Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029807.351ON26426412441e-175
Kpol_530.307.351ON2602497152e-94
YLR201C (COQ9)7.351ON2602487082e-93
Suva_10.2967.351ON2602606857e-90
NCAS0E028707.351ON2612656789e-89
ZYRO0F11726g7.351ON2512556718e-88
CAGL0A03949g7.351ON2682666728e-88
Smik_12.2607.351ON2602596701e-87
TDEL0C019707.351ON2602656658e-87
Skud_12.2657.351ON2602486562e-85
SAKL0F11396g7.351ON2542536127e-79
NDAI0E044707.351ON2642506102e-78
KNAG0B026207.351ON2652576075e-78
KAFR0L014807.351ON2642476051e-77
KLTH0H01232g7.351ON2572656014e-77
Kwal_56.246447.351ON2582575997e-77
TBLA0E004507.351ON2792485973e-76
KLLA0D12320g7.351ON2502535735e-73
ACL147W7.351ON2462535189e-65
Ecym_47227.351ON2532485066e-63
Kwal_14.23841.288ON52859711.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02980
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   483   e-175
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   280   2e-94
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   277   2e-93
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   268   7e-90
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   265   9e-89
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   263   8e-88
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   263   8e-88
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   262   1e-87
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   260   8e-87
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   257   2e-85
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   240   7e-79
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   239   2e-78
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   238   5e-78
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   237   1e-77
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   236   4e-77
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   235   7e-77
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   234   3e-76
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   225   5e-73
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   204   9e-65
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   199   6e-63
Kwal_14.2384 s14 complement(734924..736510) [1587 bp, 528 aa] {O...    32   1.5  

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  483 bits (1244), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 236/264 (89%)

Query: 1   MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF 60
           MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF
Sbjct: 1   MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF 60

Query: 61  SERAIIEAMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDP 120
           SERAIIEAMKELKIENQSTMLSAIG             VMELLKFNLVLKRYRMIEGLDP
Sbjct: 61  SERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDP 120

Query: 121 LTMQQXXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIY 180
           LTMQQ               MDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIY
Sbjct: 121 LTMQQEELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIY 180

Query: 181 FSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYN 240
           FSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYN
Sbjct: 181 FSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYN 240

Query: 241 NTEEYAWYVLLNSVNMVKSRMSRA 264
           NTEEYAWYVLLNSVNMVKSRMSRA
Sbjct: 241 NTEEYAWYVLLNSVNMVKSRMSRA 264

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  280 bits (715), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 174/249 (69%), Gaps = 3/249 (1%)

Query: 16  ARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIE 75
            RF+HP   EYV    L P  Y KDS Q+KILSH++D +V +FGF+ERAI+ ++  L   
Sbjct: 15  TRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYP 74

Query: 76  NQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXXXXXX 135
             S++LS IG             +MELLKFNLV KRY++ E + PL              
Sbjct: 75  --SSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDI-PLDTPVEELPSLEDLL 131

Query: 136 XXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSK 195
                MD+PIG H+S  ++QL IPGPFL D++LPELHRLADDMIYFS+EKDH DFAWY+K
Sbjct: 132 IKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAK 191

Query: 196 RLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVN 255
           R+GVS+AY+SSKLFMAQD S  Y +T +FAKDKL+++M+LGDYYNN EEYAWYVL+NS+N
Sbjct: 192 RMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSIN 251

Query: 256 MVKSRMSRA 264
           M KS+ +R 
Sbjct: 252 MAKSKAARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  277 bits (708), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 170/248 (68%), Gaps = 2/248 (0%)

Query: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76
           R +H    E+V P  + P TY K+SPQ+K+LS A+   V + GFSER+I+E++ EL    
Sbjct: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYP- 73

Query: 77  QSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXXXXXXX 136
            S+M+S+IG             VMEL+KF LV KRYR+ EG++P    Q           
Sbjct: 74  -SSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLL 132

Query: 137 XXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196
               MD PIG H+S  MSQL IP  FL ++A+PELHRL+DDMIYFSNEKDHHD AWY+KR
Sbjct: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192

Query: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256
           L VSS YI SKLFMAQD S NYKET  FAKDKL +VMRLG+YYNNTEE+AWY L+++VN+
Sbjct: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 257 VKSRMSRA 264
           +KS++ R 
Sbjct: 253 IKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  268 bits (685), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 172/260 (66%), Gaps = 2/260 (0%)

