Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029907.352ON1071075443e-73
Kpol_530.297.352ON1071064151e-53
Suva_10.2957.352ON1141063979e-51
TDEL0C019607.352ON1071063942e-50
Skud_12.2647.352ON1141063917e-50
YLR200W (YKE2)7.352ON1141033909e-50
NCAS0E028607.352ON1051053839e-49
KAFR0L014907.352ON1071063821e-48
KLLA0D12298g7.352ON1151033803e-48
Smik_12.2597.352ON1141063786e-48
KLTH0H01210g7.352ON1131043718e-47
ZYRO0F11748g7.352ON1091073673e-46
NDAI0E044607.352ON1061033586e-45
CAGL0A03971g7.352ON1061003561e-44
Kwal_56.246487.352ON1131003543e-44
KNAG0B026107.352ON1191043544e-44
TBLA0E004407.352ON1151043518e-44
ACL146C7.352ON1071033491e-43
SAKL0F11418g7.352ON1151033492e-43
Ecym_47217.352ON1071023431e-42
Ecym_26257.101ON1097103730.12
YNL153C (GIM3)2.101ON12988670.52
TPHA0E031505.186ON14959650.86
TPHA0H027307.69ON51693651.3
Kpol_1039.612.101ON129113631.6
KAFR0A073402.101ON12992622.0
ZYRO0G05324g2.101ON12981613.3
CAGL0H08998g6.236ON54744614.5
Kpol_250.5singletonON40933614.9
Skud_15.273.45ON37739605.2
KLLA0C17094g8.143ON22539605.6
TDEL0F015804.39ON122946606.2
Ecym_25743.544ON84530597.5
KLLA0B01826g5.577ON80353597.6
CAGL0C01749g6.157ON23562597.7
Smik_14.1752.101ON12988588.8
TPHA0J003306.20ON110774599.0
KNAG0L020805.696ON669106599.1
NCAS0A015205.211ON88554599.4
KLTH0F14498g3.479ON70255599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02990
         (107 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   214   3e-73
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   164   1e-53
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   157   9e-51
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   156   2e-50
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   155   7e-50
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   154   9e-50
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   152   9e-49
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   151   1e-48
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   150   3e-48
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   150   6e-48
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   147   8e-47
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   145   3e-46
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   142   6e-45
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   141   1e-44
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   140   3e-44
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   140   4e-44
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   139   8e-44
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   139   1e-43
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   139   2e-43
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   136   1e-42
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    33   0.12 
YNL153C Chr14 complement(345669..346058) [390 bp, 129 aa] {ON}  ...    30   0.52 
TPHA0E03150 Chr5 complement(666045..666494) [450 bp, 149 aa] {ON...    30   0.86 
TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {O...    30   1.3  
Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {...    29   1.6  
KAFR0A07340 Chr1 (1481834..1482223) [390 bp, 129 aa] {ON} Anc_2....    28   2.0  
ZYRO0G05324g Chr7 complement(429815..430204) [390 bp, 129 aa] {O...    28   3.3  
CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly...    28   4.5  
Kpol_250.5 s250 complement(7886..9115) [1230 bp, 409 aa] {ON} co...    28   4.9  
Skud_15.27 Chr15 complement(47080..48213) [1134 bp, 377 aa] {ON}...    28   5.2  
KLLA0C17094g Chr3 complement(1495879..1496556) [678 bp, 225 aa] ...    28   5.6  
TDEL0F01580 Chr6 complement(288032..291721) [3690 bp, 1229 aa] {...    28   6.2  
Ecym_2574 Chr2 complement(1120451..1122988) [2538 bp, 845 aa] {O...    27   7.5  
KLLA0B01826g Chr2 complement(155830..156444,156659..158455) [241...    27   7.6  
CAGL0C01749g Chr3 complement(185416..186123) [708 bp, 235 aa] {O...    27   7.7  
Smik_14.175 Chr14 complement(325104..325493) [390 bp, 129 aa] {O...    27   8.8  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...    27   9.0  
KNAG0L02080 Chr12 complement(371331..373340) [2010 bp, 669 aa] {...    27   9.1  
NCAS0A01520 Chr1 (296107..298764) [2658 bp, 885 aa] {ON} Anc_5.2...    27   9.4  
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    27   9.8  

