K FETNG R LF+T MAI+QWCSL L  TSLI
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVAIGL            K Q+FQ+T N+IKNPTD+DFPHEAVVREML
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNT-NIIKNPTDEDFPHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  254 bits (650), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 124/168 (73%), Positives = 142/168 (84%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MAL IKQFIN AGM KDLKSFNFSVYG++FGYINIILC+ALG+ANLFHVNAVIAFGI++I
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q LVILFIEIPFLLKICPLS+NF+ F+K FETNG+RCLF+ GMAI+Q+CS+IL  TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVAIGL              QEFQ+T N+IKNP D DFPHEAVVREM+
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNT-NIIKNPADADFPHEAVVREMV 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  253 bits (646), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 122/168 (72%), Positives = 141/168 (83%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALS+ QFIN  GM+KDLKSFNFSVYG++FGYINIILC+ALGIANLFHV+ VIAFGI++I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q LVILFIEIPFLLKICPLSDNF+ F+K FETNGWRCLF+  MAI+Q+ S+ +  TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVA+GL            K QEFQ+T N+IKNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNT-NIIKNPTDDDFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  252 bits (643), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 141/168 (83%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALS+ QFIN  GM+KDLKSFNFSVYG++FGYINIILC+ALGIANLFHV+ VIAFGI++I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q LVILFIEIPFLLKICPLSDNFV F+K FETNGWRC+F+  MA++Q+ S+ +  TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVA+GL            K QEFQ+T N+IKNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNT-NIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  250 bits (638), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALS+ QFIN  GM+KDLKSFNFSVYG++FGYINIILC+ALGIANLFHV+ VIAFGI++I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q LVILFIEIPFLLKICPLSDNFV F+K FETNGWRC+F+  MA +Q+ S+ +  TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVA+GL            K QEFQ+T N++KNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNT-NILKNPTDDDFPHEAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  246 bits (628), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 138/168 (82%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MAL+IKQFIN AG+++DLKSFNFSVYGQ+FGYINI LC+ALGIANLFHV+AVI FGI+AI
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           VQ LVILF+E+PFLL+ICPLSDNF+ F+K FETNG R LF+ GMA VQWCSL +  TSLI
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
            VAIGL            K Q+FQ TS VIK+P DDDFPHEAVVREML
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTS-VIKSPADDDFPHEAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  246 bits (627), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALSIKQF N AGMLKDL+SFNFSVYG++FG+INIILC+ALGIANLFHV+ VIAFGIV+I
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           VQ L+ILFIEIPFLLKICPLSDNF+ F+  FETNG+R +F+  MA++Q+CS+IL VTSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVAI L            K QEFQ+T N+IKNP D DFPHEAVVREML
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNT-NIIKNPADADFPHEAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  245 bits (626), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 142/168 (84%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MAL ++QFIN AG++KDLKSFNFS+YG++FGYINI LC+ALGIANLFHV+AVIAFGIVAI
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           VQ L+ILF+EIPFLLKICPLSDNF+ F+K FETNG+R LF+  MA++QWCS+ ++ TSLI
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVA+GL            K QEFQ+T +++K+PT DDFPHEAVVREML
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNT-HILKDPTSDDFPHEAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  241 bits (615), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 119/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MAL I QFIN AG+LKDLKSFNFSVYG++FGYINI LC+ALGIANLFHV+AVIAFGIV I
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           VQ L+ILFIEIPFLLKICPLSD F+ F+K FETNG+RC+F+T MAIVQ+CSL +  TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           V+ I L            K QEF +T N+IKNPTD+DFPH+AVVREML
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANT-NIIKNPTDEDFPHDAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  241 bits (614), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 141/168 (83%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           M +++++F+N  G+++ LKSFNFS+YGQ+FGYINI+LC+ALGIANLFHVN VIAFGIV+I
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +QS +ILF+E+PFLLKICPLSDNF+ F+K+F+TNG+RC+F+  MA VQWCS+ILK TSLI
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVAIGL            K QEFQ+ S +IKNPTDDDFP EAVVREML
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVS-IIKNPTDDDFPREAVVREML 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  237 bits (604), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 137/168 (81%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MAL I QFIN AG++KDLKSFNFSVYG++FGYINIILC+ LGI+NLFHVNAVIAFGIV+I
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q LVILFIEIPFLLKICPLS+ F+ F+K FETNG+RC+F+  MAI+Q+CS+ L  TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVA+GL              QEFQ+T  ++KNPTD DFP EAVVREML
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNT-QILKNPTDPDFPREAVVREML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  235 bits (600), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALSIKQFIN AG++KDLKSFNFSVYG++FGYINIILC+ALGI+NLFHVNAVIAFGI++I
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q L+ILFIEIPFLLKICPLSDNFV F+K FETNG+RC+F+  MAI+Q+CS+IL  TSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVAI L            KKQEFQ+T N+IKNPTD DFPHEAVVREML
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNT-NIIKNPTDTDFPHEAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  232 bits (591), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (83%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALS+ QFIN  GM+KDLKSFNFSVYG++FGYINIILC+ALGIANLFHV+ VIAFGI++I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           +Q L+ILFIEIPFLLKICPLSDNF+ F+K FETNGWRC+F+  MAI+Q+ S+ +  TSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           VVA+GL            K QEFQ+T N+IKNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNT-NIIKNPTDDDFPHEAVVREML 167

