Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F030007.353ON28228214700.0
Kpol_530.287.353ON2742827043e-92
Skud_12.2637.353ON2742836662e-86
Suva_10.2947.353ON2752836374e-82
NCAS0E028507.353ON2812916262e-80
YLR199C (PBA1)7.353ON2762856036e-77
Smik_12.2587.353ON2742835843e-74
KAFR0L015007.353ON2792895811e-73
TDEL0C019507.353ON2732875792e-73
ZYRO0F11770g7.353ON2722835697e-72
CAGL0A03993g7.353ON2722865262e-65
KNAG0B026007.353ON2792905176e-64
NDAI0E044507.353ON2212315101e-63
SAKL0F11440g7.353ON2722923975e-46
TBLA0E020707.353ON2522953861e-44
KLTH0H01188g7.353ON2672913696e-42
Kwal_56.246507.353ON2522653372e-37
KLLA0D12276g7.353ON2582872361e-22
Ecym_47207.353ON2612921922e-16
ACL145W7.353ON2342571482e-10
KLLA0F05093g7.313ON37284721.4
ZYRO0F16544g1.88ON102855712.1
TDEL0G028802.358ON23699692.4
YLR381W (CTF3)4.235ON73392684.5
TPHA0G018508.630ON52938684.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F03000
         (282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   570   0.0  
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   275   3e-92
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   261   2e-86
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   249   4e-82
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   245   2e-80
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   236   6e-77
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   229   3e-74
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   228   1e-73
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   227   2e-73
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   223   7e-72
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   207   2e-65
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   203   6e-64
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   201   1e-63
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   157   5e-46
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   153   1e-44
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   146   6e-42
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   134   2e-37
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...    96   1e-22
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    79   2e-16
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    62   2e-10
KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {...    32   1.4  
ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON} sim...    32   2.1  
TDEL0G02880 Chr7 (553008..553718) [711 bp, 236 aa] {ON} Anc_2.35...    31   2.4  
YLR381W Chr12 (879723..881924) [2202 bp, 733 aa] {ON}  CTF3Outer...    31   4.5  
TPHA0G01850 Chr7 complement(383439..385028) [1590 bp, 529 aa] {O...    31   4.9  

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/282 (100%), Positives = 282/282 (100%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60
           MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60

Query: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES 120
           PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES
Sbjct: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES 120

Query: 121 KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSD 180
           KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSD
Sbjct: 121 KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSD 180

Query: 181 RVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSIET 240
           RVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSIET
Sbjct: 181 RVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSIET 240

Query: 241 ISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           ISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI
Sbjct: 241 ISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  275 bits (704), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 129/282 (45%), Positives = 198/282 (70%), Gaps = 8/282 (2%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60
           MLFKQWN+   PRH+L SP ++ N +SLQL ++PEV M       ++NV++TTK M+ LF
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPETDLSKYKNVVLTTKIMDPLF 60

Query: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES 120
           P+K L+  K+ +++++L ++E++ V  +E++SWDY+ENFPNEV             SN  
Sbjct: 61  PSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRD--------SNNR 112

Query: 121 KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSD 180
           +  +F  PI A+  T++I IEENFIKMS IFSN+ AE+++  +L   N ++  + +GTSD
Sbjct: 113 RLLSFSSPIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSD 172

Query: 181 RVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSIET 240
           R+  I+KLT ++ +L  PEF+TGF+GS ++QL+  EV  +  ++ PSEGPIGFEK++++ 
Sbjct: 173 RILNIKKLTQDHCSLEPPEFVTGFIGSILTQLISKEVNVFTGILAPSEGPIGFEKMTLDV 232

Query: 241 ISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           I ELIDIC+E L+I   +YS +  R+W++ G+A+GAQ+GLYI
Sbjct: 233 IKELIDICQELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  261 bits (666), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 133/283 (46%), Positives = 188/283 (66%), Gaps = 12/283 (4%)

Query: 3   FKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNALFP 61
           FKQWNDL EPRHQL  P +S N++SL+   IP V +  +L    +  VI+TTK MN LFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 62  NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESK 121
              L LT +GE+ SSL +  +    + + YSW+Y ENFPNEVD  S    ESE  +++  
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPIS----ESE--TSKET 114