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  214 bits (544), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107
           QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  164 bits (415), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (89%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MSD+A KYQ +QGELEE+I+AR++LETQLQENKIVN+EF  L EDT +YKLTGNV+LP+E
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           QFEA+SNVEKRLEFIE EIK+CE+NIK+KQ EL+KLR ELMK RG 
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  157 bits (397), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 93/106 (87%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS++ AKYQ +Q ELEE I+ARQKLETQLQENKIVN+EF+ L EDTP+YKLTGNV+LP+E
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           Q EA+ NVEKRLEFIE EIKRCE+NI+ KQ+EL+++R EL+K+  A
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  156 bits (394), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 91/106 (85%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MSD+AA YQ++Q ELE L+IARQKLETQLQENKIV++EF++L EDT +YKLTGNV+LP+E
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           Q EA SNV KRLEFI+ EI RCE N+K KQ E +KLR EL+K+RGA
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  155 bits (391), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 92/106 (86%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS++ A+YQ +Q ELEE I+ARQKLETQLQENKIVN+EF+ + +DTP+YKLTGNV+LP+E
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           Q EA+ NV+KRLEFIE EIKRCE NI+ KQDEL+K+R EL+K+  A
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  154 bits (390), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 92/103 (89%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS++ AKYQ +Q ELEE I+ARQKLETQLQENKIVN+EF+ L EDTP+YKLTGNV+LP+E
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKM 103
           Q EA++NV+KRLEFIE EI RCE+NI+ KQ+EL+K+R EL+K+
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  152 bits (383), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 73/105 (69%), Positives = 92/105 (87%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           M+D+ A+YQS+Q ELE  IIARQKLETQLQENKIV DEF  L ++T +YKLTGNV+LP+E
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105
           Q EA+SNVEKRLEFI++EI +CE+NIK KQ+EL+K+R E++KMRG
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG 105

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  151 bits (382), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 90/106 (84%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS++AA+YQ +Q ELEELI+ARQKLETQLQENKIVNDEF  L E+T +YKLTGNV+LPIE
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           Q EA+ NV+KRLEFIE EI RCE NIK+KQ E++ +R EL+K+R  
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSG 106

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  150 bits (380), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 85/103 (82%)

Query: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62
           +   KY  +QGELEELI+ARQKLETQLQENKIV+DEF+ L +D  +YKLTG V+LP+EQF
Sbjct: 5   ETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQF 64

Query: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105
           EAK NVEKRLEFIE EIKRCE NIK+KQ EL+  R ELMK+R 
Sbjct: 65  EAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  150 bits (378), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 92/106 (86%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS++  KYQ +QGELEE I+ARQKLETQLQENKIVN+EF+ L E+TP+YKLTGNV+LP++
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           Q EA+ NV+KRLEFIE EI RCE+NIK KQ++L+K+R +L+K+  A
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  147 bits (371), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%)

Query: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62
           D+   Y + Q ELEEL+IARQKLETQLQENKIV DEF+ L E+T +YKLTGNV+LP+EQF
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           EAKSNV KRLEFI  EI RCEENIKTKQ  L+KLR EL++ + A
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  145 bits (367), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 68/107 (63%), Positives = 90/107 (84%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS++AA+YQ +QGELE  I+ARQKLETQLQENKIV+DEFN L  D+ +YKLTGNV+LP+E
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107
           Q +A++NV KRLEFI+ EI RCE NIK KQ+E ++++ EL+K+R  +
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGD 107

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  142 bits (358), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 87/103 (84%)

Query: 2   SDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQ 61
           S++ +KYQ +QGELE+LI+ARQKLETQLQENKIV +EFN L  ++ +YKLTGNV+LP++Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  FEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMR 104
            EA SNV+KRLEFI+ EI RCE NIK KQ ELD +R E++KMR
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  141 bits (356), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 87/100 (87%)