Query: 5   GRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERA 64
            R   RK+  + R +H    E+V P  + P  Y K SPQ+K+LS A+   V K GF+ER+
Sbjct: 3   SRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERS 62

Query: 65  IIEAMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQ 124
           I+E++ +L     S+M+S+IG             VMELLKF LV KRYR+ EG++P    
Sbjct: 63  IVESLNKLGYP--SSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120

Query: 125 QXXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNE 184
                           MD P+G+ ++  MSQL IP  FL ++A+PELHRL+DDMIYFSNE
Sbjct: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 185 KDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEE 244
           KDHHD AWY+KRL VSS YI S+LFMAQD S ++ ET  FAKDKL +VMRLG+YYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240

Query: 245 YAWYVLLNSVNMVKSRMSRA 264
           +AWY L+++VN+VKS+++R 
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  265 bits (678), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 135/265 (50%), Positives = 175/265 (66%), Gaps = 5/265 (1%)

Query: 1   MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF 60
           M+NR   I +K   + R +HP+  EYV P  LSP TY K+S Q+KILS+A+   V K GF
Sbjct: 1   MLNRS--ILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGF 58

Query: 61  SERAIIEAMKELKIENQSTMLSAIGXXXXXXX-XXXXXXVMELLKFNLVLKRYRMIEGLD 119
            E+AI +++ EL     S++LS IG              VMEL+KF LV KRY + E L 
Sbjct: 59  KEKAITDSLNELGF--SSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLC 116

Query: 120 PLTMQQXXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMI 179
           P T  +               MD  IGK I    ++L  P  FL D ALPELHRL+DDMI
Sbjct: 117 PDTTPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMI 176

Query: 180 YFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYY 239
           YFSNEKDHHD AWY+KRLGVS AY+SSKL+MAQDNS ++++TL FAKDKL ++M+LG+YY
Sbjct: 177 YFSNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYY 236

Query: 240 NNTEEYAWYVLLNSVNMVKSRMSRA 264
           NNTEEYAWY+ + S N+V++R++R+
Sbjct: 237 NNTEEYAWYMFMVSTNLVRARLARS 261

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  263 bits (671), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 172/255 (67%), Gaps = 7/255 (2%)

Query: 10  RKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAM 69
           R   V+ R +HP+  E++  ++L P  Y  DSPQ+ +LSHA+  +V   GF+ERAI+ ++
Sbjct: 4   RLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSL 63

Query: 70  KELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXX 129
            +L     STMLS IG             VMEL+KF+LV KR ++ + L           
Sbjct: 64  NQLNYP--STMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS-----SEEKP 116

Query: 130 XXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHD 189
                      +++PI  H+S  +S + +PGPF +D+ALPELHRL+DD+IY+SNEKDHHD
Sbjct: 117 SLEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHD 176

Query: 190 FAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYV 249
           FAWYSKRLG+S AY+SS+LFMAQD S NY+ET QFA+DKL++ M+LG+YYNNTEE+ WY 
Sbjct: 177 FAWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYT 236

Query: 250 LLNSVNMVKSRMSRA 264
           LLNS+N+ KS+M+R 
Sbjct: 237 LLNSINLAKSQMARG 251

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  263 bits (672), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/266 (45%), Positives = 177/266 (66%), Gaps = 8/266 (3%)

Query: 3   NRGRLIFRKSGVNA-----RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTK 57
           N  RL+ R+  V+      R +HP ++EYV P    P TYT +SP+FK+LSH ++N+V +
Sbjct: 5   NNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQ 64

Query: 58  FGFSERAIIEAMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEG 117
            GF+E+AI+ ++  +K+   S ML+ IG             VMEL+KF LV KR+RM+EG
Sbjct: 65  HGFTEKAIVNSLNAMKMP--SGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEG 122

Query: 118 LDPLTMQQXXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADD 177
           +  +  +                MD+PI  H++   +QL++P  F+ + +LPEL RLADD
Sbjct: 123 ITEIA-EASKLPSLESLLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADD 181

Query: 178 MIYFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGD 237
           MIY+SNEKDHHDFAWY+KR  +++ Y++SK FMAQD S N+ ET++FA+DKL KVM LGD
Sbjct: 182 MIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGD 241

Query: 238 YYNNTEEYAWYVLLNSVNMVKSRMSR 263
           YYNN EE+ W+ L+++VN+ KS+M+R
Sbjct: 242 YYNNVEEFGWFTLMSAVNLTKSQMAR 267

