Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0G035002.530ON39239218060.0
Kpol_348.82.530ON42236710281e-137
YHR004C (NEM1)2.530ON44633910041e-133
Suva_8.582.530ON45234110001e-133
Skud_8.492.530ON4473379881e-131
KAFR0A018302.530ON4423399721e-129
Smik_8.532.530ON4463379601e-127
CAGL0K02959g2.530ON4643389551e-126
TDEL0A030502.530ON3553349271e-123
KNAG0C058502.530ON4432889291e-122
NDAI0H014202.530ON4483379171e-120
SAKL0A09416g2.530ON3853359081e-120
NCAS0F009302.530ON4223369071e-119
TBLA0I014602.530ON3933598781e-115
KLTH0D06776g2.530ON4093568641e-113
Kwal_26.80012.530ON4133538521e-111
ZYRO0B01958g2.530ON3363338131e-106
AGL070W2.530ON3433337674e-99
Ecym_72572.530ON3523337606e-98
KLLA0E18613g2.530ON3743395826e-71
SAKL0G12870g5.202ON3992032743e-26
TPHA0E030705.202ON4942032774e-26
NDAI0I021705.202ON3912052727e-26
TBLA0H019905.202ON6882072751e-25
YLR019W (PSR2)5.202ON3971892692e-25
Smik_12.535.202ON4142152683e-25
Skud_12.875.202ON3922032673e-25
CAGL0D05610g5.202ON4471782684e-25
Smik_12.825.202ON3922032664e-25
Suva_10.995.202ON3851942621e-24
YLL010C (PSR1)5.202ON4272152622e-24
TBLA0C060905.202ON4842032642e-24
Suva_10.655.202ON4151922612e-24
KLLA0F15620g5.202ON4142032613e-24
ZYRO0B10428g5.202ON4822032623e-24
Skud_12.575.202ON4152032603e-24
Ecym_71045.202ON4921912624e-24
Kpol_2002.1005.202ON4771922606e-24
KLTH0B03388g5.202ON4092032578e-24
Kwal_33.151405.202ON4101922561e-23
TDEL0E042705.202ON4532032571e-23
NCAS0D027405.202ON3982072551e-23
KAFR0J009905.202ON4832032562e-23
NDAI0D018605.202ON5141902572e-23
AAL158W5.202ON4782032527e-23
KNAG0M017405.202ON4811892527e-23
CAGL0D03234g5.202ON4101892508e-23
TPHA0N006705.202ON4521922463e-22
Kpol_478.165.202ON3502292417e-22
NCAS0A068005.202ON4731942385e-21
YPL063W (TIM50)8.527ON4761452031e-16
TDEL0B031908.527ON4771452013e-16
ZYRO0F09130g8.527ON4891461987e-16
Smik_16.1728.527ON4771451961e-15
Suva_16.2498.527ON4801451952e-15
SAKL0H10296g8.527ON4781451923e-15
NCAS0C022108.527ON4911461891e-14
Kwal_27.119908.527ON4741451862e-14
Kpol_457.58.527ON4891461853e-14
Skud_16.2188.527ON4801451844e-14
NDAI0E029108.527ON4411451825e-14
TBLA0A005408.527ON4851461836e-14
TPHA0I020008.527ON4781451792e-13
CAGL0H05159g8.527ON4851521792e-13
KLLA0E23101g8.527ON4801891792e-13
KLTH0E12254g8.527ON4761451782e-13
Ecym_11778.527ON4901451675e-12
KNAG0A020608.527ON4501511612e-11
KAFR0E010208.527ON4481481578e-11
ADR045W8.527ON4761441498e-10
Kpol_1068.98.839ON74536722.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0G03500
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   700   0.0  
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   400   e-137
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   391   e-133
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   389   e-133
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   385   e-131
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   379   e-129
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   374   e-127
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   372   e-126
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   361   e-123
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   362   e-122
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    357   e-120
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   354   e-120
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   353   e-119
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   342   e-115
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   337   e-113
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   332   e-111
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   317   e-106
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   300   4e-99
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   297   6e-98
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   228   6e-71
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   110   3e-26
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...   111   4e-26
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202    109   7e-26
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...   110   1e-25
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   108   2e-25
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...   107   3e-25
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...   107   3e-25
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...   107   4e-25
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...   107   4e-25
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...   105   1e-24
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...   105   2e-24
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...   106   2e-24
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...   105   2e-24
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...   105   3e-24
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...   105   3e-24
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...   104   3e-24
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...   105   4e-24
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...   104   6e-24
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...   103   8e-24
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...   103   1e-23
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...   103   1e-23
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...   102   1e-23
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...   103   2e-23
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202    103   2e-23
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...   101   7e-23
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....   101   7e-23
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...   100   8e-23
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    99   3e-22
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    97   7e-22
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    96   5e-21
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    83   1e-16
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    82   3e-16
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    81   7e-16
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    80   1e-15
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    80   2e-15
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    79   3e-15
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     77   1e-14
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    76   2e-14
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    76   3e-14
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    75   4e-14
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    75   5e-14
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    75   6e-14
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    74   2e-13
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    74   2e-13
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    74   2e-13
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    73   2e-13
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    69   5e-12
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    67   2e-11
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    65   8e-11
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    62   8e-10
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...    32   2.3  

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/392 (89%), Positives = 351/392 (89%)

Query: 1   MNTISYISNSLITSIRXXXXXXXXXXLQPALPDEKXXXXXXXXXXXXXXXXXXXXSWYLL 60
           MNTISYISNSLITSIR          LQPALPDEK                    SWYLL
Sbjct: 1   MNTISYISNSLITSIREEGGKEEQEELQPALPDEKPFWFVLLFLPRLLLVKPLLFSWYLL 60

Query: 61  TFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSVLEDD 120
           TFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSVLEDD
Sbjct: 61  TFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSVLEDD 120

Query: 121 MKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRFLFPK 180
           MKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRFLFPK
Sbjct: 121 MKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRFLFPK 180

Query: 181 KLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHK 240
           KLIPRSILHSGRKKKLVLDLDETLIH           AQAHLVEVKFQISGISTLYYVHK
Sbjct: 181 KLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQISGISTLYYVHK 240

Query: 241 RPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGY 300
           RPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGY
Sbjct: 241 RPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGY 300

Query: 301 IKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDL 360
           IKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDL
Sbjct: 301 IKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDL 360

Query: 361 LNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           LNLLPFLESLRYTTDVRNILSLKNGERAFDIN
Sbjct: 361 LNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  400 bits (1028), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 218/367 (59%), Positives = 248/367 (67%), Gaps = 60/367 (16%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W+L+TFP+TLFEQ N    +S  S   +++S +                     +NL+ +
Sbjct: 84  WFLITFPITLFEQKNKKLPKS--SANLDTMSKS---------------------KNLNIL 120

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGR 175
           +E+D+ GG E+ILQRDT+ GSLL      K          +   KS SSSV   +KK+GR
Sbjct: 121 VEEDLSGGGEIILQRDTLNGSLL------KSRANQQHSHQSRHAKSSSSSVGLISKKIGR 174

Query: 176 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTL 235
           FLFPKKLIPRSILHSGRKKKLVLDLDETLIH           AQAHLVEVKF ISGISTL
Sbjct: 175 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTL 234

Query: 236 YYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILR 295
           YYVHKRPYCDLFLS V +WYDLIIFTASMKEYADPVIDWLE+SF G+FSKR+YRN CILR
Sbjct: 235 YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILR 294

Query: 296 DGVGYIKDLSIINDTNDDHGNELVRA------------------------------NSIL 325
           DGVGYIKDLSI+N     H                                     N++L
Sbjct: 295 DGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLL 354

Query: 326 HEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNG 385
            E+ILIDNSPVSYAMNVDNAIQV+GWISDPTDQDLLNLLPFLESLR TTDVRNILSLKNG
Sbjct: 355 SEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNG 414

Query: 386 ERAFDIN 392
           ERAF++N
Sbjct: 415 ERAFNVN 421

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  391 bits (1004), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/339 (58%), Positives = 255/339 (75%), Gaps = 11/339 (3%)

Query: 57  WYLLTFPLTLFEQN-NSNNGRSRDSQTA-NSLSDASSIANNNAFYVTKGRKRTEQLQNLD 114
           W++ TFPL++ E+     + R+R S  + N L  +SS  N+++    K   +   L  + 
Sbjct: 116 WFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSS---EKTNPKNCNLNTIP 172

Query: 115 SVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKM 173
             +EDD+    E+ILQRD VKGSLL A ++   P +    + + +  S S++V FGTK+M
Sbjct: 173 EAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTV-FGTKRM 231