Query: 2   SDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQ 61
           +++ AKYQS+Q ELEEL+ ARQKLETQLQENKIVN+EF  L EDT +YKLTGNV+LP+E 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  FEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELM 101
            +AK+NV+KRLEFI  EIKRCE+NI++KQ EL+ +RG+L+
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  140 bits (354), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%)

Query: 8   YQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFEAKSN 67
           Y + Q ELEEL+ ARQ+LETQLQENKIV DEF+ L E+T +YKLTG V+LP+EQFEAKSN
Sbjct: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQFEAKSN 71

Query: 68  VEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107
           V KRLEFI  EIKRCE+NIK KQ  L+KLR EL++ + A+
Sbjct: 72  VSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  140 bits (354), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (83%)

Query: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60
           MS+ AAKYQ  Q  LEELI+ARQKLETQLQENKIV +EF+ L ED+ +YKLTG+V+LP++
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMR 104
           Q EA++NV+KRLEFI  EI RCEENIK KQ+ L+ LR ELMK++
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  139 bits (351), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (80%)

Query: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62
           ++A KYQ+ Q ELE  I+ RQKLETQLQENKIVNDEF  L E+T ++KLTGNV+LPIEQ 
Sbjct: 5   ELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQD 64

Query: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           EA+SN++KRLEFI+ EI RCE+NIK KQ E++K+R ELM    A
Sbjct: 65  EARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPA 108

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  139 bits (349), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%)

Query: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62
            VA KY  +QGELEEL++ RQKLETQLQENKIVN+E   L  +T +YKLTG V+LP+EQ 
Sbjct: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64

Query: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105
           EA+ NV KRLEFIE EI+RCE+NIK KQ+E++  R  L+K+RG
Sbjct: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  139 bits (349), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 88/103 (85%)

Query: 4   VAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFE 63
           ++ +Y ++Q ELE+L+IARQKLETQLQENKIV DEF+ L +++ +YKLTG V+LP+EQ E
Sbjct: 9   LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68

Query: 64  AKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106
           AK NVEKRL+FI+NEI RCEENIK KQ +L++LR EL+++R A
Sbjct: 69  AKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  136 bits (343), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 80/102 (78%)

Query: 4   VAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFE 63
           VAAKY  +QGELE+LI+ RQKLETQLQENKIVN+E   L ED  +YKLTG V+LP+E  E
Sbjct: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65

Query: 64  AKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105
           A SNV KRLEFI+ EI RCE NIK KQ EL++ R EL+K+R 
Sbjct: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar
           to Ashbya gossypii AEL337
          Length = 1097

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 13/103 (12%)

Query: 8   YQSVQGELEELIIARQKLETQL----QENKIVNDEFNDLNEDTPIYKLTG----NVMLPI 59
           YQ VQ  +EELI  ++K  + L    Q+ K +  E +DLN    I+  T     N+   +
Sbjct: 675 YQGVQKNIEELIEGKKKYNSPLADIRQKLKDLQHEMHDLNHKRMIHSRTTSEIENIKHKL 734

Query: 60  EQFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMK 102
           E+F    N +     +   I  CE  I+   D   KL  +++K
Sbjct: 735 EEFRRDMNKD-----VSEAIATCESQIQQSVDAQSKLLAQMVK 772

>YNL153C Chr14 complement(345669..346058) [390 bp, 129 aa] {ON}
           GIM3Subunit of the heterohexameric cochaperone prefoldin
           complex which binds specifically to cytosolic chaperonin
           and transfers target proteins to it
          Length = 129

 Score = 30.4 bits (67), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 3/88 (3%)

Query: 23  QKLETQLQENKIVND---EFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEI 79
           Q+L  Q +E + ++D   E   ++ED P+    G++ + ++Q +  + +EK  E ++N+I
Sbjct: 37  QELSLQREEKEYLDDVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKI 96

