Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0G035102.533ON38738715420.0
SAKL0A09482g2.533ON3881382938e-29
TDEL0A030702.533ON2391332779e-28
KNAG0C058102.533ON5541422891e-27
NDAI0H014002.533ON5411392872e-27
TBLA0G022302.533ON2161392705e-27
Kpol_1018.332.533ON5891292847e-27
Kwal_26.80212.533ON5071312827e-27
KLTH0D06842g2.533ON5061412792e-26
NDAI0K018602.533ON7301412803e-26
Ecym_72552.533ON5441342766e-26
ZYRO0B02002g2.533ON2941282624e-25
KAFR0A018602.533ON4901302678e-25
NCAS0A048002.533ON5111352661e-24
NCAS0F009002.533ON5251342652e-24
AGL071C2.533ON3961332584e-24
Smik_13.2492.533ON4731342605e-24
YMR070W (MOT3)2.533ON490672597e-24
Suva_13.2462.533ON419652587e-24
TBLA0I014802.533ON513682581e-23
Skud_13.2262.533ON475652571e-23
KLLA0E18547g2.533ON4311472517e-23
CAGL0K03003g2.533ON647602511e-22
KAFR0J003402.533ON218612205e-20
TPHA0C041902.533ON417601932e-15
KNAG0A070402.533ON352521735e-13
NCAS0A129102.598ON822551614e-11
TBLA0H028302.598ON746551533e-10
ZYRO0F01012g2.598ON584541392e-08
CAGL0L06072g8.144ON300591362e-08
ABR089C2.598ON571541382e-08
KNAG0H005502.598ON620541382e-08
KLLA0F26961g2.598ON694611373e-08
KAFR0A023202.598ON443621363e-08
Kpol_185.32.598ON647541373e-08
NCAS0H030802.598ON730541373e-08
Ecym_23012.598ON767611374e-08
CAGL0F05995g2.598ON597541364e-08
SAKL0B11330g2.598ON499541354e-08
TPHA0C025802.598ON365501336e-08
TPHA0N014602.598ON519541346e-08
TDEL0B069102.598ON437541346e-08
NDAI0C005602.598ON972621357e-08
YKL062W (MSN4)2.598ON630541347e-08
Smik_11.1862.598ON641541347e-08
Kwal_26.83512.598ON698541348e-08
Suva_13.2062.598ON709541348e-08
Skud_11.1672.598ON628541321e-07
Skud_13.1932.598ON704541331e-07
YMR037C (MSN2)2.598ON704541321e-07
Smik_13.2072.598ON703541321e-07
Kpol_1013.212.598ON494541312e-07
NDAI0B013402.598ON769651312e-07
KLTH0D08734g2.598ON677541312e-07
Suva_11.1642.598ON639541312e-07
TBLA0G019202.598ON523551302e-07
CAGL0M13189g2.598ON541551292e-07
KAFR0F020702.598ON370541283e-07
Kpol_1052.83.298ON386551265e-07
KNAG0M023102.598ON660501266e-07
KNAG0G012808.144ON472501266e-07
Kwal_26.80112.531ON190561172e-06
TBLA0G032403.298ON511701222e-06
Kpol_1065.483.298ON364521203e-06
NCAS0B028408.425ON1152531213e-06
NDAI0C06260na 1ON582611213e-06
Kwal_47.172418.144ON403581203e-06
NCAS0I014603.298ON330581184e-06
SAKL0H24816g8.144ON410501194e-06
KLLA0C17072g8.144ON474501194e-06
KLLA0F20636gsingletonON285501174e-06
CAGL0K12078g3.281ON463621195e-06
TPHA0A039103.298ON351641175e-06
Kwal_47.190453.518ON266511157e-06
ADR308Cna 2ON278501158e-06
NCAS0B046008.144ON547501178e-06
Kpol_541.398.116ON291571158e-06
KLTH0E06688g8.144ON397501168e-06
ACL057W8.144ON520501179e-06
CAGL0L05786g8.116ON348561169e-06
TPHA0D010508.144ON439501169e-06
Kpol_1072.582.162ON794551171e-05
Kpol_1031.428.144ON359511151e-05
KNAG0G011408.117ON519691161e-05
TDEL0A013008.234ON837661161e-05
NCAS0C042308.117ON338691151e-05
Suva_16.766.256ON392641151e-05
TBLA0F038308.234ON967661161e-05
KNAG0J022503.296ON296611141e-05
Ecym_84038.144ON573501151e-05
KAFR0C031408.117ON370551141e-05
CAGL0K02145g8.144ON317501131e-05
TPHA0C021608.425ON1375681161e-05
NDAI0C048608.425ON1350611152e-05
Ecym_8379na 3ON305561132e-05
Kpol_1032.528.234ON824661152e-05
KLTH0G01826g3.518ON307511132e-05
ZYRO0B11770g8.234ON867661142e-05
ZYRO0G19140g8.144ON557501132e-05
ACR264W2.162ON769531132e-05
Ecym_54242.162ON775481132e-05
SAKL0E10714g2.162ON819531133e-05
TBLA0F003708.144ON687511133e-05
Kpol_529.138.425ON1410481133e-05
Suva_2.2558.234ON894761133e-05
NDAI0B019408.116ON336581113e-05
NDAI0B042902.162ON1064531123e-05
KAFR0B063608.425ON627631123e-05
KAFR0H032402.303ON519931124e-05
TBLA0E039308.116ON462631114e-05
ADL042Wna 3ON281541104e-05
NCAS0B048408.234ON8641021124e-05
CAGL0J01595g8.117ON344501104e-05
KAFR0F041503.518ON416561114e-05
TBLA0B012802.162ON823541114e-05
KAFR0B025508.234ON890661115e-05
Kpol_495.20singletonON486621105e-05
CAGL0M00594g4.351ON1020621115e-05
Suva_8.1662.162ON948661115e-05
NCAS0C040708.144ON289631095e-05
NDAI0G034208.144ON484501105e-05
CAGL0M01870g3.298ON315551096e-05
NCAS0G037302.303ON571701106e-05
KNAG0G018708.234ON875661106e-05
ZYRO0A09416g8.425ON1346531106e-05
KAFR0C003403.298ON394591096e-05
NDAI0B02080singletonON273501086e-05
Ecym_4128na 4ON312551087e-05
NDAI0B019308.144ON436501097e-05
TPHA0A019408.234ON912661107e-05
KLLA0F23782g2.162ON782521097e-05
KNAG0D021208.144ON402501087e-05
TDEL0B046708.144ON312501087e-05
KAFR0C029808.144ON225501068e-05
NCAS0A023104.214ON879581098e-05
Smik_4.3378.234ON894761098e-05
Ecym_8011na 2ON276501078e-05
YOR113W (AZF1)2.162ON914481098e-05
YDR096W (GIS1)8.234ON894761099e-05
KNAG0I020702.162ON572481089e-05
Skud_4.3548.234ON916761099e-05
Skud_15.2762.162ON917481099e-05
TPHA0B003804.351ON1310471099e-05
Smik_15.2912.162ON909481099e-05
TDEL0F011708.116ON162501039e-05
NCAS0F00910singletonON350581079e-05
KLLA0F13046g8.425ON1379531099e-05
SAKL0H20416g8.116ON317501071e-04
Kpol_1001.14.351ON1341621091e-04
TDEL0F055008.425ON1207531091e-04
Smik_6.4356.256ON386581071e-04
KLLA0F11682g3.298ON374521071e-04
YDR216W (ADR1)8.425ON1323521081e-04
YPR013C8.116ON317501061e-04
Ecym_26733.298ON301681061e-04
SAKL0F01980g3.518ON385571071e-04
Suva_2.3838.425ON1319521081e-04
Smik_5.2768.144ON442501071e-04
Suva_5.2518.144ON449501071e-04
NDAI0B022508.234ON1156631081e-04
Ecym_8387na 5ON179621031e-04
AER159C4.351ON1191611081e-04
Skud_16.486.256ON398551071e-04
Smik_4.4638.425ON1324521081e-04
Skud_5.2488.144ON442501061e-04
KAFR0B019908.116ON410601061e-04
YPL230W (USV1)6.256ON391581061e-04
NDAI0A075403.298ON370551061e-04
YER130C8.144ON443501062e-04
NCAS0B046708.116ON266601042e-04
Suva_7.523.518ON400511062e-04
Smik_16.2538.116ON317501052e-04
KNAG0D022908.116ON435501052e-04
ZYRO0E02684g8.116ON13350992e-04
TPHA0D034003.518ON338521052e-04
NCAS0B05750singletonON505511062e-04
YGL209W (MIG2)3.518ON382511052e-04
KLTH0H08800g8.117ON168561012e-04
Skud_14.3012.303ON682701062e-04
Smik_14.3032.303ON673701062e-04
Suva_14.3182.303ON681701062e-04
Kpol_1018.352.531ON517571062e-04
NDAI0I029003.518ON524561062e-04
Skud_4.4788.425ON1323521062e-04
TPHA0G002707.543ON472321052e-04
KAFR0B020008.117ON303551042e-04
KNAG0H034802.162ON796541062e-04
Kwal_47.178882.162ON786531062e-04
Suva_16.3358.116ON317501042e-04
Kwal_23.54007.543ON429471052e-04
ZYRO0E08426g3.518ON171561012e-04
SAKL0H12958g8.425ON1129481062e-04
NDAI0D032404.351ON1362611062e-04
YNL027W (CRZ1)2.303ON678701052e-04
Suva_13.704.351ON777591052e-04
CAGL0E04884g8.425ON1489531062e-04
SAKL0A09438g2.531ON441551052e-04
CAGL0L11880g8.234ON980661052e-04
KNAG0D022808.117ON435551042e-04
Kpol_472.104.214ON830601052e-04
Skud_16.2988.116ON317501042e-04
TPHA0B029102.162ON717551052e-04
KNAG0A044608.425ON1290521052e-04
KLTH0E09724g2.162ON768531052e-04
KLTH0G14454g8.234ON832611053e-04
KAFR0H012903.298ON330551043e-04
KLTH0E09922g8.425ON1119531053e-04
Smik_7.543.518ON382511043e-04
KLLA0C17710g8.234ON821501053e-04
KNAG0M003504.351ON1076601053e-04
KLLA0B04477g4.351ON1332611053e-04
TBLA0H006608.425ON1311591053e-04
NCAS0E006103.518ON401561033e-04
KAFR0B021608.144ON453501043e-04
SAKL0G18062g4.351ON1238621053e-04
ADL198W2.303ON547541043e-04
Skud_7.593.518ON383511033e-04
KAFR0B068104.351ON1155561043e-04
NCAS0B069602.162ON839541043e-04
Kwal_14.22068.117ON254531013e-04
Kwal_56.234538.234ON828611043e-04
SAKL0H20394g8.117ON359641024e-04
NCAS0F009202.531ON354581024e-04
CAGL0A01628g4.80ON424501024e-04
SAKL0E07216g2.303ON548691034e-04
YER169W (RPH1)8.234ON796631034e-04
KLLA0B03454g7.543ON472341024e-04
TDEL0B052502.162ON714481035e-04
SAKL0A10582gsingletonON288551015e-04
Ecym_33412.303ON560691025e-04
Suva_5.3038.234ON797631035e-04
Skud_5.3088.234ON802631035e-04
Smik_5.3418.234ON798631035e-04
SAKL0H17842g8.234ON814531035e-04
Smik_13.584.351ON1253591035e-04
AGL207W3.298ON277521005e-04
ZYRO0B16148g2.162ON930481035e-04
YML081W (TDA9)4.351ON1251591035e-04
Kwal_47.166214.351ON1178521035e-04
ZYRO0B14894g4.351ON1119621025e-04
Suva_16.5187.543ON427341016e-04
Skud_13.614.351ON1253591026e-04
TPHA0A04530singletonON501631016e-04
NDAI0D042404.214ON1169561026e-04
KNAG0D037104.80ON459501016e-04
KLTH0D18062g4.351ON1128521026e-04
Kwal_27.114602.303ON531661016e-04
KNAG0B005903.518ON439511016e-04
KAFR0B045802.162ON729541017e-04
CAGL0M06831g2.303ON645531017e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0G03510
         (387 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   598   0.0  
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   117   8e-29
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   111   9e-28
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   115   1e-27
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   115   2e-27
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   108   5e-27
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   114   7e-27
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   113   7e-27
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   112   2e-26
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   112   3e-26
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   110   6e-26
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   105   4e-25
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   107   8e-25
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   107   1e-24
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   106   2e-24
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   103   4e-24
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   104   5e-24
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   104   7e-24
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   103   7e-24
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   103   1e-23
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   103   1e-23
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   101   7e-23
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   101   1e-22
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       89   5e-20
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    79   2e-15
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    71   5e-13
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    67   4e-11
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    64   3e-10
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    58   2e-08
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    57   2e-08
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    58   2e-08
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    58   2e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    57   3e-08
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    57   3e-08
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    57   3e-08
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    57   3e-08
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    57   4e-08
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    57   4e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    57   4e-08
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    56   6e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    56   6e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    56   6e-08
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     57   7e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    56   7e-08
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    56   7e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    56   8e-08
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    56   8e-08
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    55   1e-07
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    56   1e-07
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    55   1e-07
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    55   1e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    55   2e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     55   2e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    55   2e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    55   2e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    55   2e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    54   2e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    54   3e-07
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    53   5e-07
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    53   6e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    53   6e-07
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    50   2e-06
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     52   2e-06
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    51   3e-06
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    51   3e-06
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             51   3e-06
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    51   3e-06
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    50   4e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    50   4e-06
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    50   4e-06
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    50   4e-06
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    50   5e-06
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    50   5e-06
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    49   7e-06
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    49   8e-06
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    50   8e-06
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    49   8e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    49   8e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    50   9e-06
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    49   9e-06
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    49   9e-06
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    50   1e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    49   1e-05
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    49   1e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    49   1e-05
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               49   1e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    49   1e-05
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    49   1e-05
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               49   1e-05
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    49   1e-05
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               49   1e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    48   1e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    49   1e-05
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    49   2e-05
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    48   2e-05
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    49   2e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    48   2e-05
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    49   2e-05
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    48   2e-05
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    48   2e-05
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    48   2e-05
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    48   3e-05
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    48   3e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    48   3e-05
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    48   3e-05
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    47   3e-05
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    48   3e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    48   3e-05
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    48   4e-05
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    47   4e-05
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    47   4e-05
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     48   4e-05
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    47   4e-05
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    47   4e-05
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    47   4e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    47   5e-05
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    47   5e-05
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    47   5e-05
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    47   5e-05
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      47   5e-05
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    47   5e-05
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    47   6e-05
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     47   6e-05
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    47   6e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    47   6e-05
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    47   6e-05
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                46   6e-05
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    46   7e-05
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     47   7e-05
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    47   7e-05
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    47   7e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    46   7e-05
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    46   7e-05
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    45   8e-05
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    47   8e-05
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    47   8e-05
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    46   8e-05
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    47   8e-05
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    47   9e-05
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    46   9e-05
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    47   9e-05
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    47   9e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    47   9e-05
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    47   9e-05
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    44   9e-05
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               46   9e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    47   9e-05
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    46   1e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    47   1e-04
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    47   1e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    46   1e-04
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    46   1e-04
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    46   1e-04
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    45   1e-04
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    45   1e-04
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    46   1e-04
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    46   1e-04
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    46   1e-04
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    46   1e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    46   1e-04
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    44   1e-04
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    46   1e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    46   1e-04
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    46   1e-04
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    45   1e-04
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    45   1e-04
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    45   1e-04
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    45   1e-04
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    45   2e-04
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                45   2e-04
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    45   2e-04
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    45   2e-04
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    45   2e-04
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    43   2e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    45   2e-04
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    45   2e-04
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    45   2e-04
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    44   2e-04
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    45   2e-04
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    45   2e-04
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    45   2e-04
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    45   2e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    45   2e-04
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    45   2e-04
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    45   2e-04
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    45   2e-04
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    45   2e-04
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    45   2e-04
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    45   2e-04
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    45   2e-04
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    44   2e-04
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    45   2e-04
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    45   2e-04
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    45   2e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    45   2e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    45   2e-04
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    45   2e-04
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    45   2e-04
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               45   2e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    45   2e-04
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    45   2e-04
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    45   2e-04
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    45   2e-04
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    45   2e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    45   3e-04
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    45   3e-04
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    45   3e-04
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    45   3e-04
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    45   3e-04
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    45   3e-04
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    45   3e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    45   3e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     44   3e-04
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    45   3e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    45   3e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    45   3e-04
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    44   3e-04
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    45   3e-04
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    45   3e-04
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    44   3e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    45   3e-04
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    44   4e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     44   4e-04
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    44   4e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    44   4e-04
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    44   4e-04
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    44   4e-04
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    44   5e-04
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    44   5e-04
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    44   5e-04
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    44   5e-04
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    44   5e-04
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    44   5e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    44   5e-04