Query: 174 GRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGIS 233
           GRFLFPKKLIP+S+L++ +KKKLV+DLDETLIH           +Q HLVEVKF +SGI 
Sbjct: 232 GRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIR 291

Query: 234 TLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCI 293
           TLY++HKRPYCDLFL+ VSKWYDLIIFTASMKEYADPVIDWLESSF  +FSKRYYR+ C+
Sbjct: 292 TLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCV 351

Query: 294 LRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWIS 353
           LRDGVGYIKDLSI+ D+ ++       ++S L ++I+IDNSPVSYAMNVDNAIQVEGWIS
Sbjct: 352 LRDGVGYIKDLSIVKDSEENGKG----SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 407

Query: 354 DPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           DPTD DLLNLLPFLE++RY+TDVRNIL+LK+GE+AF+IN
Sbjct: 408 DPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  389 bits (1000), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/341 (56%), Positives = 250/341 (73%), Gaps = 10/341 (2%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++ TFPL + E+   +  + R  ++ +S  + S+ ++++  +  K   +   L  +  +
Sbjct: 117 WFVFTFPLNVIERRVKHTDK-RHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEI 175

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASN---LYKVPGAAGSGKNNSAVKSMSSSVAFGTKK 172
           +EDD+    E+ILQRD VKGSLL A++     K      S    S     +++  FGTK+
Sbjct: 176 VEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKR 235

Query: 173 MGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGI 232
           MGRFLFPKKLIP+SIL++ +KKKLV+DLDETLIH           +Q HLVEVKF ISGI
Sbjct: 236 MGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGI 295

Query: 233 STLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHC 292
           STLY++HKRPYCDLFL+  SKWYDLIIFTASMKEYADPVIDWLE SF  +FSKRYYR+ C
Sbjct: 296 STLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDC 355

Query: 293 ILRDGVGYIKDLSIINDTNDD-HGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGW 351
           +LRDGVGYIKDLSI+  + ++  G+ L    S L ++I+IDNSPVSYAMNVDNAIQVEGW
Sbjct: 356 VLRDGVGYIKDLSILKSSEENGKGSSL----SSLDDVIIIDNSPVSYAMNVDNAIQVEGW 411

Query: 352 ISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           ISDPTD DLLNLLPFLE++RY+TDVRNIL+LK+GE+AF++N
Sbjct: 412 ISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNMN 452

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  385 bits (988), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++ TFPL++ E+   +  + R  +  NS + +S+ + N      K   +   L  +   
Sbjct: 116 WFVFTFPLSVIERRVKHTDK-RHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPET 174

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGR 175
           ++DD+    E+ILQRD VKGSLL A ++      + S  + S     +++  FGTK+MGR
Sbjct: 175 VDDDLNASDEIILQRDNVKGSLLKAQSVKSR-SRSYSKSDVSLTNHSNTNTVFGTKRMGR 233

Query: 176 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTL 235
           FLFPKKLIP+SIL++ +KKKLV+DLDETLIH           +Q HLVEVKF ISGI TL
Sbjct: 234 FLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTL 293

Query: 236 YYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILR 295
           Y++HKRPYCD FL+ VS+WYDLIIFTASMKEYADPVIDWLESSF  NFSKRYYR+ C+LR
Sbjct: 294 YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLR 353

Query: 296 DGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDP 355
           DGVGYIKDLSII  + +   N    + S L ++I+IDNSPVSYAMNVDNAIQVEGWISDP
Sbjct: 354 DGVGYIKDLSIIKSSEE---NGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDP 410

Query: 356 TDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           TD DLLNLLPFLE++RY+TDVRNIL+LK+GE+AF+IN
Sbjct: 411 TDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 447

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  379 bits (972), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 244/339 (71%), Gaps = 25/339 (7%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++LT PLTL E+      R + ++   +  ++S ++                L+++  V
Sbjct: 122 WFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELS---------------PLRSISEV 166

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVK----SMSSSVAFGTK 171
            E+D+    E  LQRDT+KGSLL AS+  K P      +  S +K    +M++++ FGTK
Sbjct: 167 GEEDLSTSDEFFLQRDTIKGSLLRASS-DKPPVFQ---RYKSTIKQDHEAMNTNI-FGTK 221

Query: 172 KMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISG 231
           KMGRFLFPKKLIPRSIL + RKK LV+DLDETLIH           +Q HLVEVKF I+G
Sbjct: 222 KMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSING 281

Query: 232 ISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNH 291
           ISTLYYVHKRP+CDLFLS VSKWY+++IFTASMKEYADPVIDWLE SF GNF+KR YR++
Sbjct: 282 ISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHN 341

Query: 292 CILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGW 351
           C+LRDGVGYIKDLS++ + N    N+       LHE+I+IDNSPVSYA+NVDNAIQVEGW
Sbjct: 342 CLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401

Query: 352 ISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFD 390
           ISDPTD DLLNLLP LE+LRYTTDVRN+L+LKNGE+ F+
Sbjct: 402 ISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMFE 440

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 253/337 (75%), Gaps = 7/337 (2%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           WY+ TFPL++ E+   +  + R+ +++++ + + + +++      K   +   L  +   
Sbjct: 116 WYVFTFPLSVIERRVKHTDK-RNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISET 174

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGR 175
           +EDD+    E+ILQRD VKGSLL A ++ K+   + S    S     S++  FGTK+MGR
Sbjct: 175 VEDDLNASDEIILQRDNVKGSLLRAQSV-KLRSRSYSKSEVSLTNHSSTNTVFGTKRMGR 233

Query: 176 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTL 235
           FLFPKKLIP+S+L++ +KKKLV+DLDETLIH           +Q HLVEVKF ISGI TL
Sbjct: 234 FLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTL 293

Query: 236 YYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILR 295
           Y++HKRPYCDLFL+ VSKWY+LIIFTASMKEYADPVIDWLESSF  +FS+RYYR+ C+LR
Sbjct: 294 YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLR 353

Query: 296 DGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDP 355
           DGVGYIKDLSII ++ ++       ++S L ++I+IDNSPVSYAMNVDNAIQVEGWISDP
Sbjct: 354 DGVGYIKDLSIIKNSEENEKG----SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDP 409

Query: 356 TDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           TD DLLNLLPFLE++RY+TDVRNIL+LK+GE+AF+IN
Sbjct: 410 TDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  372 bits (955), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 189/338 (55%), Positives = 244/338 (72%), Gaps = 20/338 (5%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++LTFPL+L E +    G++ +++    LS + +   +N+         +++L  ++  
Sbjct: 145 WFILTFPLSLIEHSVRRRGKATENE---HLSQSPATNKDNS--------PSKRLNVIEEA 193

Query: 117 LEDDMKGGE-MILQRDTVKGSLLNAS-NLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMG 174
           +EDD+  GE M LQ+D +KGSLL  + +  +       GK  ++  S +S++  GTK MG
Sbjct: 194 IEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNI-LGTKSMG 252

Query: 175 RFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGIST 234
           RF FPKKLIPRSIL+S +KK LV+DLDETLIH           +QAH++EV+F ISG+ST
Sbjct: 253 RFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVST 312

Query: 235 LYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCIL 294
           LYYVHKRPYCDLFLS V KWY+LIIFTASMKEYADPVIDWLESSF G+F++R YRNHCI 
Sbjct: 313 LYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIA 372

Query: 295 RDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISD 354
           RDGVGYIKDL  I D    +      A   L ++++IDNSPVSYAM+VDNAIQVEGWISD
Sbjct: 373 RDGVGYIKDLGNIKDPYSKN------ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISD 426

Query: 355 PTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           PTD +LLNLLPFLE+LRYTTDVRN+L+LKN E+AF ++
Sbjct: 427 PTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQLS 464

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 227/334 (67%), Gaps = 47/334 (14%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++++ PL L E    +  + + +                       ++ T  LQ++  +
Sbjct: 66  WWIISLPLLLIEYGLKSRLQRKST-----------------------KRSTGTLQSISEL 102

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGR 175
            EDD+ GG E+ LQRD VKGSL            A +    S   S SS+V  GTK+MGR
Sbjct: 103 EEDDLAGGDEIFLQRDAVKGSL------------APAKYRRSRSGSRSSTVMLGTKRMGR 150

Query: 176 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTL 235
           FLFPKKLIPRS+LH+ ++K+LV+DLDETLIH           AQ H+VE++F ISG+STL
Sbjct: 151 FLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTL 210

Query: 236 YYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILR 295
           YYVHKRP+CDLFLS VSKWYDL++FTASM+EYADPVIDWLE SF G FSKR YRN+CILR
Sbjct: 211 YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILR 270