Query: 80  KRCEENIKTKQDELDKLRGELMKMRGAN 107
           +  E+  +     LD L+  L    G N
Sbjct: 97  ETLEDKQRDIDSRLDALKAILYAKFGDN 124

>TPHA0E03150 Chr5 complement(666045..666494) [450 bp, 149 aa] {ON}
           Anc_5.186 YGR174C
          Length = 149

 Score = 29.6 bits (65), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 8/59 (13%)

Query: 47  PIYKLTGNVMLPIEQF-EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMR 104
           PI+K TG+++ P E+  E K++  +R  F   ++K  E     ++DEL K+R EL ++R
Sbjct: 76  PIWK-TGSIVSPWERADEGKNDPNQRYAF--QKLKSSE----VQKDELKKIRDELQQLR 127

>TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {ON}
           Anc_7.69 YOR324C
          Length = 516

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 53/93 (56%), Gaps = 8/93 (8%)

Query: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62
           D++ + Q ++  L ++ +A   ++    EN  ++ +F+  NE + IY++T NV   +E+ 
Sbjct: 412 DLSQRLQKLRSNLNDITLA---VKNSHLEN--LDKKFDRNNESSLIYQVTENVAEFVEKL 466

Query: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDK 95
           E   N++KR +  ++ + R  E I+  + EL+K
Sbjct: 467 E---NIQKRYDTCKSLVDRHREVIRIMEQELEK 496

>Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {ON}
           complement(169465..169854) [390 nt, 130 aa]
          Length = 129

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 7/113 (6%)

Query: 2   SDVAAKYQSVQGELEELIIARQKLETQL----QENKIVND---EFNDLNEDTPIYKLTGN 54
           ++V+ K Q +  E  +LI+ +  +E QL    +E   + D   E   ++ED  ++   G+
Sbjct: 12  TNVSYKDQQLINEFSKLIMRKDSIEEQLNLQNEEKSYLEDVSLEIELIDEDQLVHYKIGD 71

Query: 55  VMLPIEQFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107
           V L + Q E  + +E   E I+++I   + +     D L +L+ +L    G N
Sbjct: 72  VFLMLPQEEVVNLLESDTEVIDSKIDNLQNSKSEIDDRLKELKAQLYAKFGDN 124

>KAFR0A07340 Chr1 (1481834..1482223) [390 bp, 129 aa] {ON} Anc_2.101
           YNL153C
          Length = 129

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 11/92 (11%)

Query: 23  QKLETQLQENKIVND---EFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEI 79
           Q+L  ++QE + ++D   E   ++ED  +    G++ L  +Q EA   +EK +E I+ +I
Sbjct: 37  QELSKEMQEKEYLDDVSLEIELIDEDEKVQYKIGDIFLFFKQSEAVEQLEKDVESIDAKI 96

Query: 80  KRCEENIKTKQDELDK----LRGELMKMRGAN 107
               E ++ KQ ++D     L+ EL    G N
Sbjct: 97  ----EELQNKQSDIDSRVSALKTELYAKFGDN 124

>ZYRO0G05324g Chr7 complement(429815..430204) [390 bp, 129 aa] {ON}
           highly similar to uniprot|P53900 Saccharomyces
           cerevisiae YNL153C GIM3 Subunit of the heterohexameric
           cochaperone prefoldin complex which binds specifically
           to cytosolic chaperonin and transfers target proteins to
           it
          Length = 129

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 7/81 (8%)

Query: 23  QKLETQLQENKIVND---EFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEI 79
           Q+L  Q QE +  +D   E   ++ED P+    G + L ++Q EA   +EK +E  +  I
Sbjct: 37  QELNIQRQEKEYSDDVSLELELIDEDEPVQYKVGVIFLHLKQKEAVEQLEKDMESTQGRI 96

Query: 80  KRCEENIKTKQDELDKLRGEL 100
              E    ++QD LD    EL
Sbjct: 97  DELE----SEQDGLDAQLKEL 113

>CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly
          similar to uniprot|Q08966 Saccharomyces cerevisiae
          YPL219w PCL8
          Length = 547