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    44   5e-04
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    43   5e-04
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    44   5e-04
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    44   5e-04
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    44   5e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    44   5e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    44   6e-04
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    44   6e-04
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             44   6e-04
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    44   6e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    44   6e-04
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    44   6e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    44   6e-04
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    44   6e-04
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    44   7e-04
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    44   7e-04
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       40   7e-04
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    43   8e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    43   8e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    43   0.001
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               43   0.001
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    44   0.001
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    44   0.001
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    42   0.001
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    43   0.001
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    43   0.001
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    43   0.001
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    42   0.001
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    42   0.001
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    43   0.001
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    43   0.001
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    43   0.001
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    43   0.001
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    42   0.001
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    43   0.001
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    43   0.001
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    42   0.001
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    42   0.001
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    42   0.001
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    42   0.001
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    42   0.001
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    42   0.001
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    42   0.001
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    42   0.001
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    43   0.001
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    42   0.001
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    43   0.001
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    43   0.001
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    42   0.002
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    42   0.002
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    42   0.002
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      42   0.002
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    42   0.002
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    42   0.002
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    41   0.002
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    42   0.002
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    42   0.002
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    42   0.002
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    42   0.002
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    42   0.002
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    42   0.002
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    42   0.002
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    42   0.002
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    42   0.002
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    41   0.002
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    42   0.002
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    41   0.003
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    41   0.003
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    42   0.003
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    41   0.003
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    41   0.003
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    40   0.003
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    42   0.004
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    41   0.004
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    41   0.004
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    40   0.004
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                40   0.004
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    40   0.004
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    41   0.004
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                40   0.004
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    41   0.004
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    40   0.004
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    41   0.004
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    41   0.004
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    41   0.004
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    41   0.004
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    41   0.004
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    41   0.005
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    41   0.005
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    40   0.005
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    40   0.006
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      40   0.006
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    40   0.006
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    40   0.006
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    39   0.006
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    40   0.006
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    40   0.006
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    40   0.006
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    40   0.006
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    40   0.007
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    40   0.007
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    38   0.007
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    40   0.007
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             40   0.007
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    40   0.008
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    40   0.008
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    40   0.008
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     40   0.008
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    40   0.008
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    40   0.009
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    39   0.009
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    40   0.009
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    40   0.009
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    40   0.009
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    40   0.009
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    40   0.009
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    40   0.009
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    40   0.009
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    39   0.009
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    40   0.009
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    40   0.009
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    40   0.010
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    39   0.010
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    40   0.010
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     40   0.010
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    40   0.010
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    39   0.010
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     40   0.011
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    40   0.011
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    39   0.012
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    39   0.012
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    38   0.012
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    39   0.012
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      39   0.013
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    39   0.013
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      39   0.013
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    39   0.013
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    39   0.013
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    40   0.013
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    39   0.014
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    39   0.014
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    39   0.015
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    39   0.015
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    39   0.017
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    39   0.017
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    38   0.017
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    38   0.017
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    39   0.017
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    39   0.018
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    38   0.018
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    39   0.019
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    39   0.019
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    39   0.020
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    38   0.020
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    39   0.020
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    39   0.021
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    39   0.021
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    39   0.022
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    39   0.022
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    38   0.023
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    39   0.025
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    39   0.025
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    39   0.026
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    39   0.026
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  38   0.027
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    39   0.027
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    38   0.028
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    39   0.028
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    39   0.028
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    39   0.028
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    38   0.028
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    37   0.029
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    37   0.029
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    39   0.029
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    37   0.031
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    38   0.031
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    38   0.031
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    38   0.032
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    39   0.032
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    38   0.032
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    38   0.034
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                37   0.035
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    38   0.036
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    38   0.036
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    38   0.037
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    38   0.037
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    38   0.038
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    38   0.040
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    38   0.040
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    37   0.041
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    38   0.044
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    38   0.044
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    37   0.045
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    37   0.045
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    38   0.048
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    37   0.048
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    37   0.048
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    38   0.048
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    37   0.049
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    38   0.052
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    38   0.052
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    37   0.052
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    37   0.052
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    38   0.053
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    37   0.054
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    37   0.060
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    37   0.061
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    37   0.062
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    37   0.063
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    37   0.066
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    37   0.067
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    37   0.069
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.070
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    36   0.072
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    37   0.073
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     37   0.073
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    37   0.078
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    36   0.079
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    37   0.079
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    37   0.080
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    37   0.080
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    36   0.088
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    37   0.092
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    37   0.092
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    36   0.095
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    37   0.097
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    37   0.099
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      36   0.10 
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    37   0.11 
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    36   0.12 
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    36   0.12 
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    36   0.12 
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    36   0.13 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    36   0.13 
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    36   0.13 
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    36   0.13 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    36   0.13 
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    36   0.14 
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    36   0.15 
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    36   0.16 
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    36   0.16 
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    36   0.17 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    36   0.17 
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    36   0.17 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    35   0.17 
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    35   0.17 
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    35   0.18 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    36   0.18 
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    36   0.20 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    36   0.22 
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    36   0.22 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    35   0.23 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    35   0.23 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    35   0.25 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    35   0.26 
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     35   0.29 
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    35   0.29 
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    35   0.31 
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      35   0.32 
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    35   0.34 
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    34   0.35 
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    35   0.37 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    35   0.37 
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    34   0.40 
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    35   0.42 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    35   0.42 
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    34   0.43 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    35   0.44 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    34   0.44 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    34   0.45 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    33   0.51 
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    34   0.55 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      34   0.55 
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    34   0.57 
Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {O...    34   0.58 
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    34   0.59 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    33   0.65 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    34   0.65 
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    34   0.73 
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    34   0.75 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    33   0.75 
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    34   0.76 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    33   0.76 
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    34   0.79 
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    33   0.96 
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    33   0.97 
KLLA0B03047g Chr2 complement(275298..277343) [2046 bp, 681 aa] {...    33   1.0  
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    33   1.0  
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    33   1.0  
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    33   1.0  
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    33   1.0  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    33   1.1  
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    33   1.1  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    33   1.1  
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    33   1.1  
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    33   1.2  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    33   1.2  
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    33   1.2  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    33   1.2  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    33   1.3  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    33   1.3  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    33   1.4  
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    32   1.4  
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    33   1.5  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    33   1.6  
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    33   1.6  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    33   1.7  
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    32   1.7  
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                32   1.8  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   1.8  
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    32   1.8  
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    32   1.8  
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    32   1.8  
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    32   2.2  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      32   2.2  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    32   2.2  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    32   2.2  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    32   2.5  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   2.5  
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    32   2.5  
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    32   2.5  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    31   2.5  
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    32   2.7  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    32   2.8  
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    32   2.8  
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    32   2.9  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   3.0  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    31   3.3  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    32   3.6  
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    31   3.9  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    31   3.9  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    32   4.1  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    32   4.1  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 32   4.1  
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    31   4.2  
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    32   4.4  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    32   4.9  
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     31   5.0  
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    31   5.0  
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    31   5.1  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    31   5.2  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    31   5.7  
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    30   6.4  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      30   6.5  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  30   6.9  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    31   7.0  
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    31   7.0  
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    30   8.0  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    30   8.4  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    30   8.5  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    30   9.1  
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    30   9.5  