Query: 122 KYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181
           +YNF  PI ++ +TLL SIEENFI +SPIF N+ +  I+  ++    ++  I+ +G+SDR
Sbjct: 115 QYNFSFPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLI---KTSPDIIVIGSSDR 171

Query: 182 VAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP--NYKAVIVPSEGPIGFEKLSIE 239
           ++ ++K+T    TL  PEFITGF+GS ++QL+I E    N+K +IVPSEGP GFEK+S+ 
Sbjct: 172 ISNMKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLS 231

Query: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
            +  LID+C + L  +  KYS E +RLW+   +A+GAQ+GLYI
Sbjct: 232 DMGSLIDVCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  249 bits (637), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 184/283 (65%), Gaps = 11/283 (3%)

Query: 3   FKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNALFP 61
           FKQWNDL EPRHQL  P +S N++SL++  +P+V +  +L    +  V++TTK MN LFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 62  NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESK 121
              L L  +GE+ +SL++ E   +   + +SW+Y ENFPNE++  S+ A      SNE  
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTAT-----SNEET 115

Query: 122 KYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181
            YNF  PI ++ KTLL SIEENFI +SPIF N+ +  I   ++    ++  ++ +GTSDR
Sbjct: 116 LYNFSFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLV---KTSPDVIIIGTSDR 172

Query: 182 VAAIRKLTPENSTLVAPEFITGFVGSFISQLVIL--EVPNYKAVIVPSEGPIGFEKLSIE 239
           ++ ++ +T +  TL  PEF+TGF+GS ++QL+    +   +K ++VPSEGP GFEK S+ 
Sbjct: 173 ISNMKIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLS 232

Query: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
            +  LID+C +   ++  KYS E HRLW+   +A+GAQ+GLYI
Sbjct: 233 DMGSLIDVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  245 bits (626), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 125/291 (42%), Positives = 191/291 (65%), Gaps = 19/291 (6%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60
           MLFKQWN+  EPRHQL  P LS N ESLQ   IP+V   ++ ++++E +I+TT+ MN LF
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60

Query: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES 120
           P K +    +G++ + L L E++     + +SW++ ENFPNE D       ++E   N+ 
Sbjct: 61  PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFD------PDNEDRENQQ 114

Query: 121 KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSD 180
           + +NF+ P+ A  K ++ISI++NF+K+SPIFSN+ ++K+++ +       I  L LG+SD
Sbjct: 115 QAFNFEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQL----PRTIKPLILGSSD 170

Query: 181 RVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP--------NYKAVIVPSEGPIG 232
           R+A+++++     TLV PEFITGF+ S +++L I             + A++VPSEGP+G
Sbjct: 171 RIASVKEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLG 230

Query: 233 FEKLSIETISELIDICKENLNINDPK-YSNESHRLWKVAGSAMGAQTGLYI 282
           FEKL++  I +LID+ KE     DPK Y+ ES+R WK+AGS +GAQ+GLYI
Sbjct: 231 FEKLNLTVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  236 bits (603), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 176/285 (61%), Gaps = 12/285 (4%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNAL 59
           MLFKQWNDL EP+H L  P +S N++SL++  +P+V    +L    +   ++TTK MN L
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60

Query: 60  FPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNE 119
           FP   L LT +GE+ ++L +       ++  +SW+Y ENFPNEVD   +     E     
Sbjct: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADE----- 115

Query: 120 SKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTS 179
              Y F  PI ++ KTLL S+EENFI +SPIF N+ +  I+  +  F   +  I+ +GTS
Sbjct: 116 -TVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQF---SPDIIVIGTS 171

Query: 180 DRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPN--YKAVIVPSEGPIGFEKLS 237
           D++A+++ +T    TL  PEFITGF+GS ++QL++       +K ++ PSEGP GFEKLS
Sbjct: 172 DKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLS 231

Query: 238 IETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           +  +  L+D+C + L     +YS E +RLW+   +A+GAQ+GLYI
Sbjct: 232 LSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  229 bits (584), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 179/283 (63%), Gaps = 12/283 (4%)

Query: 3   FKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNALFP 61
           FKQWN++ EPRH L  P +S N+ SL+   +P+V +  +L    +  V++TTK MN LFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 62  NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESK 121
              L L  VG++ ++L +  +  V +   +SW++ ENFPNEVD   + A+  E       
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDE------T 114