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  262 bits (670), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 168/259 (64%), Gaps = 2/259 (0%)

Query: 6   RLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAI 65
           R I RK   + R +HP   E+V  + + P TY K+SPQ+K+LS A++  V K GFSER+I
Sbjct: 4   RNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSI 63

Query: 66  IEAMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQ 125
           +E++ EL   +      +               VMEL+KF LV KRYR+ E ++P    Q
Sbjct: 64  VESLNELGYPSSMISSISA--SNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQ 121

Query: 126 XXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEK 185
                          MD PIG  +S  MSQL IP  FL ++A+PELHRL+DDMIYFSNEK
Sbjct: 122 YKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEK 181

Query: 186 DHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEY 245
           DHHD AWY+KRL VSS YI SKLFMAQD S NYK+T  FAK KL +VMRLG+YYNNTEE+
Sbjct: 182 DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEF 241

Query: 246 AWYVLLNSVNMVKSRMSRA 264
           AWY L+++VN+VKS++ R 
Sbjct: 242 AWYTLMSTVNLVKSQLVRG 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  260 bits (665), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 135/265 (50%), Positives = 179/265 (67%), Gaps = 6/265 (2%)

Query: 1   MINRGRLIFRKSGVNARFFHPATDEYVLP-NKLSPCTYTKDSPQFKILSHAIDNTVTKFG 59
           MI++ RLI   S + AR + PA  EY+ P N   P  Y KDSPQ+K+LSH +  +V  +G
Sbjct: 1   MISK-RLI-AGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYG 58

Query: 60  FSERAIIEAMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLD 119
           F+ERAI+ ++ EL     STMLS IG             +MELLKF+LV KR  + E + 
Sbjct: 59  FNERAIVNSLNELGY--PSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENIS 116

Query: 120 PLTMQQXXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMI 179
            L                   M++P+ KH+S  +SQL IPGPFL+D ++PELHRL+DDMI
Sbjct: 117 -LETPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMI 175

Query: 180 YFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYY 239
           YFS EKDH+DFAWYSKRL VS AY+SS+LFMAQD S +YKET +FA++KL +V  LG+YY
Sbjct: 176 YFSTEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYY 235

Query: 240 NNTEEYAWYVLLNSVNMVKSRMSRA 264
           NNTEE+AWY LL+++N+VKS+++R 
Sbjct: 236 NNTEEFAWYTLLSTINLVKSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  257 bits (656), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 167/248 (67%), Gaps = 2/248 (0%)

Query: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76
           R +H    E+V P  + P TY K SPQ+K+LS A+   V K GFSER+I+E++   K+  
Sbjct: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLN--KLGY 72

Query: 77  QSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXXXXXXX 136
            S+M+S+IG             VMEL+KF LV KRYR+ EG++P    +           
Sbjct: 73  PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 132

Query: 137 XXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196
               MD  IG  ++  MSQL +P   L ++A+PELHRL+DDMIYFSNE+DHHD AWY+KR
Sbjct: 133 KRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKR 192

Query: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256
           L VSS YI SKLFMAQD S ++KET  FAK+KL KVMRLG+YYNNTEE+AWY L+++VN+
Sbjct: 193 LAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 257 VKSRMSRA 264
           VKS+++R 
Sbjct: 253 VKSQLARG 260

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  240 bits (612), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 169/253 (66%), Gaps = 5/253 (1%)

Query: 12  SGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKE 71
           S +  R +HP   E+     L P  Y+KDSPQ+KIL++A+D  V K+GF+ERA+  +  +
Sbjct: 7   SKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSD 66

Query: 72  LKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXX 131
           L     S+ LS +G             V+ELLKF+LV KRY + +G+   T++       
Sbjct: 67  LGY--SSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPSLENL 124

Query: 132 XXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFA 191
                    M+ PI  H+S  +S L +PG FL + A+PELHRL+DDM+YFSNE DH+DFA
Sbjct: 125 FLKRLE---MNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFA 181

Query: 192 WYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLL 251
           WYSKRL +S+AY+SS+LFMAQD S +Y++T++FAK+KL+ + +LG+ YNN EEYAWY LL
Sbjct: 182 WYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLL 241

Query: 252 NSVNMVKSRMSRA 264
           +S+++ KS+M+R+
Sbjct: 242 SSISLAKSQMTRS 254

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  239 bits (610), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 162/250 (64%), Gaps = 4/250 (1%)