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/387 (77%), Positives = 301/387 (77%)

Query: 1   MTKRDPRLNAEPDXXXXXXXXXXXXXQFDYNKPLLDSQAKSPDNQTKRINVRTSSINKHE 60
           MTKRDPRLNAEPD             QFDYNKPLLDSQAKSPDNQTKRINVRTSSINKHE
Sbjct: 1   MTKRDPRLNAEPDNSNSSCNNTNSGNQFDYNKPLLDSQAKSPDNQTKRINVRTSSINKHE 60

Query: 61  KPYLLAPELKSFNQYNNNTTRHNSLRNNNFNLRPWTPTVHNTYAFPPFYSEKNNGTNNSQ 120
           KPYLLAPELKSFNQYNNNTTRHNSLRNNNFNLRPWTPTVHNTYAFPPFYSEKNNGTNNSQ
Sbjct: 61  KPYLLAPELKSFNQYNNNTTRHNSLRNNNFNLRPWTPTVHNTYAFPPFYSEKNNGTNNSQ 120

Query: 121 SVIVNSSKTVQSDGDFLSKGLPPRLGPVHTQYNNQHKIHASNAQFNYHLPFPLADSNISL 180
           SVIVNSSKTVQSDGDFLSKGLPPRLGPVHTQYNNQHKIHASNAQFNYHLPFPLADSNISL
Sbjct: 121 SVIVNSSKTVQSDGDFLSKGLPPRLGPVHTQYNNQHKIHASNAQFNYHLPFPLADSNISL 180

Query: 181 HTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMTSKNEKIXXXXXXXXXXXXXXXXXXXF 240
           HTQ                            IMTSKNEKI                   F
Sbjct: 181 HTQSNSNASNYNNGSSTTGSSSDSASGGSGSIMTSKNEKIYSNDQQQSYYAQNNQQQDSF 240

Query: 241 AFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH 300
           AFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH
Sbjct: 241 AFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH 300

Query: 301 MKLKHKQQVLQEMDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXI 360
           MKLKHKQQVLQEMDK             TGTDTASPIVNETALSML             I
Sbjct: 301 MKLKHKQQVLQEMDKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSI 360

Query: 361 IAMVDNGTLKKENVKKVLNSIIERQRQ 387
           IAMVDNGTLKKENVKKVLNSIIERQRQ
Sbjct: 361 IAMVDNGTLKKENVKKVLNSIIERQRQ 387

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  117 bits (293), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 81/138 (58%), Gaps = 21/138 (15%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMD 314
           +C++C K FKRKSWLKRHLLSHSS + ++CPWC S+HKRKDNLLQHMKLKH  QVLQE+ 
Sbjct: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQ 318

Query: 315 KXXXXXXX--------XXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDN 366
                                  G  +  P+  +  +SM+             I  M+D+
Sbjct: 319 SAGVHPIVSNITLINLASTAGQNGVPSLVPVHGD--MSMM-----------TSIKTMIDD 365

Query: 367 GTLKKENVKKVLNSIIER 384
           GTL K++VK+VLN +I R
Sbjct: 366 GTLNKDDVKRVLNMLINR 383

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  111 bits (277), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 61/133 (45%), Positives = 75/133 (56%), Gaps = 30/133 (22%)

Query: 252 YIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQ 311
           Y+ +C++C K FKRKSWL+RHLLSHS  R +SCPWCLSKHKRKDNLLQHMKLKH   VLQ
Sbjct: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191

Query: 312 EMDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGTLKK 371
           E+                        +N   +S               I  ++  G L K
Sbjct: 192 ELR-----------------------LNNVYVS-------TEGSCKNNIRTLLYEGRLNK 221

Query: 372 ENVKKVLNSIIER 384
           + VKKVLNS+I+R
Sbjct: 222 DEVKKVLNSLIDR 234

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  115 bits (289), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 81/142 (57%), Gaps = 15/142 (10%)

Query: 243 SDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           SDN   +N +I +C++C K FKR+SWLKRHLLSHS+ R Y CPWCLS+HKRKDNLLQHMK
Sbjct: 426 SDNSSPSN-FIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMK 484

Query: 303 LKHKQQVLQEMDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIA 362
           LKH   +L E+                 TD+    ++    S               I  
Sbjct: 485 LKHSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDS--------------SIKK 530

Query: 363 MVDNGTLKKENVKKVLNSIIER 384
           ++  G L K++VK+VLN IIER
Sbjct: 531 LLYRGILNKDDVKRVLNKIIER 552

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 76/139 (54%), Gaps = 8/139 (5%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           +RC +C K FKR+SWLKRHLLSHSS R Y CPWCLS+HKR+DNLLQHMKLKH   ++ E+
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459

Query: 314 DKXXXXXXXXXXXXXTGTDTASPIV--------NETALSMLXXXXXXXXXXXXXIIAMVD 365
                              +A+P +        N  A ++              I  ++ 
Sbjct: 460 KLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519

Query: 366 NGTLKKENVKKVLNSIIER 384
            G + KE+VK++LN +I+ 
Sbjct: 520 EGLINKEDVKRLLNILIDE 538

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  108 bits (270), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 74/139 (53%), Gaps = 27/139 (19%)

Query: 245 NIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLK 304
           N  MN     +C  C K FKRKSWLKRH+LSHS  RQYSCPWC+S+HKRKDNLLQHMKLK
Sbjct: 104 NSSMNEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLK 163

Query: 305 HKQQVLQEMDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMV 364
           H  +VL+++                  D    ++N                    I  M+
Sbjct: 164 HTDEVLKKL----------KMTCYLEGDDGEEMMNRD-----------------NIRTML 196

Query: 365 DNGTLKKENVKKVLNSIIE 383
             G L K+ VKKVLN ++E
Sbjct: 197 YEGLLDKDEVKKVLNELLE 215

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  114 bits (284), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 73/129 (56%), Gaps = 22/129 (17%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMDK 315
           C++CGK FKRKSWL+RHLLSHSS R + CPWCLSKHKRKDNLLQHMKLKH + VL+++  
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQL-- 536

Query: 316 XXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGTLKKENVK 375
                           D + P +                     I  ++  G L K+ VK
Sbjct: 537 ------RINLKANNPNDNSEPTLEGNG--------------DHNIRTLMGEGILNKDEVK 576