Query: 122 KYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181
           KY+F  PI ++ KTLL SIEENF+ +SPIF N+ +  I+  ++    S+  I+ +GTSD+
Sbjct: 115 KYDFSFPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLV---ESSPEIIVIGTSDK 171

Query: 182 VAAIRKLTPENSTLVAPEFITGFVGSFISQLV--ILEVPNYKAVIVPSEGPIGFEKLSIE 239
           +A ++ +T +  +L  PEFITGF+GS ++QLV  + +   +K ++VPSEGP G+EKLS+ 
Sbjct: 172 IANMKVMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLS 231

Query: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
            +  L+ +C + L  +   Y  E +RLW+   +A+GAQ+GLYI
Sbjct: 232 DMGSLVSLCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  228 bits (581), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 189/289 (65%), Gaps = 17/289 (5%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNAL 59
           MLFKQWN+L EPRHQL SP +  N ESLQ   +P+V + + + + D++ +I+TTK MN L
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60

Query: 60  FPNKTLNLTKVGELSSSLVLNENEKVPTAE-HYSWDYKENFPNEVDIYSQEAIESEIGSN 118
           FP   L +  +G + ++L+L E++     + HYSWD+ ENFPNE +     ++ES  G+N
Sbjct: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFN----PSMESATGNN 116

Query: 119 ESKKYNFQIPI--MAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTL 176
               ++F+ PI  ++   TLLISI+ENF+K+SPIF NL ++K+   I    N    IL L
Sbjct: 117 ---NFSFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSI---NNDKSSILLL 170

Query: 177 GTSDRVAA-IRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEK 235
           G SD+++  I+ +T +N ++  PEFITGF+GS + +L+ +   N++ +IVPSEGPIGFEK
Sbjct: 171 GASDKISNNIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEK 230

Query: 236 LSIETISELIDICKENLN--INDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           LS+ T+ ELI+     L   ++   Y +E HR WK+ GSA   Q+GLYI
Sbjct: 231 LSLSTMEELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  227 bits (579), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 182/287 (63%), Gaps = 19/287 (6%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60
           MLFKQWN++AEPRHQL SP +  N  +LQ   +P+V++  +  ++F  VI+T+  MN LF
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPPIDLQNFSRVILTSAIMNPLF 60

Query: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES 120
           P K L  T +G+L   L L+  +       +SW++ ENFPNEVD        + +    S
Sbjct: 61  PEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVD-------PAYVVEERS 113

Query: 121 KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIG-----ILT 175
           K +    PI+++ +TLLIS++ENF+K SPIF N  A+ ++      C    G     ++ 
Sbjct: 114 KTFELCAPIVSFGRTLLISVKENFLKTSPIFLNQIAKSVV------CKLAQGAFEGEVVV 167

Query: 176 LGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEK 235
           LGTSD++  ++ ++ + +TL  PEF+T FVG+ I+QL+   +P ++ +I PSEGP+GFEK
Sbjct: 168 LGTSDQITELKPVSDKETTLNPPEFVTSFVGAVITQLIEKSLP-FQGLIAPSEGPVGFEK 226

Query: 236 LSIETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           L++ T+ ELI +C + ++ N   Y NE +R W++ G+A+GAQ+GLYI
Sbjct: 227 LNLVTMEELITLCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  223 bits (569), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 182/283 (64%), Gaps = 12/283 (4%)

Query: 1   MLFKQWNDLAEPRHQLMSP-SLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNAL 59
           MLFKQWN++AEPRH L SP ++  + ESLQ  ++P V + N+ +  F  + +TT  M+ L
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELPNINWNKFHKIFLTTGIMDPL 60

Query: 60  FPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNE 119
           FP + L + K+G++ ++L ++ N++    E YSW+++ENFPNEV++   +       +++
Sbjct: 61  FPKELLGVMKLGDIRTTLTIDRNQQHENGE-YSWNFEENFPNEVNLNGGQD------NDD 113

Query: 120 SKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTS 179
            +   F   + A+   LL+ ++ENF+K+SPI  N  A+ +L V   F  ++  +  LGTS
Sbjct: 114 GQSLTFVTTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSV---FDGTHHELKVLGTS 170

Query: 180 DRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSIE 239
           DR+  ++ ++   S L  PEF+TGF+GS ++QL +  +P ++  I PSEG IGFEK+S+ 
Sbjct: 171 DRITELKSISHLRSDLQPPEFVTGFIGSILTQLTVKNIP-FEGFIAPSEGAIGFEKMSMN 229