Query: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76
           R FH  T EY     LSP TY KDS Q+KILS+A++  V K GF++ AI  ++ EL +  
Sbjct: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDL-- 74

Query: 77  QSTMLSAIGXXXXXXXXXXXX-XVMELLKFNLVLKRYRMIEGLDP-LTMQQXXXXXXXXX 134
            S++ S +G              VMELLKF LV KRY++ E + P +   +         
Sbjct: 75  SSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETL 134

Query: 135 XXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYS 194
                 MD P+   +S+  +QL+IP P L + ALPEL  L+DD+IYFSNEKDHHD AWY+
Sbjct: 135 LIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYA 194

Query: 195 KRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSV 254
           KRLGVS AY+SSKL+M ++N  N+ +T+ FAKDKL ++M LG+YYNNTEEYAWY L+ S+
Sbjct: 195 KRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSM 254

Query: 255 NMVKSRMSRA 264
           N+VK+R++R 
Sbjct: 255 NLVKARLARG 264

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  238 bits (607), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 115/257 (44%), Positives = 166/257 (64%), Gaps = 3/257 (1%)

Query: 8   IFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIE 67
           + R++ ++ R +HP   EY     ++P TYT DSPQ +IL+H + N V  +GF+ERA+++
Sbjct: 10  VSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLK 69

Query: 68  AMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTM-QQX 126
           +++ +  +  S+M+S +G             VMEL+KFNLV KR+ + E L    +    
Sbjct: 70  SIQAVGYD--SSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPA 127

Query: 127 XXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKD 186
                         MD+P+ K +    +QL +P  F+++ A+PEL RL+DDMIYFSNEKD
Sbjct: 128 ALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKD 187

Query: 187 HHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYA 246
           H D AWYSKRLGVS AY +SKLFMAQDNS N ++T++FA+DKL ++M LG+YYNN EEYA
Sbjct: 188 HFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYA 247

Query: 247 WYVLLNSVNMVKSRMSR 263
           WY ++ +VN  K+  SR
Sbjct: 248 WYSIMTTVNRAKAGFSR 264

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  237 bits (605), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 159/247 (64%), Gaps = 7/247 (2%)

Query: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76
           R +HPA++EYV P  +SP TY+ DS Q KILSH++   V   GF+E++I++++ +L    
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYS- 82

Query: 77  QSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXXXXXXX 136
            S+M+S IG             V+EL+K+NLV KR  + +                    
Sbjct: 83  -SSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTK-----DTNDNTTTTLKELLL 136

Query: 137 XXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196
               MDIPI   +    +QL  PG F+ D +LPEL +LADDMI+FSNEKDHHD AWYSKR
Sbjct: 137 KRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKR 196

Query: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256
           L VS AY++SK+FM QD S N++ T+ FA DK+++VM LG+YYNN EEYAW+ L+NS+N+
Sbjct: 197 LAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINL 256

Query: 257 VKSRMSR 263
           VKS+ SR
Sbjct: 257 VKSQFSR 263

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  236 bits (601), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 116/265 (43%), Positives = 166/265 (62%), Gaps = 9/265 (3%)

Query: 1   MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF 60
           M+   R++ R      R +HP+  E+ L +  +P TY   S QFK+L HA++  V  +GF
Sbjct: 1   MLALSRILAR------RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGF 54

Query: 61  SERAIIEAMKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDP 120
           +ERA++ ++ +L +    ++LS IG             V+EL+KF+LV KRY + + LDP
Sbjct: 55  NERALVASLNDLDL--GPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDP 112

Query: 121 L-TMQQXXXXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMI 179
             T                  ++ PI  H++  +S L IPG FL+ +ALPELHRL+DDM+
Sbjct: 113 ARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMV 172

Query: 180 YFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYY 239
           YFS E D +DFAWYSKR+ +S A++SS+LFMAQD S NY +T +FA +KL  V +LG YY
Sbjct: 173 YFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYY 232

Query: 240 NNTEEYAWYVLLNSVNMVKSRMSRA 264
           NNTEEY WY LL SVN+ KS+++R+
Sbjct: 233 NNTEEYMWYTLLMSVNLAKSQLTRS 257

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  235 bits (599), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 120/257 (46%), Positives = 162/257 (63%), Gaps = 5/257 (1%)

Query: 9   FRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEA 68
           FR  G   RF+ P   EY L  KL+P  Y   S QFK+L HA+ N V  +GF+ERA++ +
Sbjct: 6   FRTLG--RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVAS 63