Query: 376 KVLNSIIER 384
           K+LNS++ +
Sbjct: 577 KLLNSLVAQ 585

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  113 bits (282), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 74/131 (56%), Gaps = 20/131 (15%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           +RC++C K FKR+SW KRHLLSHSS + YSCPWC S+HKR+DNL QHMK KH + V+QE+
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448

Query: 314 DKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGTLKKEN 373
            +               +D ++P                       I  ++ +G +KKE 
Sbjct: 449 LEVGDVDGSVMSGMQVTSDESAP--------------------EPSIKTLIQDGQVKKER 488

Query: 374 VKKVLNSIIER 384
           VK VLN++I R
Sbjct: 489 VKAVLNAVIAR 499

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  112 bits (279), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 78/141 (55%), Gaps = 20/141 (14%)

Query: 244 DNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           D+   +   ++RC++C K FKRKSW +RHLLSHSS + Y+CPWC S+HKR+DNL QHMK 
Sbjct: 378 DDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437

Query: 304 KHKQQVLQEMDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAM 363
           KH  QVLQE+                GT+    I +  A                 I  +
Sbjct: 438 KHVHQVLQEL------MEAGDLDGSMGTNVRLAIDDMVA--------------GPSIRTL 477

Query: 364 VDNGTLKKENVKKVLNSIIER 384
           V +G +KKE VK VLN++I R
Sbjct: 478 VQDGRVKKERVKTVLNAVIAR 498

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  112 bits (280), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 78/141 (55%), Gaps = 16/141 (11%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +F+C+ C K FKR SWLKRHLL+HS  R YSCPWCLSKHKRKDNLLQH+KLKH + VLQ+
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 313 M----------DKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIA 362
           +          ++                DT +  VN+                   I  
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDI------DIKNVKQPGTNIKT 672

Query: 363 MVDNGTLKKENVKKVLNSIIE 383
           ++ +G L KE+VKKVLN +++
Sbjct: 673 LLYDGRLNKEDVKKVLNKLLD 693

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  110 bits (276), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           I +C+ C K FKRKSWLKRHLLSHS+ + YSCPWC S+HKRKDNL QH+KLKH + +L+ 
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 313 MDKXXXXXXXXXXXXXTGTDTASPIVNETA----LSMLXXXXXXXXXXXXXIIAMVDNGT 368
           +               +G + A  +   +A      +              I  M+D+G 
Sbjct: 345 LSSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGM 404

Query: 369 LKKENVKKVLNSII 382
           L K  VKK LNS+I
Sbjct: 405 LSKNEVKKTLNSLI 418

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  105 bits (262), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 71/128 (55%), Gaps = 31/128 (24%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMDK 315
           C +C K FKRKSWL+RHLLSHS  R + CPWCLSKHKRKDNLLQHMKLKH + VL+++  
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL-- 251

Query: 316 XXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGTLKKENVK 375
                         G D    + N+   ++L                    G L KE+VK
Sbjct: 252 ---------RNQNVGIDGE--VRNDNIRTLLC------------------EGRLNKEDVK 282

Query: 376 KVLNSIIE 383
           KVLN +I+
Sbjct: 283 KVLNGLID 290

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  107 bits (267), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 71/130 (54%), Gaps = 23/130 (17%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           I  C++C K F+RKSWLKRHLLSHS+ RQ+ CPWCLS+HKRKDNLLQHMKLKH   ++ E
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411

Query: 313 MDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGTLKKE 372
           + K                       N    S +             I  ++  G + K+
Sbjct: 412 LKK-----------------------NNAVFSCVNGGNREKLNDTDDIRNLISLGVINKD 448

Query: 373 NVKKVLNSII 382
           +VKKV+N +I
Sbjct: 449 DVKKVINKLI 458

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  107 bits (266), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 74/135 (54%), Gaps = 21/135 (15%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +++C++C K F+R SWLKRHLL+HSS R YSCP C+SKHKRKDNLLQH+KLKH   VL++
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 313 MDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGTLKKE 372
           + +                 TAS                        I  ++  G L KE
Sbjct: 446 LRQDNIDIKTAKDEGEEDQGTAS---------------------NTNIKTLLVEGRLNKE 484

Query: 373 NVKKVLNSIIERQRQ 387
           +VKKVLN +I+   Q
Sbjct: 485 DVKKVLNRLIDSANQ 499

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  106 bits (265), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           ++ C++C K FKR+SWLKRHLLSHSS R Y CPWCLS+HKR+DNLLQHMKLKH + ++ E
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446

Query: 313 MDKXXXXXXXXXXXXXTGTDTASPIVNETAL--SMLXXXXXXXXXXXXXIIAMVDNGTLK 370
           +                          +  +   +              I  +V NG + 
Sbjct: 447 LKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVTNGVVN 506

Query: 371 KENVKKVLNSIIER 384
           KE+VK+VLN +++ 
Sbjct: 507 KEDVKRVLNQLVDE 520

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  103 bits (258), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 74/133 (55%), Gaps = 17/133 (12%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           I +C+ C K FKRKSWLKRHLLSHS+ + YSCPWC S+HKRKDNL QH+KLKH + +L+ 
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 313 MDKXXXXXXXXXXXXXTGTDTASPIVNETALS---MLXXXXXXXXXXXXXIIAMVDNGTL 369
           +               +  +T + ++N    S                  I  M+D+G L
Sbjct: 244 LS--------------SNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIKDMIDSGML 289

Query: 370 KKENVKKVLNSII 382
            K  VKK LNS+I
Sbjct: 290 SKNEVKKTLNSLI 302

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  104 bits (260), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310
           KYI +C  C K FKRKSWLKRHLLSHS  R + CPWCLS+ KRKDNLLQHMKLKH   +L
Sbjct: 335 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 394

Query: 311 QEMDKXXX--XXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXXXXXIIAMVDNGT 368
            E+ K                  +  S   +    +               I  ++++G 
Sbjct: 395 DELKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGV 454

Query: 369 LKKENVKKVLNSII 382
           L K++VK+VLN++I
Sbjct: 455 LNKDDVKRVLNNLI 468

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  104 bits (259), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (77%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQ 308
           ++KYI +C  C K FKRKSWLKRHLLSHS  R + CPWCLS+ KRKDNLLQHMKLKH   
Sbjct: 341 DHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 400

Query: 309 VLQEMDK 315
           +L E+ K
Sbjct: 401 LLDELKK 407

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  103 bits (258), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 50/65 (76%)

Query: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310
           KYI +C  C K FKRKSWLKRHLLSHS  R + CPWCLS+ KRKDNLLQHMKLKH   +L
Sbjct: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 383

Query: 311 QEMDK 315
            E+ K
Sbjct: 384 DELKK 388

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 56/68 (82%)

Query: 248 MNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           +N   IF+C++C K FKRKSWLKRHLLSHS  R +SCP CLSKHKRKDNL+QH+KLKH  
Sbjct: 334 INQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLD 393

Query: 308 QVLQEMDK 315
            +L++++K
Sbjct: 394 YILKKLNK 401

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/65 (67%), Positives = 50/65 (76%)

Query: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310
           +YI +C  C K FKRKSWLKRHLLSHS  R + CPWCLS+ KRKDNLLQHMKLKH   +L
Sbjct: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 384

Query: 311 QEMDK 315
            E+ K
Sbjct: 385 DELKK 389

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 80/147 (54%), Gaps = 22/147 (14%)

Query: 244 DNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           D +   + + ++C++C K F+RKSWLKRHLLSHS+ +++ CPWC S HKRKDNLLQH+KL
Sbjct: 296 DGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355

Query: 304 KHKQQVLQE-------MDKXXXXXXXXXXXXXTGTDTASPIVNETALSMLXXXXXXXXXX 356
           KH Q +L E       M+              +  +T   I NE + +            
Sbjct: 356 KHTQYLLHEFTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTT------------ 403

Query: 357 XXXIIAMVDNGTLKKENVKKVLNSIIE 383
              I  M+D+  L K+ VK+ LN I++
Sbjct: 404 ---IRDMLDSNALPKDQVKRCLNYIVD 427

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMD 314
           RC++C K FKRKSWLKRHLLSHS  R + CPWC S+HKR+DNLLQHMKLKH   +LQE++
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEIN 594

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 89.4 bits (220), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 51/61 (83%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           ++RCNVC K F+R++WL+RH LSH+++R + CPWC SKHKR+DNL +H+KLKH + +++ 
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177

Query: 313 M 313
           +
Sbjct: 178 I 178

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
            + C VC K FKR SWLKRH  SHS  + +SC WC  K+KRKDNL+QH++ KH+ +  +E
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKTNKE 382

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 39/52 (75%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           + C  C K F+R +WLKRH ++H+++  + C WC S+HKR+DN+ +HMKLKH
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKH 301

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           F+C  CGK F+R   LKRH+ S HSS R ++CP C  K  R DNL QH+K   K+
Sbjct: 765 FKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIKTHKKR 819

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           F+C+ CGK F+R   LKRH+ S HS  R +SC  CL K  R DNL QH+K   K 
Sbjct: 689 FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLKTHKKH 743

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HSS R ++C +C  K  R DNL QH+K   K
Sbjct: 527 FKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKK 580

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 245 NIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           ++  ++  IF+C++C + FKR+  LKRH+ S H   R YSC  CL    R DNL QH +
Sbjct: 209 SLLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKR 267

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HSS+R + C +C  K  R DNL QH+K   K
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRK 557

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K FKR   LKRH+ S HS++R ++C  C  K  R DNL QH+K   K
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKK 616

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           F+C+ C K F+R   LKRH+ S HS+ R + C +C  K  R DNL QH+K   K   + E
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKKHGDITE 680

Query: 313 M 313
           +
Sbjct: 681 L 681

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQ 308
           N+  F+C+ C K F+R   LKRH+ S HS+ R ++C  C  K  R DNL QH+K   K  
Sbjct: 382 NEKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLKTHKKHG 441

Query: 309 VL 310
            L
Sbjct: 442 EL 443

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HSS R ++C +C  K  R DNL QH+K   K
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKK 643