Query: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           T+ ELIDIC + +N N  KY +E +R W++   A+G+ +GLY+
Sbjct: 230 TMPELIDICGQWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  207 bits (526), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 177/286 (61%), Gaps = 18/286 (6%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYE--DFENVIVTTKTMNA 58
           MLFKQWN+L+EPR+ L +P+L  N ESLQL  +P+V + +  +E  + + VI+TTKTM+ 
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 59  LFP-NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGS 117
            F  +KT+ + K+ +++ SL + +N +   A H +WD+ ENFPNEV+    E        
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPKNLQTHEATH-TWDFGENFPNEVEPLQDE-------- 111

Query: 118 NESKKYNFQIPI-MAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTL 176
            E + ++ + PI +  D+TL +SI+ENF+ +SPIF+   ++ I K +    N    I+ L
Sbjct: 112 -EQRTFSLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKL----NRGHEIVIL 166

Query: 177 GTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKL 236
           G SDR+   +  T  N +LV PEF+TGF+GS +S L       + A I PSEGP GFEKL
Sbjct: 167 GCSDRIEDTKICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQGFEKL 226

Query: 237 SIETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           S  T+  +ID C + ++ +  +Y+ E ++ WK   S+ GAQ+GLY+
Sbjct: 227 SSTTVDSIIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  203 bits (517), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 118/290 (40%), Positives = 166/290 (57%), Gaps = 19/290 (6%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNAL 59
           MLFK WN+  EPRH L +P +  N ESLQ   +P V++     +    +     K MN L
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60

Query: 60  FPNKTLNLTKVGELSSSLVLNEN--EKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGS 117
           F     +    GEL +SL LNE+   +  T     WDY+ENFPNE D  S          
Sbjct: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDT-------R 113

Query: 118 NESKKYNFQIPIMAYD--KTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILT 175
            ++K    ++PI+  +   TLLIS++ENF+K+SPIF+N+ A K+     T  N+   IL 
Sbjct: 114 EDTKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLR----TLLNTQTKILL 169

Query: 176 LGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEK 235
           +G+SD++ + + ++    TL  PEFITGF+G  I +LV     N+K  IV SEGP GFEK
Sbjct: 170 VGSSDKIYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEK 229

Query: 236 LSIETISELIDICKE---NLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           LS+E++ ELID   +   + NIN   +    H+LWK+ G+AM AQ+GLYI
Sbjct: 230 LSLESMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  201 bits (510), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 108/231 (46%), Positives = 153/231 (66%), Gaps = 14/231 (6%)

Query: 56  MNALFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEI 115
           MN LFP   L L  V  +S++L LN ++ +     +SW+Y ENFPNE D   ++   SE 
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSE- 59

Query: 116 GSNESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILT 175
                K Y+F  PI A D+TL+ISI+ENF+K+SPIFSN+ ++ +++ +      N  IL 
Sbjct: 60  -----KSYDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLVQALPL----NKEILI 110

Query: 176 LGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP-NYKAVIVPSEGPIGFE 234
           LGTSDRVA +RK++ E  TL  PEF+TGF+GS I++L +     N+ A+IVPSEGP GFE
Sbjct: 111 LGTSDRVAVMRKISNEIDTLEPPEFVTGFIGSLITELNLHNAKYNFDAIIVPSEGPTGFE 170

Query: 235 KLSIETISELIDICKEN---LNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           KL++  + +LIDI K     LNI+   Y+ + +R WK+AG+A+GAQ+GLYI
Sbjct: 171 KLNLTIMQDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  157 bits (397), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 163/292 (55%), Gaps = 30/292 (10%)

Query: 1   MLFKQWNDLAEPRHQLMSP-SLSTNIESLQLQNIPEVSMTN-LKYEDFENVIVTTKTMNA 58
           MLFK WN+ AEPRHQL +P + + N ESLQ   +P V +T  +    F  +++ TK +  
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 59  LFPNKTLNLTKVGELSSSLVLNENEKVPTA--EHYSWDYKENFPNEVDIYSQEAIESEIG 116
           LFP+    +T + E   ++        PTA  + +   Y +      + Y QE++  +  
Sbjct: 61  LFPSTICPMTTISEFQVTI-----PPQPTAIKKAHGSSYGD------EDYEQESLPDK-- 107