Query: 296 DGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDP 355
           DGVGYIKDLSI+                 L E+IL+DNSP+SYAMNVDNAIQVEGWISDP
Sbjct: 271 DGVGYIKDLSIVCG-----------PTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDP 319

Query: 356 TDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           +D DLL LLPFLE+LRYTTDVR+IL+LKN E+AF
Sbjct: 320 SDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  362 bits (929), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 218/288 (75%), Gaps = 9/288 (3%)

Query: 109 QLQNLDSVLEDDMKGG-EMILQRDTVKGSLLNAS-NLYKVP--GAAGSGKNNSAVKSMSS 164
           +L +++  +E+D+  G E  LQRD VKGSLL A+ N +  P      S +N    ++  +
Sbjct: 161 KLGSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPN 220

Query: 165 SVAFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVE 224
           S  FGTKKMGRFLFPKKLIP+SIL+  +KK LV+DLDETLIH           +Q H+VE
Sbjct: 221 STVFGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVE 280

Query: 225 VKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFS 284
           VKF ISG+STLYYV KRPYCDLFL+ VSKWYD++IFTASMKEYADPVIDWLESSF G FS
Sbjct: 281 VKFSISGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFS 340

Query: 285 KRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDN 344
           +R YRN CILRDGVGYIKDL ++       G+ L  +   L ++I++DNSPVSYA+NVDN
Sbjct: 341 RRLYRNDCILRDGVGYIKDLKMVT-----RGSNLGTSPDRLEDVIIVDNSPVSYALNVDN 395

Query: 345 AIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           AIQVEGWI+DPTD DLLNL+P LE+L  TTDVRNILSLKNGE+AF+I+
Sbjct: 396 AIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNID 443

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  357 bits (917), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 237/337 (70%), Gaps = 15/337 (4%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           WY+LTFPL+L E+      R       +S     ++ +NN+F   +  K    L  ++ +
Sbjct: 125 WYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPEEPSK----LDAINEL 180

Query: 117 LEDDMKGGEMI-LQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGR 175
            EDD+  G+ I LQRD VKGSLL AS++ + P  + S K       +S++ +F +K+MG+
Sbjct: 181 TEDDLVSGDGIYLQRDNVKGSLLKASSV-RQPSLSRSMKT-----MVSNNTSFSSKRMGK 234

Query: 176 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTL 235
           FLFPKKLIP+SI  + R+KKLVLDLDETLIH           +Q H+VEVKF  SG+S L
Sbjct: 235 FLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSML 294

Query: 236 YYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILR 295
           YYVHKRPYCD FLS V KWYDLIIFTASMKEYADPVIDWLE+SF G F++RYYR  CI R
Sbjct: 295 YYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRR 354

Query: 296 DGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDP 355
           DGVGYIKDL+II     D  N  V   S L E+I++DNSP+SYAMN DNAIQVEGWISDP
Sbjct: 355 DGVGYIKDLTIIK----DDSNVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWISDP 410

Query: 356 TDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392
           TD  LLNLLP LE+LRYTTDVR+IL+LKNGERAF  N
Sbjct: 411 TDTALLNLLPLLEALRYTTDVRSILALKNGERAFYAN 447

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/335 (55%), Positives = 239/335 (71%), Gaps = 30/335 (8%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           WY++TFPL L E + +++   R+ +  NS  D                ++T  +  +   
Sbjct: 81  WYIITFPLNLIEHSPADDEDERNGEEGNSTGD---------------EEKTPSINIIVEE 125

Query: 117 LEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRF 176
            E+D+ G E+ILQ D VKGSL   S   +V     S +  S+++S S+  A G+++MGRF
Sbjct: 126 DEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKASTR--SSIRSGSTGTALGSRRMGRF 183

Query: 177 LFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLY 236
           LFPKKLIP+S+L++ +KK LVLDLDETLIH           +Q H+VEVKF +SGIS+LY
Sbjct: 184 LFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGISSLY 243

Query: 237 YVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRD 296
           +VHKRPYCDLFLS V+KWY L++FTASMKEYADPVIDWLESSF G+FS+R YR  CILRD
Sbjct: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303

Query: 297 GVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPT 356
           GVGYIKDLS+I+  +             L+EII++DNSP+SYAMNVDNAIQVEGWISDPT
Sbjct: 304 GVGYIKDLSLISKKS-------------LNEIIIVDNSPISYAMNVDNAIQVEGWISDPT 350

Query: 357 DQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDI 391
           D DLLNLLP LE+LR+TTD+RN+LSLK+GE+AF+I
Sbjct: 351 DTDLLNLLPLLEALRFTTDIRNVLSLKSGEQAFNI 385

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  353 bits (907), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 239/336 (71%), Gaps = 24/336 (7%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W+++TFPL L E+   +    ++    NS  +A  +   +            +L  +D  
Sbjct: 105 WFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSP-----------ELTVIDET 153

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSS-VAFGTKKMG 174
            EDD+ GG E+ LQRDT+KGSLL A+       +A    ++  VKS+SS+  +F +K+MG
Sbjct: 154 TEDDLAGGDEIYLQRDTIKGSLLKAT-------SAKQLSSSKTVKSISSNNTSFSSKRMG 206

Query: 175 RFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGIST 234
           +FLFPKKLIPRSI+ + R+KKLVLDLDETLIH           +Q H+VEVKF +SG+ST
Sbjct: 207 KFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVST 266

Query: 235 LYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCIL 294
           LYYVHKRPYCD FLS VSKWYDLIIFTASMKEYADPVIDWLE S    FS+R YR  CIL
Sbjct: 267 LYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCIL 326

Query: 295 RDGVGYIKDLSIINDTNDDHGNELVRA-NSILHEIILIDNSPVSYAMNVDNAIQVEGWIS 353
           RDGVGYIKDLS+I++ +   G + + A    L EII+IDNSP+SYAMNV+NAIQVEGWIS
Sbjct: 327 RDGVGYIKDLSVISEAS---GMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWIS 383

Query: 354 DPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           DPTD  LLNLLP LE+LR+TTDVRN+L+LKNGE+AF
Sbjct: 384 DPTDNALLNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  342 bits (878), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 189/359 (52%), Positives = 226/359 (62%), Gaps = 60/359 (16%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           WY+ TFPL L EQ+   N + +D+        ASS A +                     
Sbjct: 66  WYIFTFPLLLIEQHT--NRKYKDTPPLIDPKIASSSATD--------------------- 102

Query: 117 LEDDMKGGEMILQRDTVKGSLLNASNL--YKVPGAAGSGKN------------NSAVKSM 162
           L+D     E+ILQ D++KGSLL   N      P A     +            N +V S+
Sbjct: 103 LDDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSL 162

Query: 163 SSSVAFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHL 222
           +S+   G+K MGRFLFPKKLIP SIL + ++KKL+LDLDETLIH           +  HL
Sbjct: 163 TSNF-IGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHL 221

Query: 223 VEVKFQIS------------GISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADP 270
           +EVKF                +S+LYYV+KRPYCD FL+ VS WYDLIIFTASMKEYADP
Sbjct: 222 IEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADP 281

Query: 271 VIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIIL 330
           VIDWLE SF GNF KR YRNHCILRDG+GYIKDLS++N  N           S L+E+IL
Sbjct: 282 VIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDN----------QSTLNELIL 331

Query: 331 IDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           IDNSP+S+AMNVDNAIQV+GWISDPTD +LL LLPFLESLR+TTDVRNIL+LKNGERAF
Sbjct: 332 IDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAF 390

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  337 bits (864), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 241/356 (67%), Gaps = 46/356 (12%)

Query: 57  WYLLTFPLTLFEQNNS--NNGRSRDSQTANSLSDAS--SIANNNAFYVTKGRKRTEQLQN 112
           W+++TFPL+L E+ +S  N G   D+   +S S+AS  +I+  N+  ++     TE+   
Sbjct: 74  WFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRIST---ITEE--- 127

Query: 113 LDSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAG-----------SGKNNSAVKS 161
                EDD+ G EMILQ DTVKGSL   S   + P   G              +  ++K+
Sbjct: 128 -----EDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKT 182

Query: 162 MS--------SSVAFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXX 213
            S        +  A G+++MGRFLFPKKLIP+S+L+  +++ LVLDLDETLIH       
Sbjct: 183 SSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTS 242

Query: 214 XXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVID 273
               +Q H+VEVKF  SGISTLY+VHKRPYCDLFL+ ++KWY+L++FTASMKEYADPVID
Sbjct: 243 SSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVID 302