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C+ C K F+R   LKRH+ S HSS R ++C +C  K  R DNL QH+K   K
Sbjct: 673 FKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKK 726

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           F+C  C K F+R   LKRH+ S HS++R + C +C  K  R DNL QH+K   K   +++
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDIKD 757

Query: 313 M 313
           +
Sbjct: 758 V 758

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F C++C K FKR   LKRH+ S HS++R +SC  C  K  R DNL QH+K   K
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIKTHKK 588

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HSS R + C +C  K  R DNL QH+K   K
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKK 495

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F+CN C K FKR   LKRH+ S HS+ R Y C +C     R DNL QH+K
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+CN C K F+R   LKRH+ S HSS R + C +C  K  R DNL QH+K   K
Sbjct: 462 FKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKK 515

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HS+ R ++C +C  K  R DNL QH+K   K
Sbjct: 380 FKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKK 433

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 246 IYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLK 304
           IY +    F+C+ C K F+R   LKRH  S HS+ R + C +C  +  R DNL QH+K  
Sbjct: 907 IYDDQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTH 966

Query: 305 HK 306
            K
Sbjct: 967 KK 968

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HS+ R ++C +C  K  R DNL QH+K   K
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKK 626

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HS+ R ++C +C  K  R DNL QH+K   K
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKK 637

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HSS R + C +C  K  R DNL QH+K   K
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKK 694

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F C++C K FKR   LKRH+ S HS+ R ++C  C  K  R DNL QH+K   K
Sbjct: 652 FHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKK 705

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HS+ R ++C +C  K  R DNL QH+K   K
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKK 624

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F C++C K FKR   LKRH+ S HS+ R ++C  C  K  R DNL QH+K   K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKK 700

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F C++C K FKR   LKRH+ S HS+ R ++C  C  K  R DNL QH+K   K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKK 700

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F C++C K FKR   LKRH+ S HS+ R ++C  C  K  R DNL QH+K   K
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIKTHKK 699

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HS  R + C +C  K  R DNL QH+K   K
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKK 490

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 247 YMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           Y +    F+C+ C K F+R   LKRH+ S HS  R ++C  C  K  R DNL QH+K   
Sbjct: 705 YGDENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLKTHK 764

Query: 306 KQQVL 310
           K   L
Sbjct: 765 KHGDL 769

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  C K F+R   LKRH+ S HS+ R + C +C  K  R DNL QH+K   K
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKK 673

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F C  C K F+R   LKRH+ S HS+ R ++C +C  K  R DNL QH+K   K
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKK 635

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           F+C  C K F+R   LKRH+ S HSS R + C +C  +  R DNL QH+K   K 
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKH 520

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           F+C  C K F+R   LKRH+ S HS+ R + C +C  K  R DNL QH+K  HK+
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK-THKR 537

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C+ C K FKR   LKRH  S HS+ R + C  C  K  R DNL QH+K   K
Sbjct: 313 FKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKK 366

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHK 306
           + C++CGK FKR S L  H+  H+ N+ ++CP+  C      K N+L+H KL  K
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFK 359

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C K FKR   LKRH+ S HS  R Y C  C  K  R DNL QH+K
Sbjct: 603 FHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+LS H   +++ CP C     R DNL QH+K
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ 307
           ++C +C K F R S L+ HLL+H+ +R + CP+  C      K N+++H+K  HKQ
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK-THKQ 182

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 240 FAFSDNIYMNNK-YIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDN 296
           ++ S+ +Y N K + + C++C K+F+R S LK H+  H+  + Y CP+  C      K N
Sbjct: 400 YSASNCMYPNPKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSN 459

Query: 297 LLQHMKLKHK 306
           +L+H KL ++
Sbjct: 460 MLRHFKLHYR 469

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKL 303
           + C+VCGK FKR S L  H   H+ N+ YSCP   C      K N+L+H KL
Sbjct: 276 YSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKL 327

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           +F C+VC + F R+  L RH  SH++ + Y C  C  K  R+D LL+H +  H
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +C++CGK   R S L+ H+L H+ +R + C W  C  +   K N+ +H KL  K+Q+  E
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANE 551

Query: 313 M 313
           +
Sbjct: 552 V 552

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310
           F C+ C + FKR+  LKRH+ S H   + + C  C  K  R DNL QH+K     +VL
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIKTHTDGEVL 403

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 248 MNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKL 303
            + K  + C+VCGK F+R S L+ H    S NR Y CP+  C      K N+L+H KL
Sbjct: 233 FDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + Y C  C  K  R DNL QH+K
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + Y C  C  K  R DNL QH+K
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKL 303
           C  CGK F R S L+ H+L HS ++ + C W  C  K   K NL++H+KL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 243 SDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQH 300
           SD+I +  KY+  C VCGK F     L RH   H+  +++ CP+  C  +  R DN LQH
Sbjct: 393 SDDIELRRKYL--CKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQH 450

Query: 301 MK 302
            K
Sbjct: 451 YK 452

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCP--WCLSKHKRKDNLLQHMKLKHKQ 307
           +K  + CN+CGK FKR S L  H+  H+  + Y CP   C      K N+L+H KL  K 
Sbjct: 266 DKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFKL 325

Query: 308 QVLQ 311
              Q
Sbjct: 326 NTGQ 329

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           F+C++CGK F R    +RH+ +H+  + +SC  P C+ +  R D L +H++
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKL 303
           C VCG+  +R S LK H+L+H+  R +SC  P C      + N+L+H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C+ C + FKR+  LKRH+ S H   + Y+C  C     R DNL QH+K
Sbjct: 495 FACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQV 309
           +C++C K   R + LK HLL H+ +  + CPW  C      K N+L+H+K   ++QV
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQV 206

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C+ C + FKR+  LKRH+ S H   + + C  C  K  R DNL QH+K
Sbjct: 340 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + Y C  C  K  R DNL QH+K
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQ 308
           +C VCGK   R S LK H L H+ +  + CPW  C      K N+L+H+K   +++
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C+ C + FKR+  LKRH+ S H   + Y+C  C  K  R DNL QH+K
Sbjct: 386 FGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNL----LQHMKLK 304
           F+C  CGK F +   L+ H   H+  R YSC  C  K  RK NL    L H KLK
Sbjct: 536 FQCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLK 590

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 25/49 (51%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
            C  C ++F + + L+ H+ SH   + + C +C  +  +  NL  H +L
Sbjct: 509 ECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           +F C  C + FKR+  LKRH+ S H   + +SC  C  K  R DNL QH+K
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 245 NIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           N+ +  K   +C VCGK   R S LK H + H+ +  + CPW  C      K N+ +H+K
Sbjct: 446 NLTLATKLRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLK 505

Query: 303 LKHKQQVLQ 311
             HK+++ Q
Sbjct: 506 -SHKRKLEQ 513

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F  S+ +   N  ++ C  C + F     L RH  S HS  + YSCP C  K KR+D++L
Sbjct: 742 FTSSEIVMSENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVL 801

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 802 QHLNKK 807

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 241 AFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLL 298
           A   N+ + ++   +C VCGK   R S LK H L H+ +  + CPW  C      K N+L
Sbjct: 257 AIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNML 316

Query: 299 QHMKLKHKQ 307
           +H+K   K+
Sbjct: 317 RHLKSHQKK 325

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 254 FRC---NVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310
           F+C   + C   F R   L RH+  H+  + + CP CL    R DNL QH +  H  + L
Sbjct: 44  FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKQL 103

Query: 311 QEMD 314
              D
Sbjct: 104 HPTD 107

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F+  + I   N  I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 845 FSSGEIIVSENGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 904

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 905 QHLNKK 910

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 248 MNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKH 305
           + NK  F+C VCGK F+R S L  H   H+  + Y CP+  C      K N+ +H KL  
Sbjct: 202 IENKRKFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHF 261

Query: 306 K 306
           K
Sbjct: 262 K 262

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + Y C  C  K  R DNL QH+K
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ 307
           +C VCGK   R S LK H L H+ +  + CPW  C      K N+L+H K   K+
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFKSHEKK 353

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + Y C  C  K  R DNL QH+K
Sbjct: 264 FGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 244 DNIYMNNKY------IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNL 297
           DN+ +N K       +F C++C + F R+  L RH  SH+  + Y C  C  K  R+D L
Sbjct: 28  DNLRLNGKTPSGKVRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLL 87

Query: 298 LQHMKLKH 305
           L+H +  H
Sbjct: 88  LRHAQKIH 95

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +F C +C + F R+  L RH  SH+  + Y+C  C  K  R+D L++H +  H   V+  
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVVDT 174

Query: 313 M 313
           +
Sbjct: 175 V 175

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQV 309
           C +CGK FKR S L+ H++ H++++ Y C    C  +   K N+L+HM+ KHK+ V
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR-KHKEVV 305

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           FA ++ I   N  ++ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 673 FASNEIIISENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 732

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 733 QHLNKK 738

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           F+C++CGK F R    +RH+ +H+  + ++C  P C+ +  R D L +H++
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 242 FSDNIYM--NNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           FS N  M   N  ++ C  C + F     L RH  S HS  + YSCP C  K KR+D++L
Sbjct: 774 FSTNEIMISENGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVL 833

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 834 QHLNKK 839

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + + C  C  K  R DNL QH+K
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  CGK F +   L+ H+  H+  R Y C  C  +  RK NL  HM L H+
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHE 566

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ---- 307
           + C+ CGK F RK  L  H+L+H + + + C    C     +  N+  H    H Q    
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQTLNR 602

Query: 308 --QVLQEMD 314
             Q L EMD
Sbjct: 603 LTQKLAEMD 611

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMD 314
           +C  C K F + + L+ H+ SH   + + C +C  +  +  NL  H++L H  +   E D
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYECD 546

Query: 315 K 315
           K
Sbjct: 547 K 547

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           F+C  CGK F +   L+ H+  H+  R Y C  C  +  RK NL  HM
Sbjct: 519 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM 566

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC 284
           + C+ CGK F RK  L  H+L+H +++ + C
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQC 577

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMDK 315
           C  C K F + + L+ H+ SH   + + C +C  +  +  NL  H++L H  +   E DK
Sbjct: 493 CPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYECDK 551