Query: 117 SNESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNS--NIGIL 174
             E    +FQ+    ++  L I IEENF+ +SPI  NL +++I+++    C S   +  +
Sbjct: 108 KPEEIIVSFQV--EKFNDILFICIEENFLHVSPIAWNLLSQQIIRL----CKSKNTLQTI 161

Query: 175 TLGTSDRVAAIRKL--TPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIG 232
            LGTSDR+  ++ +  T     L  PEF+T    S I+ L++ ++P +K++I PSEGP G
Sbjct: 162 VLGTSDRITTLKSVGSTLGLPDLEPPEFVTNCTASLITTLILHDLP-FKSLIAPSEGPSG 220

Query: 233 FEKLSIETISELIDICKENLNI--NDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           FEKLS+ ++ +L + C E +    N   Y  E HR W++ G+AMGAQTGLYI
Sbjct: 221 FEKLSLVSMDQLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  153 bits (386), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 153/295 (51%), Gaps = 56/295 (18%)

Query: 1   MLFKQWNDLAEPRHQLMS----PSLSTNIESLQLQNIPEVSMTNLKYED---FENVIVTT 53
           MLFKQW++ AEPRH + S    P    N +SLQ   +P V + +   +D   +E +IV T
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPD-TLQDITIYEQIIVAT 59

Query: 54  KTMNALFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIES 113
           + +  LFP + LN T +G                                       IE 
Sbjct: 60  RVLMPLFPKEILNFTSLGN--------------------------------------IEV 81

Query: 114 EIGSNESKKYNFQIPIM-AYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIG 172
           ++  +E+  +  + PI    ++TL+I ++EN +++ PIF N+    I K I T   + + 
Sbjct: 82  KLNVSEATAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNV----ISKTICTMFGNQLK 137

Query: 173 ILTLGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIG 232
            L  GTSDR++ I+ +   N TL+ PEFITGF+GS IS L +     +   +VPSEGP+G
Sbjct: 138 FLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLG 197

Query: 233 FEKLSIETISELID----ICKE-NLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           FEKL++ET+  LI     I K  + N+N   Y  E +R W++ G+ +G Q+GLYI
Sbjct: 198 FEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  146 bits (369), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 157/291 (53%), Gaps = 33/291 (11%)

Query: 1   MLFKQWNDLAEPRHQLMSP-SLSTNIESLQLQNIPEVSMTN-LKYEDFENVIVTTKTMNA 58
           MLFKQWN+ +EPRH L +P   +T+++SLQ   +PEV +   +    F+   + T    +
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60

Query: 59  LFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSN 118
           LF ++   L +  ++SS +V+ + +     +H    Y+E++  + D  S         ++
Sbjct: 61  LFEDR---LARAEQISSFVVVWQTKG--REQHL---YREDYQTQEDSRS---------TD 103

Query: 119 ESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGT 178
           E+K+  F +  +  D TL I + E+F+ + PI  NL + +I K+        + +L  G+
Sbjct: 104 ETKRLEFPVHKLD-DGTLFICVREDFLHVPPISINLLSREIAKLC-----GGLEVLLFGS 157

Query: 179 SDRVAAIRKLT-PEN-----STLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIG 232
           SDRV  ++ +  P N       L  PE IT F  S ++QL+  +V  +   + PSEGP G
Sbjct: 158 SDRVERVKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKV-RFDGYVAPSEGPSG 216

Query: 233 FEKLSIETISELIDICKENLNI-NDPKYSNESHRLWKVAGSAMGAQTGLYI 282
           +EKLS+ET+  LID+C   +   N   Y    HR W++ G+ MGAQTGLY+
Sbjct: 217 YEKLSMETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  134 bits (337), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 146/265 (55%), Gaps = 34/265 (12%)

Query: 27  SLQLQNIPEVSMTN-LKYEDFENVIVTTKTMNALFPNKTLNLTKVGELSSSLVLNENEKV 85
           SLQL  +PEV +T  LK   F+ V + T+   +LF         VG+L+ +      E++
Sbjct: 13  SLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLF---------VGKLAHA------EQI 57