Query: 274 WLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDN 333
           WLESSF G FS+R YR  CILRDGVGYIKDLS+            V  N+ L +I +IDN
Sbjct: 303 WLESSFPGKFSRRLYRQDCILRDGVGYIKDLSV------------VVPNASLSDIFIIDN 350

Query: 334 SPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           SPVSYAM+VDNAIQVEGWISDPTD DLLNLLP LE+LR+TTD+RN+L+LK+GE AF
Sbjct: 351 SPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  332 bits (852), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 235/353 (66%), Gaps = 41/353 (11%)

Query: 57  WYLLTFPLTLFEQNN---SNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNL 113
           W+++TFPL+L E+++   S  G     Q   +L     ++  +    +K R  T Q +  
Sbjct: 79  WFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPRINTIQEE-- 136

Query: 114 DSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVP---------------GAAGSGKNNSA 158
               +DD+ G E+ LQ DTVKGSL  A+N   VP               G+  S K  S 
Sbjct: 137 ----DDDLGGDEIFLQPDTVKGSL-TATNC--VPPEHSQDLSRRQQHSKGSRQSPKAASV 189

Query: 159 VKSMSSSV--AFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXX 216
               SSS   A G+++MGRFLFPKKLIP+S+L+  + + LVLDLDETLIH          
Sbjct: 190 RSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSMSRGTSSSN 249

Query: 217 XAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLE 276
            +Q H+VEVKF ISGISTLY+VHKRPYCDLFL+ ++ WY+L++FTASMKEYADPVIDWLE
Sbjct: 250 SSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLE 309

Query: 277 SSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPV 336
           SSF G FS+R YR  CILRDGVGYIKDLS             V  N++L +I +IDNSPV
Sbjct: 310 SSFPGKFSRRLYRQDCILRDGVGYIKDLSA------------VAPNTLLSDIFIIDNSPV 357

Query: 337 SYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           SYAM+VDNAIQVEGWISDPTD DLLNLLP LE+LR+TTDVRNIL+LK+GE AF
Sbjct: 358 SYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAF 410

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  317 bits (813), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 212/333 (63%), Gaps = 65/333 (19%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W+++T PL L E         +  Q   S S    I           RK+          
Sbjct: 68  WFVITSPLILIEYG------LKSKQKVESTSRKGEII----------RKKE--------- 102

Query: 117 LEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRF 176
           ++DD+   EM LQRDTVKG L               GK            AFGTKKMGRF
Sbjct: 103 VDDDLAEDEMFLQRDTVKGGL--------------RGK------------AFGTKKMGRF 136

Query: 177 LFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLY 236
           LFPKKL+P+SIL + RKK+LV+DLDETLIH           AQ H+VEV+F  S ISTLY
Sbjct: 137 LFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY 196

Query: 237 YVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRD 296
           YVHKRP+CDLFLS VSKWYDLIIFTASMKEYADPVIDWLESSF G F KR YR++C++R+
Sbjct: 197 YVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVRE 256

Query: 297 GVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPT 356
           GVGYIKDLS++ +              +L E++LIDNSP SYA N DNAIQVEGWISDP+
Sbjct: 257 GVGYIKDLSVVTE--------------VLDEVVLIDNSPTSYARNEDNAIQVEGWISDPS 302

Query: 357 DQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           D DLLNLLP LE+LRY TDVR+IL LKNGE+A 
Sbjct: 303 DTDLLNLLPLLEALRYVTDVRSILGLKNGEKAL 335

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  300 bits (767), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 175/333 (52%), Positives = 212/333 (63%), Gaps = 60/333 (18%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++LTFPL+L EQ +S                              G +  E+ Q  ++V
Sbjct: 70  WFVLTFPLSLIEQTSSKEADG-----------------------APGPEAAEEEQLAEAV 106

Query: 117 LEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRF 176
            +DD+ G  M+LQ D+VK                       + +  +S  ++ + ++G+F
Sbjct: 107 EDDDLAGESMVLQEDSVK-----------------------SSRPSTSRSSYTSTRLGKF 143

Query: 177 LFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLY 236
           LFPKKLIP+SIL + RKK LVLDLDETLIH           +Q H+VEV F  SG+STLY
Sbjct: 144 LFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVSTLY 203

Query: 237 YVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRD 296
           YVHKRPYCDLFLS VSKWYDL+IFTASMKEYADPVIDWLES     FS+R YR+ C+LRD
Sbjct: 204 YVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRD 263

Query: 297 GVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPT 356
           GVGY+KDLSII+                L +II++DNSP+SYAMNVDNAIQVEGWISDPT
Sbjct: 264 GVGYVKDLSIISKN--------------LQDIIIVDNSPISYAMNVDNAIQVEGWISDPT 309

Query: 357 DQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           D  LLNLLP LE LR+TTD RNILSLKNGERAF
Sbjct: 310 DTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  297 bits (760), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 212/333 (63%), Gaps = 57/333 (17%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           W++LTFPL L E  +S +G         S+ +   I  N     ++G    E +++    
Sbjct: 76  WFVLTFPLNLIEHTSSKDG---------SVEEEEVIPTN-----SQGSGGGEVIED---- 117

Query: 117 LEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRF 176
             DD+ G  M+L  D++K                       + +  +S  ++ + ++G+F
Sbjct: 118 --DDLVGESMVLHEDSIK-----------------------SSRPSTSRSSYTSTRLGKF 152

Query: 177 LFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLY 236
           LFPKKLIP+SIL + RKK LVLDLDETLIH           +Q H+VEV F +SG+S+LY
Sbjct: 153 LFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLY 212

Query: 237 YVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRD 296
           YVHKRPYCDLFLS V KWYDL+IFTASM+EYADPVIDWLES     F+KR YR+ CILRD
Sbjct: 213 YVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYRSDCILRD 272

Query: 297 GVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPT 356
           G+GY+KDL++I+                L + I++DNSPVSYAMNVDNAIQVEGWISDPT
Sbjct: 273 GIGYVKDLTMISKN--------------LQDTIIVDNSPVSYAMNVDNAIQVEGWISDPT 318

Query: 357 DQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389
           D  LLNLLP LE LR+TTD RNILSLKNGE AF
Sbjct: 319 DTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  228 bits (582), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 189/339 (55%), Gaps = 70/339 (20%)

Query: 57  WYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQNLDSV 116
           WY++TFPL L E N   N   +      S +D+                RTE+L     V
Sbjct: 90  WYVITFPLNLMETNTQGN---KGLIQVGSETDS----------------RTEKLSKY--V 128

Query: 117 LEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGR 175
           +E+D+    E+I+ +D +K   +                               T+ +G+
Sbjct: 129 VEEDLSPTDEIIINQDKMKPRPI-------------------------------TEYLGK 157

Query: 176 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXX---------XXXXAQAHLVEVK 226
           F FPKKL+P+S+L S  +K LVLDLDETLIH                       HLVEV+
Sbjct: 158 FHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVR 217

Query: 227 FQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKR 286
           F  + ISTLY V KRPYCD+FL   S+WYD+ IFTASMKEYADPVIDWL+ +    F  R
Sbjct: 218 FPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYR 277

Query: 287 YYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAI 346
           +YR  C LR GVGY+KD+  +           +  +  L ++I+IDNSP+SYAM++DNAI
Sbjct: 278 WYREDCTLRPGVGYVKDIGTVATQ--------IETSRDLSQMIIIDNSPISYAMHLDNAI 329

Query: 347 QVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNG 385
           QV GWI+DP+D +LL+LLP L+++R+ TD R IL+LK+G
Sbjct: 330 QVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSG 368

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  110 bits (274), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 105/203 (51%), Gaps = 26/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L P+  +  G KK LVLDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 219 LPPKDPVFEG-KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKR 271

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V K Y++++FTAS+  Y DP++D L+    G    R +R+ C   DG  YI
Sbjct: 272 PGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYNYDG-NYI 328

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L ++I++DNSP SY ++  +AI +  W SD  D +LL
Sbjct: 329 KNLSQIG--------------RPLSDLIILDNSPASYILHPQHAIPISSWFSDAHDNELL 374

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L  +   DV  IL +
Sbjct: 375 DIMPLLEDLSKQKVPDVGKILDV 397

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score =  111 bits (277), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 108/203 (53%), Gaps = 24/203 (11%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L P+ I   GRKK L+LDLDETL+H             A  V +   I   +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVD-----SADFV-IPVTIDNQTHHVYVIKR 365

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  VS+ Y++++FTAS+  Y DP+++ L+ +       R +R  C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTI-IHHRLFRESCYTYEG-NYV 423