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  CGK F +   L+ H   H+  + YSC  C  +  RK NL  HM L H+
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM-LTHE 619

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKLKHKQ---- 307
           + C  CGK F RK  L  H+L+H + + Y C    C     +  NL  H    H Q    
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTLNQ 655

Query: 308 --QVLQEMD 314
             Q L EMD
Sbjct: 656 LTQRLAEMD 664

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           C  C K F + + L+ H+ SH   + + C +C  +  +  NL  H +L
Sbjct: 542 CPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           IF C  C + FKR+  LKRH  S H   + + C  C  K  R DNL QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH 300
           +F C++C + F R+  L RH  SH+  + Y C  C  K  R+D LL+H
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F  ++ I  ++  I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 814 FGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVL 873

Query: 299 QHMKLKHKQQVLQEMD 314
           QH  L  K    QEMD
Sbjct: 874 QH--LNKKIPCTQEMD 887

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVL 310
           +C++CGK   R S LK H L HS +  + C W  C      K N+L+H K   K+  L
Sbjct: 256 QCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEKKARL 313

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+CN CGK F +   L+ H   H+  + Y C  C  +  RK NL  H KL H+
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTHR 679

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQ 311
           +RC +C K F RK  L  H L+H   + + C    C     +  N+  H    H Q +L+
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLE 715

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 244 DNIYMN------NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNL 297
           DN+ +N      NK  F C VC K F R+  L RHL SH++ + + C  C     R+D L
Sbjct: 33  DNLKLNGLTPSGNKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLL 92

Query: 298 LQH 300
           ++H
Sbjct: 93  IRH 95

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 9/93 (9%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQH 300
           N+  F C +CGK F R+   KRH   HS  ++Y+C        PW C  K  R D L +H
Sbjct: 421 NERPFACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALGRH 480

Query: 301 MKLKHKQQVLQEMDKXXXXXXXXXXXXXTGTDT 333
            K    ++ +  + +             T TDT
Sbjct: 481 FKTDCGRKCIAPLYEEAAQEKAFNENNTTETDT 513

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           N  ++ C VC K F R   LK HL +H++ R ++C  C     R+ +  +H  L
Sbjct: 393 NPQLYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDL 446

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +C VCGK   R S LK H L H+ +  Y C W  C      K N+L+H  LK+ ++ L++
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRH--LKNHEKKLEK 413

Query: 313 MDK 315
           M +
Sbjct: 414 MKE 416

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCP--WCLSKHKRKDNLLQHMKLKHKQ 307
           C +CGK FKR S L+ H++ H++++ Y+C    C  +   K N+L+HM+ KHK+
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR-KHKE 279

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 243 SDNIYMNNKY-IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQH 300
           SD I M+    ++ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH
Sbjct: 753 SDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812

Query: 301 MKLKHKQQVLQEMDKXXXXXXXXXXXXXTGTDTASPIVNETA 342
           +  K    V +E                T T  A+P++ +  
Sbjct: 813 LN-KKIPCVPEEGSSNAIATTATLGASKTATTGATPLIEQNG 853

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H+L H+ +  + C W  C      K NLL+H+K
Sbjct: 285 QCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           N++  F+C++C + F R     RH+++H+  + + C  P C+ K  R D L +H K
Sbjct: 13  NDRRPFKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAK 68

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           ++CN CGK F +   LK H   H+  + YSC  C  +  RK NL  H+ L HK+
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHV-LTHKK 597

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%)

Query: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           K   +C  C ++F + + L+ H+ SH   + Y C +C  K  +  NL  H +L
Sbjct: 514 KKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC 284
           + C +C K F RK  L  H+L+H   + Y C
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFC 603

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F+  + +   N  ++ C +C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 767 FSEEEVVVSKNGKVYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVL 826

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 827 QHLNKK 832

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHK 306
           N K  + C+VCGK   R   L  H+L H+  R Y C W  C      K NL +H+K+  K
Sbjct: 419 NKKATYECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIHLK 478

Query: 307 QQ 308
           +Q
Sbjct: 479 KQ 480

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C +C + F R+  LKRH  SH+  + + C  C     RKD +L+H++  H+    +++
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQL 86

Query: 314 DK 315
           DK
Sbjct: 87  DK 88

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM----KLKHKQQV 309
           F C+ CGK F +   L+ H   H+  + YSC  C  K  RK NL  H+    KLK     
Sbjct: 652 FACDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCK 711

Query: 310 LQEMDK 315
           L+  DK
Sbjct: 712 LENCDK 717

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           + C++C K FKR   LKRH  + H   R + C  C  +  R DNL QH+++  +Q +++ 
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEP 282

Query: 313 MDK 315
           + K
Sbjct: 283 IRK 285

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C +C + F+R+  +KRH+ + H   R Y+C  C     R DNL QH++
Sbjct: 413 FLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLR 462

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHK 306
           F C VC K FKR S L  H+  H+  + Y CP+  C      K N+L+H KL  K
Sbjct: 173 FICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQH 300
           N+  F CN+CGK F R+   KRH   H+  ++Y C        PW C  K  R D L +H
Sbjct: 476 NEKPFVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRH 535

Query: 301 MKLKHKQQVL 310
            K    ++ +
Sbjct: 536 FKTDSGRKCI 545

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           + C +C K F R   LK HL +H++ + + C  C     R+ +  +H  L
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDL 501

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 242 FSDNIYMNNKY--IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F  N  + N+Y  ++ C  C + F     L RH  S HS  + YSCP C  + KR+D++L
Sbjct: 746 FGVNEVIMNEYGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVL 805

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 806 QHLNKK 811

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           +F C VC + F R+  L RH  SH+  + Y C  C  K  R+D LL+H    H
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIH 137

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHK 306
           +K  + C VC K FKR S L  H+  H+  + Y CP+  C      K N+L+H KL  K
Sbjct: 274 DKVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFK 332

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C+VCGK   R S LK H L H+ +  + C W  C      K N+L+HMK
Sbjct: 210 QCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMK 259

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310
           C +CGK F R+S L+ HLL H++ + + C +C  +   K NL +H ++ H+Q+V+
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI-HRQKVI 226

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + Y+C  C     R DNL QH+K
Sbjct: 384 FGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F   + +   N  ++ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 763 FGSDEIVISENGKVYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 822

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 823 QHLNKK 828

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C  CGK F +   L+ H+  H+  + Y C  C  K  RK NL  H KL H
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTH 601

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           F+C  C KYF + + L+ H+ SH   + +SC +C  +  +  NL  H++L
Sbjct: 523 FQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL 572

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ---- 307
           + C  CG+ F RK  L  H L+H + + + C    C     +  N+  H    H Q    
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQTLNR 638

Query: 308 --QVLQEMD 314
             Q L EMD
Sbjct: 639 LTQRLAEMD 647

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           + C  C + FKR+  LKRH+ S H   + Y+C  C  K  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + ++C  C  K  R DNL QH+K
Sbjct: 258 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + F+R+  +KRH+ S H + + YSC  C     R DNL QH K
Sbjct: 171 FACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQ 311
           F C+ C K F R     RH  SH+  + Y C  C     R D  L+H+K  HK+++LQ
Sbjct: 15  FICSFCAKGFSRAEHKIRHERSHTGLKPYKCKVCTHCFVRSDLALRHIKTVHKKEILQ 72

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F  ++ I  ++  I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 814 FGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVL 873

Query: 299 QHMKLKHKQQVLQEMD 314
           QH  L  K    QEM+
Sbjct: 874 QH--LNKKIPCTQEME 887

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKL 303
           C VCG+  +R S LK H+L+H+  R + C  P C      + N+L+H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           F C+ CGK F +   L+ H   H+  + YSC  C  K  RK NL  H+
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQV 309
           + C++C K F RK  L  HL++H   + + C    C     +  N+  H    HK+ +
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 706

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F  ++ I  ++  I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 814 FGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVL 873

Query: 299 QHMKLKHKQQVLQEMD 314
           QH  L  K    QEM+
Sbjct: 874 QH--LNKKIPCTQEME 887

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           ++C  CGK F +   LK H+  H+  + +SC +C  +  RK NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           CN+C K F + + L+ HL SH  ++ Y C WC     +  NL  H++L
Sbjct: 390 CNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 3/64 (4%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCP--WCLSKHKRKDNLLQHMKLKHKQQVLQ 311
           F C  C K F RK  L  HL++H   R + C    C+    +  N+  H    H Q  L 
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFH-QNTLT 502

Query: 312 EMDK 315
           E+ +
Sbjct: 503 ELTR 506

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F  ++ I  ++  I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 836 FGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVL 895

Query: 299 QHMKLKHKQQVLQEMD 314
           QH  L  K    QEM+
Sbjct: 896 QH--LNKKIPCTQEME 909

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           F C+ CGK F +   L+ H   H+  + YSC  C  K  RK NL  H+
Sbjct: 622 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 669

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQV 309
           + C++C K F RK  L  HL++H   + + C    C     +  N+  H    HK+ +
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 707

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH 300
           F C++C + F R+  LKRH +SH++ + + C +C     RKD +L+H
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           F C+ CGK F +   L+ H   H+  + YSC  C  K  RK NL  H+
Sbjct: 611 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 658

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQV 309
           + C++C K F RK  L  HL++H   + + C    C     +  N+  H    HK+ +
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 696

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQ 311
           C VCGK   R + L+ H+L H+ +R + C W  C +    K N+ +H K   K Q  +
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLKGQTTE 344

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           +F C VC + F R+  L RH  SH+  + Y C  C  +  R+D L++H +  H
Sbjct: 124 LFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLH 176

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C +CGK   R S LK H L H+    + CPW  C      K N+L+H K
Sbjct: 259 QCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C++C + F R   LKRH +SH++ + + C +C     RKD +L+H    H   V Q+ 
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPALVSQKD 95

Query: 314 DK 315
            K
Sbjct: 96  SK 97

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           +F C +C + F R+  L RH  SH+  + YSC  C     R+D LL+H    H
Sbjct: 58  LFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVH 110

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 254 FRC---NVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQ 308
           F+C   + C   F R   L RH+  H+  + + CP CL    R DNL QH +  H  +
Sbjct: 41  FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHK 98