 Score = 28.1 bits (61), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 5/44 (11%)

Query: 35 VNDEFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENE 78
           ND F++LNED     L GN++   E+ ++ S++ K++ F  NE
Sbjct: 27 ANDNFSELNED-----LDGNLLHSGEKDQSSSSLTKKVRFESNE 65

>Kpol_250.5 s250 complement(7886..9115) [1230 bp, 409 aa] {ON}
          complement(7886..9115) [1230 nt, 410 aa]
          Length = 409

 Score = 28.1 bits (61), Expect = 4.9,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 63 EAKSNVEKRLEFIENEIKRCEENIKTKQDELDK 95
          E   N EKR    E E+KR EE+++ K  ++D+
Sbjct: 17 ETGKNFEKRFNIDEAELKRFEESVEKKLFQMDE 49

>Skud_15.27 Chr15 complement(47080..48213) [1134 bp, 377 aa] {ON}
           YOL126C (REAL)
          Length = 377

 Score = 27.7 bits (60), Expect = 5.2,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 37  DEFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFI 75
           D  N +NE      +  N MLPI   + K N+EK LEFI
Sbjct: 338 DIVNRMNE------MERNEMLPICVSQLKKNIEKGLEFI 370

>KLLA0C17094g Chr3 complement(1495879..1496556) [678 bp, 225 aa]
           {ON} similar to uniprot|P53102 Saccharomyces cerevisiae
           YGL183C MND1 Protein required for recombination and
           meiotic nuclear division forms a complex with Hop2p
           which is involved in chromosome pairing and repair of
           meiotic double-strand breaks
          Length = 225

 Score = 27.7 bits (60), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 66  SNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMR 104
           SN+EKR+E  ++EI RC+E     Q E+   R + +K R
Sbjct: 89  SNIEKRIEHEKSEIARCQE---LYQKEIQGQRSDTLKNR 124

>TDEL0F01580 Chr6 complement(288032..291721) [3690 bp, 1229 aa] {ON}
           Anc_4.39 YLR313C
          Length = 1229

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 41  DLNEDTPIYKLTGNVMLP-IEQFE-AKSNVEKRLEFIENEIKRCEE 84
           DL++ TP       +  P + ++E AKS V++ L+ ++N +KR  E
Sbjct: 808 DLSKTTPAKNDPSKITSPMVSKYEEAKSTVDRSLQKVKNSLKRAPE 853

>Ecym_2574 Chr2 complement(1120451..1122988) [2538 bp, 845 aa] {ON}
           similar to Ashbya gossypii AFR242C
          Length = 845

 Score = 27.3 bits (59), Expect = 7.5,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 4/30 (13%)

Query: 66  SNVEKRLEFI----ENEIKRCEENIKTKQD 91
           +N E+R   +    E +IKR EEN+KT+QD
Sbjct: 634 NNSEERTRMVIRHHERQIKREEENLKTRQD 663

>KLLA0B01826g Chr2 complement(155830..156444,156659..158455) [2412
           bp, 803 aa] {ON} similar to uniprot|Q03707 Saccharomyces
           cerevisiae YML034W SRC1
          Length = 803

 Score = 27.3 bits (59), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 34  IVNDEFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEIKRCEENI 86
           I+ND  NDLNE   ++ LT       ++ +  +NV+  L  I  EI +C E I
Sbjct: 731 ILND-MNDLNEKNRLWALT------TKKLDGNTNVKSTLMEIHGEIMKCWEWI 776

>CAGL0C01749g Chr3 complement(185416..186123) [708 bp, 235 aa]
          {ON} similar to uniprot|P38331 Saccharomyces cerevisiae
          YBR242w or uniprot|P53144 Saccharomyces cerevisiae
          YGL101w
          Length = 235