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS           +L R    L+EII++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 424 KNLS-----------QLGRP---LNEIIILDNSPASYIFHPQHAIPISSWFSDIHDNELL 469

Query: 362 NLLPFLESLRY--TTDVRNILSL 382
           ++LP L++L      DV NIL +
Sbjct: 470 DILPLLDNLANPDVLDVGNILDV 492

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score =  109 bits (272), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 106/205 (51%), Gaps = 25/205 (12%)

Query: 180 KKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVH 239
           + L+P        KK LVLDLDETL+H                V++  QI  +    YV 
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYLHTADFVLP--VDIDDQIHNV----YVI 261

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVG 299
           KRP  D FL  V++ Y++++FTAS+  Y DP++D L+SS   +   R +R  C   +G  
Sbjct: 262 KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG-N 318

Query: 300 YIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQD 359
           Y+K+L+ I                 L EI+++DNSP SY  +  +AI +  W SD  D +
Sbjct: 319 YVKNLAQIG--------------RPLSEIVILDNSPASYMFHPQHAIPISSWFSDTHDNE 364

Query: 360 LLNLLPFLESL--RYTTDVRNILSL 382
           LL+++P LE L  +Y  DV  IL +
Sbjct: 365 LLDIIPLLEDLSQKYVPDVGKILDV 389

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 108/207 (52%), Gaps = 26/207 (12%)

Query: 178 FPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYY 237
           F   L P++ + SG KK L+LDLDETL+H                V++  QI  +    Y
Sbjct: 504 FNTLLPPQNQIFSG-KKCLILDLDETLVHSSFKYLTSADFVIP--VDIDEQIHNV----Y 556

Query: 238 VHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDG 297
           V KRP  D FL  VSK +++++FTAS+  Y DP++D L+         R +R  C   +G
Sbjct: 557 VIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDKHRC--IHHRLFREACYDYEG 614

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
             YIK+LS I                 L E+I++DNSP SY  +  +AI +  W SD  D
Sbjct: 615 -NYIKNLSQIG--------------RPLSELIILDNSPASYIFHPQHAIPISSWFSDTHD 659

Query: 358 QDLLNLLPFLESL--RYTTDVRNILSL 382
            +LL++LP L+ L      D+RNIL++
Sbjct: 660 NELLDILPLLQDLAEENIPDIRNILNV 686

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 100/189 (52%), Gaps = 23/189 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P  +    +KK L+LDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMHSADFVLP--VEIDDQVHNV----YVIKR 269

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL+ VS+ Y++++FTAS+  YA+P++D L+ +  G    R +R  C   +G  YI
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 326

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L E I++DNSP SY  +  +A+ +  W SD  D +LL
Sbjct: 327 KNLSQIG--------------RPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELL 372

Query: 362 NLLPFLESL 370
           +++P LE L
Sbjct: 373 DIIPLLEDL 381

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 110/215 (51%), Gaps = 27/215 (12%)

Query: 172 KMGRFLFP--KKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQI 229
           + G++  P  K L+P    ++  KK L+LDLDETL+H                VE+  Q+
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQV 278

Query: 230 SGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYR 289
             +    YV KRP  + FL  V K +++++FTAS+  Y DP++D L++  V     R +R
Sbjct: 279 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKV--IHHRLFR 332

Query: 290 NHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVE 349
             C   +G  YIK+LS I                 L +II++DNSP SY  +  +AI + 
Sbjct: 333 EACYNYEG-NYIKNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPIS 377

Query: 350 GWISDPTDQDLLNLLPFLESLRYTT--DVRNILSL 382
            W SD  D +LL+++P LE L   T  DV  IL +
Sbjct: 378 SWFSDTHDNELLDIIPLLEDLSVKTSLDVGKILDV 412

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  107 bits (267), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 106/203 (52%), Gaps = 25/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P  +    +KK L+LDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  VS+ Y++++FTAS+  YA+P++D L+ +  G    R +R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L E I++DNSP SY  +  +A+ +  W SD  D +LL
Sbjct: 322 KNLSQIGRP--------------LSETIILDNSPASYIFHPQHAVPISSWFSDSHDNELL 367

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L  +   DV ++L +
Sbjct: 368 DIIPLLEDLSSKNVLDVGSVLDV 390

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score =  107 bits (268), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 94/178 (52%), Gaps = 23/178 (12%)

Query: 193 KKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVS 252
           KK LVLDLDETL+H                V++  QI  +    YV KRP  D FL  V 
Sbjct: 277 KKCLVLDLDETLVHSSFKYLHTADFVLP--VDIDDQIHNV----YVIKRPGVDEFLQRVG 330

Query: 253 KWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTND 312
           + Y++++FTAS+  Y DP++D L+ S   N   R +R+ C   +G  YIK+LS I     
Sbjct: 331 ELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQIG---- 383

Query: 313 DHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESL 370
                       L EII++DNSP SY  +  +AI +  W SD  D +LL++LP LE L
Sbjct: 384 ----------RPLSEIIILDNSPPSYIFHPQHAIPISSWFSDSHDNELLDILPLLEDL 431

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  107 bits (266), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 106/203 (52%), Gaps = 25/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P  +    +KK L+LDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYMHTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FLS V + Y++++FTAS+  YA+P++D L+ +  G    R +R  C   +G  YI
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L E I++DNSP SY  +  +A+ +  W SD  D +LL
Sbjct: 322 KNLSQIG--------------RPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELL 367

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L  +   DV ++L +
Sbjct: 368 DIIPLLEDLSSKNVLDVGSVLDV 390

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/194 (35%), Positives = 100/194 (51%), Gaps = 28/194 (14%)

Query: 177 LFPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLY 236
           L P KL+P       +KK L+LDLDETL+H                VE+  Q+  +    
Sbjct: 204 LLPPKLLPFQ-----QKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV---- 252

Query: 237 YVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRD 296
           YV KRP  D FL  VS+ Y++++FTAS+  YA+P++D L+ +       R +R  C   +
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRT--IHHRLFREACYNYE 310

Query: 297 GVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPT 356
           G  YIK+LS I                 L E I++DNSP SY  +  +A+ +  W SD  
Sbjct: 311 G-NYIKNLSQIG--------------RPLSETIILDNSPASYIFHPQHAVPISSWFSDTH 355

Query: 357 DQDLLNLLPFLESL 370
           D +LL+++P LE L
Sbjct: 356 DNELLDIIPLLEDL 369

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 109/215 (50%), Gaps = 27/215 (12%)

Query: 172 KMGRFLFP--KKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQI 229
           + G++  P    L+P     +  KK L+LDLDETL+H             +  VE+  Q+
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQV 291

Query: 230 SGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYR 289
             +    YV KRP  + FL  V K +++++FTAS+  Y DP++D L++  V     R +R
Sbjct: 292 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKV--IHHRLFR 345

Query: 290 NHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVE 349
             C   +G  YIK+LS I                 L +II++DNSP SY  +  +AI + 
Sbjct: 346 EACYNYEG-NYIKNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPIS 390

Query: 350 GWISDPTDQDLLNLLPFLESLRYTT--DVRNILSL 382
            W SD  D +LL+++P LE L   T  DV  IL +
Sbjct: 391 SWFSDTHDNELLDIIPLLEDLSVKTSLDVGKILDV 425

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 106/203 (52%), Gaps = 23/203 (11%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P        KK L+LDLDETL+H               ++ ++ +   I  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPDF----ILPIEIEDGQIHNVYVI-KR 355

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V KWY+++IFTAS+  YA+P++D L+       + R +R+ C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDH-NLINHRLFRDACYNYEN-NFI 413

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 LH+II++DNSP SY  +  +AI +  W SD  D +L+
Sbjct: 414 KNLSQIG--------------RPLHDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELI 459

Query: 362 NLLPFLESLRYTT--DVRNILSL 382
           ++LP L+ L + +  DV  IL +
Sbjct: 460 DILPLLKDLSHVSVDDVGKILDV 482

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score =  105 bits (261), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 99/192 (51%), Gaps = 25/192 (13%)

Query: 193 KKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVS 252
           KK L+LDLDETL+H                VE+  Q+  +    YV KRP  + FL  V 
Sbjct: 245 KKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKRPGVEEFLERVG 298

Query: 253 KWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTND 312
           K +++++FTAS+  Y DP++D L++  V     R +R  C   +G  YIK+LS I     
Sbjct: 299 KLFEVVVFTASVSRYGDPLLDILDTDKV--IHHRLFREACYNYEG-NYIKNLSQIGRP-- 353