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKL 303
           +RC  CGK F R S L  H+  H+ ++ Y C  P C  +   K N+L+H KL
Sbjct: 304 YRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKL 355

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C VC + F R+  LKRH  SH++ + Y C  C     R+D L++H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 241 AFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLL 298
             S N   +N + + C+ CGK F R S L+ H   H+ +R ++CP+  C      + N+L
Sbjct: 194 VLSSNNVASNLHRYICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNML 253

Query: 299 QHMKLKHK 306
           +H KL  K
Sbjct: 254 RHHKLHFK 261

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKL 303
           N++  ++C +C K F R    +RH+ +H+  + ++C  P C+ +  R D L +H+++
Sbjct: 20  NDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C VC + F R+  LKRH  SH++ + Y C  C     R+D L++H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + ++C  C     R DNL QH+K
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + ++C  C     R DNL QH+K
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 244  DNIYMN-NKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHM 301
            D I M+ N  I+ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH+
Sbjct: 987  DEIIMSENGKIYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 1046

Query: 302  KLK 304
              K
Sbjct: 1047 NKK 1049

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           C VC K F RK+ L  HLL H+  R Y C  P C      K NL +H+K+ HK+Q L+  
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKI-HKKQELKGG 169

Query: 314 DK 315
           +K
Sbjct: 170 EK 171

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C VC + F R+  LKRH  SH++ + + C +C     R+D +L+H +  H   + Q+ 
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDK 139

Query: 314 D 314
           D
Sbjct: 140 D 140

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 254 FRC---NVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F+C   + C   F R   L RH+  H+  + + CP CL    R DNL QH +  H
Sbjct: 41  FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C VC + F R+  LKRH  SH++ + Y C  C     R+D L++H +  H
Sbjct: 110 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 161

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + ++C  C     R DNL QH+K
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K  H+++++++
Sbjct: 341 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLK-SHERRLIKK 399

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 254 FRC---NVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQ 308
           F+C   + C   F R   L RH+  H+  + + CP CL    R DNL QH +  H  +
Sbjct: 41  FKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHK 98

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHK 306
           + C  C K FKR S L  H+  H+ N+ Y CP+  C      K N+L+H KL  K
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKLHFK 312

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + ++C  C     R DNL QH+K
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQE 312
           +C  CGK   R S LK H L H+ +  + C W  C      K N+L+H+K   K+ + +E
Sbjct: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKE 260

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           FRC+ C + F R    KRHL +H+  + + C  P C     R D L +HM+
Sbjct: 17  FRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMR 67

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K NL++H+K
Sbjct: 371 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLK 420

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K
Sbjct: 67  QCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLK 116

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKL 303
           F C++C K F+R    KRH+ +H+  + + C +  C+ K  R D L +H+K+
Sbjct: 13  FICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKL 303
           +C +CGK   R S L+ H+L H+  R +SC W  C      K N+ +H+KL
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           FRC+ C + F R    KRHL +H+  + + C  P C     R D L +HM+
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKLKHK 306
           +  C+VCGK F R S L  H L H+ ++ + C  P C  +   K NL++H K+  K
Sbjct: 110 LHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIHDK 165

>Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027W
           (REAL)
          Length = 682

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQH 300
           N+  F C++CGK F R+   KRH   H+  ++Y C        PW C  K  R D L +H
Sbjct: 597 NERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 656

Query: 301 MKLKHKQQVL 310
            K +  ++ +
Sbjct: 657 FKTESGRRCI 666

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           F C+VCGK F R   LK HL +H++ R + C  C     R+ +  +H  L
Sbjct: 573 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDL 622

>Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027W
           (REAL)
          Length = 673

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQH 300
           N+  F C++CGK F R+   KRH   H+  ++Y C        PW C  K  R D L +H
Sbjct: 588 NERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 647

Query: 301 MKLKHKQQVL 310
            K +  ++ +
Sbjct: 648 FKTESGRRCI 657

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           F C+VCGK F R   LK HL +H++ R + C  C     R+ +  +H  L
Sbjct: 564 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDL 613

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQH 300
           N+  F C++CGK F R+   KRH   H+  ++Y C        PW C  K  R D L +H
Sbjct: 596 NERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCSKKFARSDALGRH 655

Query: 301 MKLKHKQQVL 310
            K +  ++ +
Sbjct: 656 FKTESGRRCI 665

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           F C+VCGK F R   LK HL +H++ R + C  C     R+ +  +H  L
Sbjct: 572 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDL 621

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQ 308
           ++C VCGK   R S L  H+  H++ R Y C W  C      K NL +H KL  K+Q
Sbjct: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           N++  F+C+VC + F R    KRH+ +H+  + + C  P C     R D L +H++
Sbjct: 13  NDERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLR 68

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 256 CNV--CGKYFKRKSWLKRHLLSHSSNRQ 281
           CN   CGK F R   LKRHL +H+S  Q
Sbjct: 48  CNFPGCGKSFSRSDELKRHLRTHTSTSQ 75

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C VC + F R+  LKRH  SH++ + Y C  C     R+D L++H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWC 287
           C+VCG  F RKS L+RHL+SHS+ + + C +C
Sbjct: 110 CDVCGSKFSRKSHLERHLISHSAEKPFHCSFC 141

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 251 KYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHM 301
           KY    + C K F R S L  H  S H   + +SC  C SK  RK +L +H+
Sbjct: 76  KYFCEYDGCNKSFARPSTLTEHQQSIHLGIKNHSCDVCGSKFSRKSHLERHL 127

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ 307
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K   K+
Sbjct: 232 KCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVKSHEKK 286

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           F C  CGK F +   L+ H   H+  + Y+C  C  +  RK NL  H +L H++
Sbjct: 500 FECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH-QLTHRE 552

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQVLQ 311
           + C  C K F RK  L  H L+H   + + C    C     +  N+  H    H Q VL+
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFHSQTVLE 587

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  CGK F +   L+ H+  H+  + Y C  C  +  RK NL  H +L H+
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHE 582

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           C  C K F + + L+ H+ SH   + + C +C  +  +  NL  H++L
Sbjct: 505 CPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 552

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKLKHKQ---- 307
           + C  CG+ F RK  L  H L+H + + + C    C     +  N+  H    H Q    
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQTLNE 618

Query: 308 --QVLQEMD 314
             Q L EMD
Sbjct: 619 LTQRLAEMD 627

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH 300
           F+C VC + F RK+ L+RH+ SHS ++ + C +C      K  L +H
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRH 127

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 256 CNVCGKYFKRKSWLKRHLLSH---SSNRQYSCPW--CLSKHKRKDNLLQHMKLKH 305
           C +CGK F+R   LK H+  H      ++Y C    C+   K    L QHMK  H
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMKETH 220

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCP 285
           F+C+ CGK    K  L+RH ++H+  R + CP
Sbjct: 109 FKCSYCGKGVTTKQQLRRHEITHT--RSFVCP 138

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           N+   FRC +C + F R    KRH+ +H+  + + C  P C     R D L +H++
Sbjct: 9   NDDRPFRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLR 64

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%)

Query: 259 CGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNL 297
           CGK F R   LKRHL +H+   Q       SK   KD +
Sbjct: 49  CGKSFSRSDELKRHLRTHTGTSQRKTKKTPSKRVEKDRI 87

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQH 300
           +F C +C + F R+  L RH  SH+  + Y C  C  +  R+D LL+H
Sbjct: 58  LFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRH 105

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C+ C + F R+  LKRH  SH++ + + C +C     R+D +L+H    H   +   M
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGTSM 130

Query: 314 D 314
           D
Sbjct: 131 D 131

>YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}
           CRZ1Transcription factor that activates transcription of
           genes involved in stress response; nuclear localization
           is positively regulated by calcineurin-mediated
           dephosphorylation
          Length = 678

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQH 300
           N+  F C++CGK F R+   KRH   H+  ++Y C        PW C  K  R D L +H
Sbjct: 593 NERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 652

Query: 301 MKLKHKQQVL 310
            K +  ++ +
Sbjct: 653 FKTESGRRCI 662

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           F C+VCGK F R   LK HL +H++ R + C  C     R+ +  +H  L
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDL 618

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           F C++C + F R+  LKRH  +H++ + + C +C     R+D +L+H    H   V +E
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           +F C  C + F R+  L RH  SH+  + Y C  C  +  R+D LL+H    H
Sbjct: 29  LFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVH 81

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ 307
           +C  CGK F R S L+ H L H+ +R + C W  C      K N+++H +L  K+
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           F   + I  ++  I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 888 FEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 947

Query: 299 QHMKLK 304
           QH+  K
Sbjct: 948 QHLNKK 953

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ 307
           +C VCGK   R S LK H   H+ +  + C W  C      K N+++HMK   K+
Sbjct: 353 QCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAKK 407

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMDK 315
           C+ C + F R     RH  SH+  + Y C  CL +  R+D L +H++  HK  +L +  K
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKSLLLSKASK 70

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK 302
           +C VCGK   R S LK H L H+ +  + C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNL----LQHMKLK 304
           F+C  CGK F +   L+ H   H+  + Y+C  C  +  RK NL    L H KLK
Sbjct: 437 FQCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLK 491

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 25/48 (52%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           C  C ++F + + L+ H+ SH   + + C +C  +  +  NL  H +L
Sbjct: 411 CPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRL 458

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC 284
           + C +CGK F RK  L  H L+H   + Y C
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYIC 495

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C VC + F R   L+RH  SH++ + Y C  C     R+D LL+H    H
Sbjct: 75  FVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTH 126

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           F+C  CGK F +   L+ H+  H+  + Y C  C  +  RK NL  H +L H+
Sbjct: 514 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHE 565

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           C  C K F + + L+ H+ SH   + + C +C  +  +  NL  H++L
Sbjct: 488 CPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 535

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKLKHKQ---- 307
           + C  CG+ F RK  L  H L+H + + + C    C     +  N+  H    H Q    
Sbjct: 542 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQTLNE 601

Query: 308 --QVLQEMD 314
             Q L EMD
Sbjct: 602 LTQRLAEMD 610

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 243 SDNIYMNNKY-IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQH 300
           S+ I +++K  ++ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH
Sbjct: 727 SEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 786