 Score = 27.3 bits (59), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 24 KLETQLQ--ENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEIKR 81
          KL T++   E+ I  D  N L EDTP Y L+   M  +EQ +    V++R  ++++ + +
Sbjct: 20 KLSTKIWAPEDYIPQDVKNMLAEDTPNYMLS--FMKVLEQLK----VQRRTGWLDHGMTK 73

Query: 82 CE 83
          CE
Sbjct: 74 CE 75

>Smik_14.175 Chr14 complement(325104..325493) [390 bp, 129 aa] {ON}
           YNL153C (REAL)
          Length = 129

 Score = 26.9 bits (58), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 23  QKLETQLQENKIVND---EFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEI 79
           Q+L  Q QE + ++D   E   ++ED P+    G + + ++Q +  + +E+  + ++N+I
Sbjct: 37  QELTLQRQEKEYLDDVSLEIELIDEDEPVQYKVGELFIFMKQSKVTAQLEEDTQTLDNKI 96

Query: 80  KRCEENIKTKQDELDKLRGELMKMRGAN 107
           +  E+        LD L+  L    G N
Sbjct: 97  QILEDKQGDIDARLDALKAALYAKFGDN 124

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 40/74 (54%), Gaps = 11/74 (14%)

Query: 36   NDEFNDLNEDTPIYKLTGNVMLPIEQFEAKSNVEKRLEF----IENEIKRCEENIKTKQD 91
            N+E  +L+E+T +++   NV    E+       E+RL+F    +E ++K+    I+ K +
Sbjct: 1005 NEETGNLSENTSVFRYAWNVTYRKEE-------ERRLKFAMLELERDLKKLGTEIRVKHE 1057

Query: 92   ELDKLRGELMKMRG 105
            EL +   + ++M+ 
Sbjct: 1058 ELAEEFSDYVRMKS 1071

>KNAG0L02080 Chr12 complement(371331..373340) [2010 bp, 669 aa] {ON}
           Anc_5.696 YIL144W
          Length = 669

 Score = 27.3 bits (59), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 32/106 (30%)

Query: 6   AKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFEAK 65
           A Y +V G+ +EL IA++KL              N+L  D   Y++       I+ F AK
Sbjct: 314 AHYDTVLGKTQELRIAKEKL--------------NNLQNDVAKYQMY------IDDFTAK 353

Query: 66  SNVEKRLEFIENEIKRCEENIKTKQDELDKLRGEL------MKMRG 105
               +R   + N  +R EE+    Q ++D+L+ ++      MK+RG
Sbjct: 354 Q--AERPAKLHNMQRRAEEH----QKQIDELKEQIQRLLEEMKLRG 393

>NCAS0A01520 Chr1 (296107..298764) [2658 bp, 885 aa] {ON} Anc_5.211
           YLL005C
          Length = 885

 Score = 27.3 bits (59), Expect = 9.4,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 22  RQKLETQLQENKIVNDEFNDLNEDTPI-----YKLTGNVML-PIEQFEAKSNVE 69
           R KL+T  Q NK++ +  +D NED        +    ++ L PIE+++ K+ ++
Sbjct: 97  RTKLKTIYQANKVLEENSSDGNEDHSSSFGRHFSWIKDIFLSPIEKYKDKAGID 150

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 27.3 bits (59), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 57  LPIEQFEAKSNVEKRLEFIENEIKRCEENIKTK-----QDELDKLRGELMKMRGA 106
           L I+Q  AKS  E  L  +E + +R  EN++       ++ LD+LR ++ K RG+
Sbjct: 158 LEIQQLRAKSTAE--LNAMEGDYRRQLENLRFAKVRKLENSLDELRRDISKARGS 210

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,618,093
Number of extensions: 525638
Number of successful extensions: 3692
Number of sequences better than 10.0: 417
Number of HSP's gapped: 3663
Number of HSP's successfully gapped: 472
Length of query: 107
Length of database: 53,481,399
Length adjustment: 77
Effective length of query: 30
Effective length of database: 44,652,117
Effective search space: 1339563510
Effective search space used: 1339563510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)