Query: 86  PTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESKKYNFQIPIMAYDK-TLLISIEENF 144
            T E   W  K     E  +Y ++    E  + E++     IP++  D+ T L+ + E+F
Sbjct: 58  STFE-VKWQTKGR---EQHLYREDFQVQEDCTKENESCGLSIPVLKIDEDTFLLCVAEDF 113

Query: 145 IKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDRVAAIRKL-TPENST-----LVAP 198
           + + PI  NL ++++ K+       ++ +L +GTSDR+  ++ + + +N       L  P
Sbjct: 114 LHVPPIVGNLLSQEMAKLC-----RDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPP 168

Query: 199 EFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSIETISELIDICKENLNI-NDP 257
           E IT F  S  +QL++ +VP +   + PSEGP G+EKLS+ET+ +LID+C   ++  N  
Sbjct: 169 ELITSFTASITTQLLLCKVP-FDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRD 227

Query: 258 KYSNESHRLWKVAGSAMGAQTGLYI 282
           +Y  E+HR W++ G++ G QTGLY+
Sbjct: 228 EYVKETHRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score = 95.5 bits (236), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 136/287 (47%), Gaps = 35/287 (12%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMT--NLKYEDFENVIVTTKTMNA 58
           + FKQW +   PRHQ+  P + ++  SL  +  P V++   +L    + + IV   ++  
Sbjct: 2   LTFKQWQNDQVPRHQI-DPVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60

Query: 59  LFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSN 118
           L P   +NL  +G +S +L  N NE         W+  +  P   D         E   N
Sbjct: 61  LLPKSIINLVHIGIISGTLS-NMNE---------WESMKPVPGMYD-------TEEHMIN 103

Query: 119 ESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGT 178
            ++++     +   + TL+  I+EN +K   I +N     + +++    +  I    L  
Sbjct: 104 STEQFVIHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITI----LVN 159

Query: 179 SDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSI 238
           SD++  +++L    S LV PEFITG + +FI  L   E+   K ++VPSEGPIGFEK + 
Sbjct: 160 SDKITELKQL----SYLVPPEFITGSITNFILALPRKEL---KVIVVPSEGPIGFEKYNF 212

Query: 239 ETISELIDICKENLNINDPK---YSNESHRLWKVAGSAMGAQTGLYI 282
            T+  L+D   + L     +   Y +E  +LWK+       Q GLYI
Sbjct: 213 PTVDALVDEMSKLLCSYPSQTEYYVSECLKLWKL-DECTTTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 132/292 (45%), Gaps = 41/292 (14%)

Query: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60
           M+FKQW     PRHQ+ S + S +  SL L   P +++ N   + +E  I    ++  L 
Sbjct: 1   MIFKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLL 59

Query: 61  PNKTLNLTKVGELSSSLVLNEN------EKVPTAEHYSWDYKENFPNEVDIYSQEAIESE 114
           P   ++  ++  L++ L  + N      E V T+  Y  D K +                
Sbjct: 60  PADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPS---------------- 103

Query: 115 IGSNESKKYNFQIPIMAYD-KTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGI 173
                +K+     PI   D  TL++ I+E+ ++  PI  N  A  + KV+ T       +
Sbjct: 104 -----TKEVRASYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQK---V 155

Query: 174 LTLGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP---NYKAVIVPSEGP 230
             L  SD++   + L    S L  PEFI G + + ++ L          ++ ++V SEGP
Sbjct: 156 YLLINSDKIIGFKSL----SELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGP 211

Query: 231 IGFEKLSIETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282
            G+E  +I  +  L++  K  L  ++ +Y   ++R WK + SA   Q+GLY+
Sbjct: 212 RGYEIHNITVVDLLVEYMKSTLGYSE-EYVTSAYRRWK-SNSASQFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 112/257 (43%), Gaps = 42/257 (16%)

Query: 34  PEVSMTNLKYEDFENVIVTTKTMNALFPNKTLNLTKVGELSSSLVLNENEKVPT----AE 89
           P+V  +    E +   +V   T++ L P + + LT V +L  +L      +  T    A+
Sbjct: 12  PQVEFSGKLGERYSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGGECATRLVAAD 71

Query: 90  HYSWDYKENFPNEVDIYSQEAIESEIGSNESKKYNFQIPIMAYDK---TLLISIEENFIK 146
            +   Y+ + P                +    +  +Q+    Y++    L++ +EEN +K
Sbjct: 72  QF---YEADVPQ---------------AERHVRVAYQL----YERGPGQLVVVVEENDLK 109