Query: 301 M 301
           +
Sbjct: 787 L 787

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHK 306
           + CNVCGK FKR S L  H   H+  + + CP   C      + N+L+H K   K
Sbjct: 233 YCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYKAHFK 287

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           +F C VC + F R   L RH   H+  + Y C  C  K+ R+D LL+H+   H
Sbjct: 52  LFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMH 104

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           FRC+ C + F R    KRHL +H+  + + C  P C     R D L +HM+
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHM 301
           ++ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH+
Sbjct: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C+VC + F R+  LKRH  SH++ + + C +C     R+D +L+H    H   +  E+
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTEL 111

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C +C + F R+  L+RH  SH++ + + C +C     R+D +L+H +  H   + Q+ 
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDK 142

Query: 314 D 314
           D
Sbjct: 143 D 143

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQ 311
           +F C+ C + F R+  L RH  SH++ + + C  C     R+D L++H +  H   + Q
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIHGGDIGQ 209

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 249 NNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           N++  FRC  C + F R    KRH+ +H+  + + C  P C     R D L +H++
Sbjct: 13  NDERPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLR 68

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 15/23 (65%)

Query: 259 CGKYFKRKSWLKRHLLSHSSNRQ 281
           CGK F R   LKRHL +H+S  Q
Sbjct: 53  CGKGFSRSDELKRHLRTHTSTSQ 75

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMK 302
           F C  C + FKR+  LKRH+ S H   + + C  C     R DNL QH+K
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHS 277
           F C++C K+F R   L +H+ +HS
Sbjct: 427 FHCHICDKHFSRSDNLNQHIKTHS 450

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C +C + F R+  LKRH  SH++ + + C +C     R+D +L+H +  H    L + 
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS--LMDQ 130

Query: 314 DK 315
           DK
Sbjct: 131 DK 132

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           N  I+ CN+C K F R   LK HL +H+  R +SC  C     R+ +  +H  L
Sbjct: 422 NPAIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 9/69 (13%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCP--------W-CLSKHKRKDNLLQHMKLK 304
           F C+VCGK F R+   KRH   HS  ++Y C         W C  K  R D L +H K +
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

Query: 305 HKQQVLQEM 313
             ++ +  +
Sbjct: 514 SGRRCIAPL 522

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           FRC+ C + F R    KRHL +H+  + + C  P C     R D L +HM+
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQV 309
           F C++C + F R+  LKRH  +H+S + + C +C     R+D +L+H    H   +
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLI 109

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           ++C  CGK F +   L+ H   H+  + Y C  C  K  RK NL  H+ L H++
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL-LTHQK 595

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC 284
           + C +C K F RK  L  HLL+H   + + C
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFIC 601

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKLKHK 306
           C +CGK F R S L  H L H+ ++ Y+C  P C  +   K NL++H K+  K
Sbjct: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 243 SDNIYMNNKY-IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQH 300
           S+ I +++K  ++ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH
Sbjct: 723 SEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782

Query: 301 M 301
           +
Sbjct: 783 L 783

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMK-LKHKQQVLQ 311
           +C++CGK   R S L+ H+L H+  + Y C W  C      K N+++H K  + K +  Q
Sbjct: 286 QCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYKNHEKKTKENQ 345

Query: 312 EMDK 315
           E+D+
Sbjct: 346 EVDR 349

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQ 308
           I +C +C K   R + L+ HLL H+  + Y C W  C +    K N+ +H K   K Q
Sbjct: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKL 303
           C +CG+ F R     RH+ +H+  + ++C  P C+ +  R D L +H ++
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI 94

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQHMKLK 304
           F CNVCGK F R+   KRH   H+  ++Y C         W C  K  R D L +H K  
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFKTD 511

Query: 305 HKQQVLQEM 313
             ++ +  +
Sbjct: 512 SGRRCIAPL 520

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           N  I+ C +C K F R   LK HL +H+  R ++C  C     R+ +  +H  L
Sbjct: 420 NPAIYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           FA  + +      I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 695 FAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 754

Query: 299 QHM 301
           QH+
Sbjct: 755 QHL 757

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWC 287
           F+C+ CGK F +KS L RH+ SH+ ++ ++C  C
Sbjct: 137 FKCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSIC 170

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           F+C  CGK F +   L+ H   H+  + Y C  C  +  RK NL  H+
Sbjct: 452 FQCQYCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHV 499

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 25/48 (52%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           C  C ++F + + L+ H+ SH   + + C +C  +  +  NL  H +L
Sbjct: 426 CPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRL 473

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHM------KLKH 305
           + C +CGK F RK  L  H+++H   + + C    C     +  N+  H        L  
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHLNTLNE 539

Query: 306 KQQVLQEMD 314
             Q L EMD
Sbjct: 540 LTQKLAEMD 548

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQ 308
           C  CGK F+R S LK H + H     Y+C W  C  +   K NLL+H ++  K++
Sbjct: 220 CPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK 274

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQHMKLK 304
           F CN+CGK F R+   KRH   HS  ++Y C         W C  K  R D L +H K  
Sbjct: 466 FACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFKTD 525

Query: 305 HKQQVLQEM 313
             ++ +  +
Sbjct: 526 SGRRCIAPL 534

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           N  I+ C++C K F R   LK HL +H+  R ++C  C     R+ +  +H  L
Sbjct: 434 NPAIYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNMCGKAFARQHDRKRHEDL 487

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           FA  + +      I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 696 FAPEEIVLSGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 755

Query: 299 QHM 301
           QH+
Sbjct: 756 QHL 758

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           FA  + +      I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 702 FAPEEIVLSGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 761

Query: 299 QHM 301
           QH+
Sbjct: 762 QHL 764

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 240 FAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLL 298
           FA  + +      I+ C  C + F     L RH  S HS  + +SCP C  + KR+D++L
Sbjct: 697 FAPEEIVLSGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 756

Query: 299 QHM 301
           QH+
Sbjct: 757 QHL 759

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 253 IFRCNVCGKYFKRKSWLKRHLLS-HSSNRQYSCPWCLSKHKRKDNLLQHMKLK 304
           ++ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH+  K
Sbjct: 717 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           F C++C + F R+  LKRH  +H++ + + C +C     R+D +L+H    H   V +E
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKL 303
           + C  CGK F R S L+ H   H+ +R ++CP+  C      + N+L+H KL
Sbjct: 183 YVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 234

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHM 301
           F C  CGK F +   L+ H   H+  + Y C  C  +  RK NL  H+
Sbjct: 590 FLCECCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHI 637

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 8/69 (11%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHM------KLKH 305
           + C +CGK F RK  L  H+++H   + + C    C     +  N+  H        L  
Sbjct: 618 YECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHLNTLNE 677

Query: 306 KQQVLQEMD 314
             Q L EMD
Sbjct: 678 LTQRLAEMD 686

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           F C++C + F R+  LKRH  +H++ + + C +C     R+D +L+H    H   V +E
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C++C + F R+  LKRH  +H++ + + C +C     R+D +L+H +  H
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 129

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313
           F C++C + F R+  LKRH  SH++ + + C +C     R+D +L+H    H   V + +
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALVSKTL 134

Query: 314 DK 315
           ++
Sbjct: 135 EE 136

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWC 287
           FRC+ C K F +KS L+RHL SHS  + + C +C
Sbjct: 80  FRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSYC 113

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312
           F C++C + F R+  LKRH  +H++ + + C +C     R+D +L+H    H   V +E
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLK-HKQ 307
           + I +C +C +   R   L  H+L H+ ++ + C W  C      K NL +HMK+  HKQ
Sbjct: 423 RAIHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIHIHKQ 482

Query: 308 QVL 310
           + L
Sbjct: 483 KKL 485

>NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {ON}
           Anc_4.214
          Length = 1169

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQV 309
           F C+ C K F R     RH  SH+  + Y C  C     R D  ++H+K  HK Q+
Sbjct: 87  FICSFCAKAFSRSEHKIRHERSHTGFKPYKCLLCDHSFVRSDLTIRHLKTVHKDQI 142

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMKL 303
           C VCG+ F R     RH+ +H+  + ++C  P C  +  R D L +H ++
Sbjct: 45  CPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRI 94

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305
           F C++C + F R+  LKRH  +H++ + + C +C     R+D +L+H +  H
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 83

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--------PW-CLSKHKRKDNLLQHMKLK 304
           F C +CGK F R+   KRH   H+  ++Y+C         W C  K  R D L +H K +
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTE 500

Query: 305 HKQQVL 310
             ++ +
Sbjct: 501 GGKRCI 506

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%)

Query: 250 NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQ 308
           N  ++ C +C K F R   LK HL +H+  R +SC  C     R+ +  +H  L   Q+
Sbjct: 409 NASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDLHTGQK 467

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC--PWCLSKHKRKDNLLQHMK 302
           ++C +C + F R    KRHL +H+  + + C  P C     R D L +H++
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLR 70

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQ 307
           ++C  CGK F +   L+ H   H+  + Y C  C  +  RK NL  H+ L HK+
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNLAAHV-LTHKK 573

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303
           C  C ++F + + L+ H+ SH   + Y C +C  K  +  NL  H +L
Sbjct: 495 CRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERL 542

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSC 284
           ++C +CGK F RK  L  H+L+H   + + C
Sbjct: 549 YQCELCGKRFSRKGNLAAHVLTHKKIKPFIC 579

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 5/53 (9%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHK 306
           + C VCGK F R   LK HL +H+  + Y C  C     R     QH K +H+
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFAR-----QHDKKRHE 568

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCP--------W-CLSKHKRKDNLLQHMKLK 304
           ++C++CGK F R+   KRH   H+  ++Y C         W C  K  R D L +H K  
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKTS 608

Query: 305 HKQQVL 310
             ++ +
Sbjct: 609 SGRKCI 614

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,640,674
Number of extensions: 1606703
Number of successful extensions: 13255
Number of sequences better than 10.0: 821
Number of HSP's gapped: 12490
Number of HSP's successfully gapped: 1014
Length of query: 387
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 276
Effective length of database: 40,753,473
Effective search space: 11247958548
Effective search space used: 11247958548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)