Query: 313 DHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRY 372
                       L EII++DNSP SY  +  +AI +  W SD  D +LL+++P LE L  
Sbjct: 354 ------------LSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSV 401

Query: 373 TT--DVRNILSL 382
            T  DV  IL +
Sbjct: 402 KTSLDVGKILDV 413

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 105/203 (51%), Gaps = 26/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P++ +  G KK LVLDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 234 LLPKADMFKG-KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKR 286

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  +++ Y++++FTAS+  Y DP++D L+         R +R+ C   +G  YI
Sbjct: 287 PGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYEG-NYI 343

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L ++I++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 344 KNLSQIGRP--------------LSDMIILDNSPASYIFHPQHAIPISSWFSDAHDNELL 389

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L      DV  IL +
Sbjct: 390 DIIPLLEDLAEERVPDVGEILDV 412

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score =  105 bits (262), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 101/203 (49%), Gaps = 25/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P    H   KK LVLDLDETL+H                V++  QI  +    YV KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGADFVLP--VDIDDQIHNV----YVMKR 354

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V   ++++IFTAS+  Y DP++D L+     +   R +R  C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYEG-NYI 411

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L EII++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 412 KNLSQIG--------------RPLSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNELL 457

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L  +   DV  +L +
Sbjct: 458 DIIPLLEDLSEQSVPDVGKVLDI 480

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 104/203 (51%), Gaps = 25/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P     +  KK L+LDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  + FL  V K +++++FTAS+  Y DP++D L+++ V     R +R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNKV--IHHRLFREACYNYEG-NYI 344

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L +II++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 345 KNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELL 390

Query: 362 NLLPFLESLRYTT--DVRNILSL 382
           +++P LE L   T  DV  IL +
Sbjct: 391 DIIPLLEDLSVKTSLDVGKILDV 413

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score =  105 bits (262), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 98/191 (51%), Gaps = 23/191 (12%)

Query: 180 KKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVH 239
           + L+P       R+K LVLDLDETL+H                VE+  Q+  +    YV 
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFKYLHTADFVIP--VEIDNQVHNV----YVI 362

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVG 299
           KRP  D FL  V + Y++++FTAS+  Y DP++D L+   V     R +R+ C   +G  
Sbjct: 363 KRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKHNV--VHHRLFRDSCYNYEG-N 419

Query: 300 YIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQD 359
           YIK+LS I                 L ++I++DNSP SY  +  +AI +  W SD  D +
Sbjct: 420 YIKNLSQIG--------------RPLSDLIILDNSPASYIFHPHHAIPISSWFSDAHDNE 465

Query: 360 LLNLLPFLESL 370
           LL++LP LE L
Sbjct: 466 LLDILPLLEDL 476

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score =  104 bits (260), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 100/192 (52%), Gaps = 25/192 (13%)

Query: 193 KKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVS 252
           KK LVLDLDETL+H             A  V +   I   +   YV KRP  D FL  V 
Sbjct: 307 KKCLVLDLDETLVHSSFKYIDT-----ADFV-LPVTIDDQTHQVYVIKRPGVDEFLKRVG 360

Query: 253 KWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTND 312
           K +++++FTAS+  Y DP++D L+SS   +   R +R  C + DG  Y+K+LS I     
Sbjct: 361 KIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLSQIGRP-- 415

Query: 313 DHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLR- 371
                       L +II++DNSP SY  +  +AI +  W SD  D +LL+++P LE +  
Sbjct: 416 ------------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPILEDISK 463

Query: 372 -YTTDVRNILSL 382
            +  DV  IL +
Sbjct: 464 PFVPDVGKILDV 475

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score =  103 bits (257), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 101/203 (49%), Gaps = 25/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P        KK LVLDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQVHNV----YVIKR 281

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V + Y++++FTAS+  Y DP++D L+ +       R +R+ C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHC--IHHRLFRDSCYNYDG-NYI 338

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L ++I++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 339 KNLSQIGRP--------------LSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNELL 384

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           ++LP LE L      DV  IL +
Sbjct: 385 DILPLLEDLAEENVPDVGKILDV 407

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 98/192 (51%), Gaps = 25/192 (13%)

Query: 193 KKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVS 252
           KK LVLDLDETL+H                VE+  QI  +    YV KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIKRPGVDEFLKLVG 293

Query: 253 KWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTND 312
           + Y++++FTAS+  Y DP++D L+ +       R +R+ C   DG  YIK+LS I     
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQTQC--IHHRLFRDSCYNYDG-NYIKNLSQIG---- 346

Query: 313 DHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESL-- 370
                       L ++I++DNSP SY  +  +AI +  W SD  D +LL+++P LE L  
Sbjct: 347 ----------RPLSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNELLDIMPLLEDLAQ 396

Query: 371 RYTTDVRNILSL 382
               DV  IL +
Sbjct: 397 EQVPDVGKILDV 408

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 102/203 (50%), Gaps = 26/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L PR+   +G KK LVLDLDETL+H                V++  QI  +    YV KR
Sbjct: 273 LPPRAPAFNG-KKCLVLDLDETLVHSSFKYLRTADFVLP--VDIDDQIHNV----YVIKR 325

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V   Y++++FTAS+  Y DP++D L+         R +R  C   +G  YI
Sbjct: 326 PGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYEG-NYI 382

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L +II++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 383 KNLSQIG--------------RPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELL 428

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L  +   DV  +L +
Sbjct: 429 DIIPLLEDLSEKSVPDVGKVLDV 451

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 106/207 (51%), Gaps = 26/207 (12%)

Query: 178 FPKKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYY 237
           F   L PR    S  KK LVLDLDETL+H                VE++ QI  +    Y
Sbjct: 214 FKTLLSPRKPEFSN-KKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----Y 266

Query: 238 VHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDG 297
           V KRP  D FL  V + Y++++FTAS+  Y DP+++ L+ S   +   R +R  C   +G
Sbjct: 267 VIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG 324

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
             YIK+L+ I                 L +II++DNSP SY  +  +AI +  W SD  D
Sbjct: 325 -NYIKNLAQIGRP--------------LSDIIILDNSPASYMFHPQHAIPISSWFSDTHD 369

Query: 358 QDLLNLLPFLESLRYTT--DVRNILSL 382
            +LL+++P LE L + +  DV  IL +
Sbjct: 370 NELLDIIPLLEDLSHDSVLDVGKILDV 396

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 104/203 (51%), Gaps = 25/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P       RKK LVLDLDETL+H                V++  QI  +    YV KR
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 355

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V + +++++FTAS+  Y DP++D L+     +   R +R  C   +G  YI
Sbjct: 356 PGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFREACYNYEG-NYI 412

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS           +L R    L +II++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 413 KNLS-----------QLGRP---LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELL 458

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           +++P LE L   +  DV  +L +
Sbjct: 459 DIIPLLEDLSKSFVLDVGKVLDV 481

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 100/190 (52%), Gaps = 24/190 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHL-VEVKFQISGISTLYYVHK 240
           L P+  +    KK LVLDLDETL+H           A  +L V +  QI  +    YV K
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLPN---ADFNLPVNIDDQIHNV----YVIK 384

Query: 241 RPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGY 300
           RP  D FL  V K ++++IFTAS+  Y DP++D L+     +   R +R  C   +G  Y
Sbjct: 385 RPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKG-KSIHHRLFREACYNYEG-NY 442

Query: 301 IKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDL 360
           IK+LS           ++ R    L EII++DNSP SY  +  +AI +  W SD  D +L
Sbjct: 443 IKNLS-----------QMGRP---LSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNEL 488

Query: 361 LNLLPFLESL 370
           L+++P LE L
Sbjct: 489 LDIIPLLEDL 498

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score =  101 bits (252), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 102/203 (50%), Gaps = 26/203 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L P+     GRK  LVLDLDETL+H                VE+  Q+  +    YV KR
Sbjct: 298 LPPQRPEFRGRKC-LVLDLDETLVHSSFKYLHTADFVIP--VEIDNQVHNV----YVIKR 350

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V + +++++FTAS+  Y DP++D L+         R +R+ C   +G  YI
Sbjct: 351 PGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQ--YKAVHHRLFRDSCYNYEG-NYI 407

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L ++I++DNSP SY  +  +A+ +  W SD  D +LL
Sbjct: 408 KNLSQIG--------------RPLSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNELL 453

Query: 362 NLLPFLESL--RYTTDVRNILSL 382
           ++LP LE L  R   DV  IL +
Sbjct: 454 DILPLLEDLSSRKVPDVARILDV 476

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score =  101 bits (252), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 94/189 (49%), Gaps = 23/189 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P        +K LVLDLDETL+H                V++  QI  +    YV KR
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 353