Query: 147 MSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDRVAAIRKLTPENSTLVAPEFITGFVG 206
             PI  N  A+++ +  L    +   +L    SD+   ++ L      LV PEFITG   
Sbjct: 110 YPPIVHNRLAQQLAE-KLRAVGAETTVLV--NSDKSTGVKDL----EELVPPEFITGA-- 160

Query: 207 SFISQLVILEVPNYKAVIVPSEGPIGFEKLSIETISELIDICKENLNINDPKYSNESHRL 266
                  +      + ++V SEGP GFEK ++  +  L++  ++ L+   P+Y     R 
Sbjct: 161 LAALVCALAPSGAGRVLVVQSEGPHGFEKHNLTVVDALVERVRQILD-QPPEYVAACTRH 219

Query: 267 WKV-AGSAMGAQTGLYI 282
           WK+ AGS    Q GLY+
Sbjct: 220 WKLQAGSQF--QGGLYL 234

>KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 372

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (53%), Gaps = 10/84 (11%)

Query: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENF-------PNEVD--IYSQEAI 111
           P K + +   G L S   +  + +    + Y  +Y+EN        PN+V+  + + EA+
Sbjct: 164 PAKEVKIEDCGVLPSDYTVPADAEATPTDAYGDNYEENITDDSKVDPNDVNSVLNAVEAV 223

Query: 112 ESEIGSNESKKYNFQIPIMAYDKT 135
           + EIG+ + K+ NF++ ++ Y+K+
Sbjct: 224 K-EIGTKQFKEKNFEVALVKYEKS 246

>ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON}
           similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 77  LVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESKKYNFQIPIMA 131
           L LN +  V    H+ + Y ENF +  D+Y + AI    G    +  +F  P++A
Sbjct: 439 LRLNNDNVVEALNHFQFLYDENFSDIADLYFEVAIALSKGEKHKEAIDFFTPLLA 493

>TDEL0G02880 Chr7 (553008..553718) [711 bp, 236 aa] {ON} Anc_2.358
           YMR157C
          Length = 236

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 31  QNIPEVSMTNLKYEDFENVIVTTKTMNALFPNKTLNLTKVGELSSSLVLNENEKVPTAEH 90
           +N P+ S +    E+FENV+   K   A+FP  TLN+ K    SS  +L   +  P A  
Sbjct: 73  KNKPKTSFSE---EEFENVMNGLKRRVAMFPAGTLNV-KFLPSSSESILKTIKAGPAAVI 128

Query: 91  YSWDYKENFPNEVD-IYSQEAIESEIGSNESKKYNFQIP 128
              +  E+F  + D IY  EA+ +++ S     Y  ++P
Sbjct: 129 DPIEAVEHFRQQKDGIY--EALLNDLKSKYGSDYTKKLP 165

>YLR381W Chr12 (879723..881924) [2202 bp, 733 aa] {ON}  CTF3Outer
           kinetochore protein that forms a complex with Mcm16p and
           Mcm22p; may bind the kinetochore to spindle microtubules
          Length = 733

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 9/92 (9%)

Query: 23  TNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALFPNKTLNLTKVGELSSSLVLNEN 82
           T++E L  QN P++ + N    D + ++  +   N L P K ++   +  L SS++L +N
Sbjct: 294 TSLEQLA-QNWPQLHIPN----DVDYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKN 348

Query: 83  EKVPTAEHYS---WDYKENFPNEVDIYSQEAI 111
            +  ++  Y    W  K  F ++++   QE I
Sbjct: 349 SRDESSSPYEWCIWQLKRCFAHQIET-PQEVI 379

>TPHA0G01850 Chr7 complement(383439..385028) [1590 bp, 529 aa] {ON}
           Anc_8.630 YPL128C
          Length = 529

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 144 FIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181
           F     +  + + ++ +K +L+FCN NIG + LG + R
Sbjct: 284 FTNFETLTEHYSWKEFIKSLLSFCNKNIGTIILGRAGR 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,765,409
Number of extensions: 1370193
Number of successful extensions: 4544
Number of sequences better than 10.0: 70
Number of HSP's gapped: 4636
Number of HSP's successfully gapped: 71
Length of query: 282
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 174
Effective length of database: 41,097,471
Effective search space: 7150959954
Effective search space used: 7150959954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)