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  209 bits (532), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 101/130 (77%), Positives = 112/130 (86%)

Query: 75  MALGIANLFHVNAVIAFGIVAIVQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRC 134
           MALGIANLFHVNAVIAFGIVAIVQSL+ILF+E+PFLLKICPLS+NF+NF+K FETNG+RC
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 135 LFFTGMAIVQWCSLILKVTSLIVVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDF 194
           +F+T MAIVQWCSL L VTSLIVVAI L            K QEFQHT+NVIKNPTDDDF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 195 PHEAVVREML 204
           PH+AVVREML
Sbjct: 121 PHDAVVREML 130

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  202 bits (513), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 102/168 (60%), Positives = 126/168 (75%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MALS K F+N  G+L DL+SFNFSVYG++FGYINI+LC+ALGIAN+FH + VIAF IVAI
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
           VQ L+++F+E+P LLKICPLSDNF+  VK  +TNG R L +T +AIVQ+ SL ++VTSL+
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
            VAIGL            KKQEF    NVI+NPTD  F  EA VRE+L
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLE-GNVIRNPTDPAFMREAAVREVL 167

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  189 bits (480), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 94/168 (55%), Positives = 122/168 (72%), Gaps = 1/168 (0%)

Query: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96
           MA+S+K FIN  G++ DLKSFNFSVYG++FGYINIILC+ALGIAN+FH   VI F I+A+
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156
            Q   +LF+E+PFL+KICPLS+ FV+ VK F +N  R + +  MA++QW SL+ +VTSL+
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 157 VVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204
           V+AI L             KQEF+  SNV++ P  D FPHEA VREML
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKE-SNVLRGPGSDTFPHEASVREML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  184 bits (466), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 2/158 (1%)

Query: 48  AGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSLVILFIEI 107
             +++ LKS+NFS+YG+Y  Y+NII C+A GIANLFHVNAVIAFG+++IVQ  +ILF+E+
Sbjct: 10  GSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQGAIILFLEV 69

Query: 108 PFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLIVVAIGLXXXXX 167
           PFLL+ICPLSDNF+ FV  FETNGWR +F+   A++QW SL LK+TSLIVVA+GL     
Sbjct: 70  PFLLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVVAVGLTISAA 129

Query: 168 XXXXXXXKKQEFQHTSNVIKNPTDDDF-PHEAVVREML 204
                  K Q FQ++S+ IK P  +    +E  VREML
Sbjct: 130 FYGVAYFKHQNFQNSSH-IKEPVGEGVEANEQNVREML 166

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  175 bits (444), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 87/165 (52%), Positives = 115/165 (69%), Gaps = 1/165 (0%)

Query: 41  IKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSL 100
           +K   N +GM+ DLKS NFS+YGQ+  Y+NII C+A GIAN+FH +AVI F I+AIVQ L
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 101 VILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLIVVAI 160
           +ILFIE+PFLLKICPLSDNF+ FV  F+TN  R LF+  M  +QWCS+I++ TSLIVVA+
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 161 GLXXXXXXXXXXXXKKQEFQHTSNVI-KNPTDDDFPHEAVVREML 204
           GL              QEF++++ +  +        +EAVVR+ML
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score = 83.2 bits (204), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 42/65 (64%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 140 MAIVQWCSLILKVTSLIVVAIGLXXXXXXXXXXXXKKQEFQHTSNVIKNPTDDDFPHEAV 199
           MA VQWCS+ L VTSLIVVA+GL            K Q+FQ TS VIKNP D+DFPHEAV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTS-VIKNPADEDFPHEAV 59

Query: 200 VREML 204
           VREML
Sbjct: 60  VREML 64

>KNAG0J00990 Chr10 complement(173785..174657) [873 bp, 290 aa] {ON}
           Anc_3.242 YBR040W
          Length = 290

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 60  SVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSLVILFIEIPFLLKICPLSDN 119
           S  G     +NI+    L   N+ H   ++A  I++I+Q L ++++ IP +    PL D 
Sbjct: 130 SAAGSTPSTLNILKLAELTSVNVIHPYILMATVILSIIQILTLVYLAIPHI----PLKDV 185

Query: 120 FVNFV 124
            V FV
Sbjct: 186 IVKFV 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.144    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,945,394
Number of extensions: 601702
Number of successful extensions: 1791
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1811
Number of HSP's successfully gapped: 25
Length of query: 204
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 100
Effective length of database: 41,556,135
Effective search space: 4155613500
Effective search space used: 4155613500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 63 (28.9 bits)