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V K Y++++FTAS+  Y DP++D L+     +   R +R  C   +G  YI
Sbjct: 354 PGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYEG-NYI 410

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L  II++DNSP SY  +  +AI +  W SD  D +LL
Sbjct: 411 KNLSQIG--------------RPLSNIIILDNSPASYIFHPQHAIPISSWFSDTHDNELL 456

Query: 362 NLLPFLESL 370
           +++P LE L
Sbjct: 457 DIIPLLEDL 465

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score =  100 bits (250), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 94/189 (49%), Gaps = 23/189 (12%)

Query: 182 LIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKR 241
           L+P        KK LVLDLDETL+H                V +  Q+  +    YV KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLP--VNIDDQVHNV----YVIKR 282

Query: 242 PYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYI 301
           P  D FL  V + Y++++FTAS+  Y DP++D L+     +   R +R  C   +G  YI
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYEG-NYI 339

Query: 302 KDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLL 361
           K+LS I                 L EII++DNSP SY  +  +AI V  W SD  D +L+
Sbjct: 340 KNLSQIG--------------RPLSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNELI 385

Query: 362 NLLPFLESL 370
           +++P LE L
Sbjct: 386 DIVPLLEDL 394

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 98/192 (51%), Gaps = 25/192 (13%)

Query: 193 KKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVS 252
           +K LVLDLDETL+H                V++  Q+  +    YV KRP  D FL  V 
Sbjct: 282 RKCLVLDLDETLVHSSFKYLNIADFVLP--VDIDNQVQNV----YVSKRPGVDEFLKIVG 335

Query: 253 KWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTND 312
             Y++I+FTAS+  Y +P++D L+         R +R+ C + +G  Y+K+LS I     
Sbjct: 336 DLYEVIVFTASVSRYGNPLMDILDPHKY--IHHRLFRDSCYVYEG-NYVKNLSQIG---- 388

Query: 313 DHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESL-- 370
                       L +II++DNSP SY  +  +AI +  W SD  D +LLN++P LE L  
Sbjct: 389 ----------RPLGDIIILDNSPASYIFHPQHAIPISSWFSDSHDSELLNIIPLLEDLSK 438

Query: 371 RYTTDVRNILSL 382
           +   DV  IL +
Sbjct: 439 KSVLDVGKILDV 450

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 97.4 bits (241), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 118/229 (51%), Gaps = 26/229 (11%)

Query: 158 AVKSMSSSVAFGTKKMGRFLFP--KKLIPRSILHSGRKKKLVLDLDETLIHXXXXXXXXX 215
           +V+   S++++ + +  +F  P    L+P        +K LVLDLDETL+H         
Sbjct: 142 SVQDNFSTISYSSLQKNQFHAPGCNTLLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTA 201

Query: 216 XXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWL 275
                  ++ +FQ        YV KRP  D FL   SK ++++IFTAS+++Y +P++D L
Sbjct: 202 DFVLPVDIDDQFQN------VYVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDIL 255

Query: 276 ESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSP 335
           +S+       R +R+ C   +G  YIK+L+           +L R    L +II++DNSP
Sbjct: 256 DST-NDLVHHRLFRDACYNYNG-NYIKNLA-----------QLGRP---LSDIIILDNSP 299

Query: 336 VSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESL--RYTTDVRNILSL 382
            SY  + ++AI +  W SD  D +LL++LP L  L      DV  IL +
Sbjct: 300 TSYLFHPNHAIPISSWFSDAHDNELLSILPLLTDLANSKVIDVSKILDV 348

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 97/194 (50%), Gaps = 28/194 (14%)

Query: 193 KKKLVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVS 252
           KK LVLDLDETL+H                V +  QI  +    YV KRP  + FL  V 
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQTADFVLP--VNIDEQIHNV----YVIKRPGVEEFLKRVG 355

Query: 253 KWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTND 312
           + +++++FTAS+  Y DP++D L+         R +R  C   +G  YIK+LS       
Sbjct: 356 ELFEVVVFTASVARYGDPLLDILDPGRQL-IHHRLFREACYNYEG-NYIKNLS------- 406

Query: 313 DHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRY 372
                  +    L EII++DNSP SY  +  +AI +  W SD  D +LL+++P LE    
Sbjct: 407 -------QMGRPLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNELLDIIPLLE---- 455

Query: 373 TTDVRNILSLKNGE 386
             D+ NI SL  G+
Sbjct: 456 --DLANIKSLDVGK 467

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 84/145 (57%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y+D + + L+   +FV   S   ++ HC+ +DG
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFV---SYNLFKEHCVYKDG 273

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS              + N  L ++I+ID  P SY +  +NAI +E W  +  D
Sbjct: 274 V-HIKDLS--------------KLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 318

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
           + L+ L+PFLE L  + T DVR IL
Sbjct: 319 K-LVRLIPFLEYLATQQTKDVRPIL 342

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 83/145 (57%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP CD FL  +S++Y++++F+++   YA+ + + L+   +FV   S   ++ HC+ +DG
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFV---SYNLFKEHCVYKDG 264

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKD+S              + N  L +++ ID  P +Y +  +NAI ++ W  +  D
Sbjct: 265 V-HIKDIS--------------KLNRDLGKVVTIDTDPNTYKLQPENAIPMDPWTGEADD 309

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
           + LL L+PFLE L  +   DVR IL
Sbjct: 310 K-LLRLIPFLEYLATQQVNDVRPIL 333

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 81/146 (55%), Gaps = 23/146 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP CD FL  +S++Y++++F+++   Y+D + + L+   +F+   S   ++ HC+ +DG
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLDPIHAFI---SYNLFKEHCVYKDG 277

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           + +IKD+S              + N  + ++++ID  P  Y    +NAI  + W   P D
Sbjct: 278 I-HIKDIS--------------KMNRDVGKVVMIDTDPNCYKSQPENAIPAKPWDGTPDD 322

Query: 358 QDLLNLLPFLESL--RYTTDVRNILS 381
             LL L+PFLE L  +   DVR ILS
Sbjct: 323 -GLLQLIPFLEYLATQQVNDVRPILS 347

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 84/145 (57%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S+++++++F+++   Y+D + + L+   +FV   S   ++ HC+ +DG
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFV---SYNLFKEHCVYKDG 273

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS              + N  L ++I+ID  P SY +  +NAI ++ W  +  D
Sbjct: 274 V-HIKDLS--------------KLNRDLSKVIIIDTEPNSYKLQPENAIPMDPWNGEADD 318

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
           + L+ L+PFLE L  + T DVR IL
Sbjct: 319 K-LVRLIPFLEYLATQQTKDVRPIL 342

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 84/145 (57%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S+++++++F+++   Y++ + + L+   +FV   S   ++ HC+ +DG
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFV---SYNLFKEHCVYKDG 278

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS              + N  L ++I+ID  P SY +  +NAI +E W  +  D
Sbjct: 279 V-HIKDLS--------------KLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 323

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
           + L+ L+PFLE L  + T DVR IL
Sbjct: 324 K-LVRLIPFLEYLATQQTKDVRPIL 347

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 81/145 (55%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   YA+ V + ++   +FV   +   Y+ HC+ +DG
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMDPIHAFV---TYNLYKEHCLYKDG 272

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS +N                L + ++ID  P SY +  +NAI V+ W     D
Sbjct: 273 V-HIKDLSKLNRD--------------LGKTMIIDTDPNSYKLQPENAIPVKPW-EGTAD 316

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
             LL L+PFLE L  +  +DVR IL
Sbjct: 317 DGLLKLIPFLEYLATQQVSDVRPIL 341

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 83/146 (56%), Gaps = 25/146 (17%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y + + + L+   +F+   S   ++ HC+ +DG
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFI---SYNLFKEHCVYKDG 284

Query: 298 VGYIKDLSIIN-DTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPT 356
           V +IKDLS +N D N               ++++ID  P +Y +  +NAI V+ W     
Sbjct: 285 V-HIKDLSKLNRDVN---------------KVLIIDTEPNNYKLQPENAIPVKPW-DGKA 327

Query: 357 DQDLLNLLPFLESL--RYTTDVRNIL 380
           D +LL L+PFLE L  + T DV+ IL
Sbjct: 328 DDELLRLIPFLEYLATQQTEDVKPIL 353

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 81/145 (55%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y+D V + L+   +F+   +   ++ HC+ +DG
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAFI---TYNLFKEHCLYKDG 268

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS +N                L + ++ID  P +Y +  +NAI ++ W     D
Sbjct: 269 V-HIKDLSKLNRD--------------LGKTVIIDCDPNAYKLQPENAIPMKPW-DGKAD 312

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
             LL L+PFLE L  + T DVR +L
Sbjct: 313 DGLLKLIPFLEYLATQQTEDVRPVL 337

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 79/146 (54%), Gaps = 23/146 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y++ + + L+   +F+   S   Y+ HC+ ++G
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDPIHAFI---SYNLYKEHCVYKEG 282

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
                          DH  +L + N  L ++I++D  P SY +  +NAI ++ W     D
Sbjct: 283 ---------------DHIKDLSKLNRDLGKVIIVDTDPASYKLQPENAIPMQPW-DGKAD 326

Query: 358 QDLLNLLPFLESL--RYTTDVRNILS 381
             L+ L+PFLE L  +  +DVR IL 
Sbjct: 327 DKLMRLIPFLEYLATQQVSDVRPILE 352

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 82/145 (56%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  + FL  +S++Y++++F+++   Y++   + L+   +FV   S   ++ HC+ +DG
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFV---SYNLFKEHCVYKDG 276

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS              +    L ++I+ID  P SY +  +NAI ++ W  +  D
Sbjct: 277 V-HIKDLS--------------KLKRDLSKVIIIDTDPNSYKLQPENAIPMDPWNGEADD 321

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
           + L+ L+PFLE L  + T DVR IL
Sbjct: 322 K-LVRLIPFLEYLATQQTKDVRPIL 345

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 83/145 (57%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y + + + L+   +F+   S   ++ HC+ +DG
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFI---SYSLFKEHCVYKDG 292

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS              + N  ++++++ID  P +Y +  +NAI +E W  +  D
Sbjct: 293 V-HIKDLS--------------KLNRDVNKVLIIDTDPNNYKLQPENAIPMEPWKGEADD 337

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
           + LL L+PFLE L  +   DV+ IL
Sbjct: 338 K-LLRLIPFLEYLATQQVDDVKPIL 361

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 82/146 (56%), Gaps = 23/146 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y+D + + L+   +FV   S   ++ HC+ +DG
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFV---SYNLFKEHCLYKDG 277

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS +N                  ++++ID  P SY +  +NAI ++ W     D
Sbjct: 278 V-HIKDLSKLNRDE--------------KKVLIIDVDPNSYKLQPENAIPMKPW-DGQMD 321

Query: 358 QDLLNLLPFLESL--RYTTDVRNILS 381
             L+ L+PFLE L  +  +DVR +LS
Sbjct: 322 DKLIRLIPFLEYLATQQVSDVRPVLS 347

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 82/145 (56%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y++ + + L+   +FV   S   Y+ HC+ ++G
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFV---SYNLYKEHCVYKEG 273

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
             +IKDLS              + N  L ++++ID  P +Y    +NAI V+ W +   D
Sbjct: 274 T-HIKDLS--------------KLNRDLDKVLIIDCDPNNYKFQPENAIPVKPW-NGQAD 317

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
            +LL L+PFLE L  +  +DV+ IL
Sbjct: 318 DELLKLIPFLEYLATQQVSDVKPIL 342

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 83/152 (54%), Gaps = 23/152 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   YA+ + + ++   +F+   S   ++ HC+ +DG
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFI---SYNLFKEHCVYKDG 279

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS              + N  L ++++ID    SY +  +NAI ++ W     D
Sbjct: 280 V-HIKDLS--------------KLNRDLKKVMIIDTDENSYKLQPENAIPMDPW-DGKAD 323

Query: 358 QDLLNLLPFLESL--RYTTDVRNILSLKNGER 387
             LL L+PFLE +  +   DVR IL   + +R
Sbjct: 324 DKLLRLIPFLEYMATQQVEDVRPILKSYHNKR 355

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 95/189 (50%), Gaps = 44/189 (23%)

Query: 196 LVLDLDETLIHXXXXXXXXXXXAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWY 255
           LVL L++ L+H                     Q SG  T     KRP  D FL  +S++Y
Sbjct: 197 LVLSLEDLLVHSEWT-----------------QQSGWRT----AKRPGVDYFLGYLSQYY 235

Query: 256 DLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDD 313
           ++++F+++   YA+ + + L+   +F+   +   ++ HC+ +DGV +IKDLS +N     
Sbjct: 236 EIVLFSSNYMMYAEKIAEKLDPIHAFI---TYNLFKEHCLYKDGV-HIKDLSKLNRD--- 288

Query: 314 HGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESL--R 371
                      L ++++ID    S+ +  +NAI +E W     D+ LL L+PFLE L  +
Sbjct: 289 -----------LGKVLIIDTDENSFKLQPENAIYLEPWDGKADDR-LLRLIPFLEYLATQ 336

Query: 372 YTTDVRNIL 380
             +DVR IL
Sbjct: 337 QVSDVRPIL 345

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 79/145 (54%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y+D V + L+   +F+   +   ++ HC+ +DG
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAFI---TYNLFKEHCLYKDG 269

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           V +IKDLS +N                L + I++D  P +Y +  +NAI +  W     D
Sbjct: 270 V-HIKDLSKLNRD--------------LGKTIIVDCDPNAYKLQPENAIPMRPW-DGKAD 313

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
             LL L+PFLE L  +   DVR +L
Sbjct: 314 DGLLRLIPFLEYLATQQMDDVRPVL 338

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 79/145 (54%), Gaps = 23/145 (15%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   +++ + + L+   +F+   +   ++ HC+ +DG
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLDPIHAFI---TYNLFKEHCVYKDG 283

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
           + +IKDLS +N                L + I+ID    ++ +  +NAI  E W     D
Sbjct: 284 I-HIKDLSHLNRD--------------LGKTIIIDTDANAFKLQPENAIHAEPW-DGKAD 327

Query: 358 QDLLNLLPFLESL--RYTTDVRNIL 380
            +LL  +PFLE L  + T D+R IL
Sbjct: 328 HELLTYIPFLEYLVTQPTEDIRPIL 352

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 82/151 (54%), Gaps = 23/151 (15%)

Query: 234 TLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNH 291
           T +   KRP  D FL  +S++Y++++F+++   Y++ + + L+   +F+   S   ++ H
Sbjct: 205 TGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDPLHAFI---SYNLFKEH 261

Query: 292 CILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGW 351
           C+ +D V +IKDLS +N                + +++++D    SY +  +NA+ +  W
Sbjct: 262 CVYKDHV-HIKDLSKLNRD--------------VRKVVIMDTDANSYKLQPENALPMAPW 306

Query: 352 ISDPTDQDLLNLLPFLESL--RYTTDVRNIL 380
              P D+ L+ ++PFLE L  +   DVR +L
Sbjct: 307 DGKPDDK-LIQMIPFLEYLATQQVDDVRPVL 336

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 81/148 (54%), Gaps = 22/148 (14%)

Query: 240 KRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDG 297
           KRP  D FL  +S++Y++++F+++   Y++ + + L+   +F+   S   ++ HC+ + G
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFI---SYNLFKEHCVYKKG 247

Query: 298 VGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTD 357
             +IKDLS              + N  ++++I+ID    +Y +  +NAI ++ W S   D
Sbjct: 248 -KHIKDLS--------------KLNRDVNKVIIIDTDKNNYKLQPENAIPMKPW-SGTAD 291

Query: 358 QDLLNLLPFLESLRYTTDVRNILSLKNG 385
            +L+ L+PFLE L  T  V N+  + N 
Sbjct: 292 DELIKLIPFLEYLA-TQQVNNVKPILNS 318

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 74/144 (51%), Gaps = 23/144 (15%)

Query: 241 RPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLES--SFVGNFSKRYYRNHCILRDGV 298
           RP  D  L  +S +Y+ ++F ++   Y+  V++ L+   +F+   +   +++HC+ +DG+
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDPIRAFI---TYNLFKDHCVYKDGI 273

Query: 299 GYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQ 358
            +IKDLS +N                L + ++ID  P S  + ++NAI  E W     D 
Sbjct: 274 -HIKDLSHLNRD--------------LGKTLIIDTDPNSVKLQMENAILAEPWDGK-ADD 317

Query: 359 DLLNLLPFLESL--RYTTDVRNIL 380
            LL  +PFLE L  +   DVR IL
Sbjct: 318 ALLRYIPFLEYLVTQPINDVRPIL 341

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 236 YYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPV 271
           YYV  RP    F   VSK Y++ I+T + + YA  +
Sbjct: 229 YYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEI 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,275,449
Number of extensions: 1683841
Number of successful extensions: 9303
Number of sequences better than 10.0: 115
Number of HSP's gapped: 9399
Number of HSP's successfully gapped: 115
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)