Query: 69  MKELKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLD-PLTMQQXX 127
           + +L + +Q  +LS+IG             V+EL+KF+LV KRY + + LD         
Sbjct: 64  LNDLGLGSQ--VLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAE 121

Query: 128 XXXXXXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDH 187
                        ++IPI +H++  ++ L +PG FLL SALPELHRL+DDMIYFS E D 
Sbjct: 122 PPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDA 181

Query: 188 HDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAW 247
           +DFAWYSKR  +S A++SS+LFMAQD S NY +T +FA DKL  V +LG YY NTEEY W
Sbjct: 182 NDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMW 241

Query: 248 YVLLNSVNMVKSRMSRA 264
           Y LL SVN+ KS+++R+
Sbjct: 242 YTLLMSVNLAKSQITRS 258

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  234 bits (597), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 116/248 (46%), Positives = 164/248 (66%), Gaps = 5/248 (2%)

Query: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76
           R ++  +++    + L P  Y KDS Q++IL  A+ N+V  FGF+ERAII ++ +L    
Sbjct: 37  RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGY-- 94

Query: 77  QSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXXXXXXX 136
            S+M+S +G             V+ELLKFNLV KR ++ EG+DP T              
Sbjct: 95  NSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKD---LPSLEYLLL 151

Query: 137 XXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196
               MD  I   ++  +++L IPG FL ++++PEL RL+DDMIYFSNEKDHHD AWYSKR
Sbjct: 152 KRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKR 211

Query: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256
           L VS+ YI+S++FMAQD S +  +TL+FA+DKL KVM LG+YYNNTEE+ W+ L+ SVN+
Sbjct: 212 LAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNI 271

Query: 257 VKSRMSRA 264
           VKS+++R+
Sbjct: 272 VKSQLARS 279

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  225 bits (573), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 167/253 (66%), Gaps = 4/253 (1%)

Query: 12  SGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKE 71
           S V  R +HP   E+ LP  + P TY  DS QFK+LS+A++  V ++GF+ERAI++++ E
Sbjct: 2   SRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNE 61

Query: 72  LKIENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXX 131
           L +   S+ LS +G             V+EL+KF+LV KR ++I  L PL   +      
Sbjct: 62  LGM--GSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDL-PLDSDKPLPDLK 118

Query: 132 XXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFA 191
                    ++  +  H+S  +S + +PG FL  +AL ELH+L DDMI++SNE+DH+DFA
Sbjct: 119 TLFLQRLK-LNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFA 177

Query: 192 WYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLL 251
           WYSKR+ +S+AY+SS+LFMAQD S N++ET++FA+ KL KV +LG  YNNTEEY W+ LL
Sbjct: 178 WYSKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLL 237

Query: 252 NSVNMVKSRMSRA 264
           +S+N+ KS+++R 
Sbjct: 238 SSINLAKSQITRG 250

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  204 bits (518), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 155/253 (61%), Gaps = 12/253 (4%)

Query: 14  VNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELK 73
           V  R +HP T E+ + N+L P  Y +DSPQ+K+L  A++  V   GF+ERAI+ A  +L 
Sbjct: 4   VCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLG 63

Query: 74  IENQSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDP--LTMQQXXXXXX 131
               S +LSA+              V+EL+KF+LV KR  + +      ++M+Q      
Sbjct: 64  Y--GSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQRV 121

Query: 132 XXXXXXXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFA 191
                     D P+   ++  +S L +PG FL+++A+PEL RL+DD+IY+S EKDH D A
Sbjct: 122 EA--------DRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLA 173

Query: 192 WYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLL 251
           WYSKR  V+ AY+S+ LFMA+D S   +ETL FA+ +L++V  LG  YNN EE+AWY LL
Sbjct: 174 WYSKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLL 233

Query: 252 NSVNMVKSRMSRA 264
            ++N+VKS+++R 
Sbjct: 234 MAMNLVKSQLTRG 246

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  199 bits (506), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 150/248 (60%), Gaps = 9/248 (3%)

Query: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76
           RF+H  + EY + N L P  Y + SPQ+K+L+ A++  V   GF + AI++A  EL    
Sbjct: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY-- 72

Query: 77  QSTMLSAIGXXXXXXXXXXXXXVMELLKFNLVLKRYRMIEGLDPLTMQQXXXXXXXXXXX 136
            S +L+AIG             V EL+KF+LV KRY + E        Q           
Sbjct: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQEGTKTLEELFL 125

Query: 137 XXXXMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196
                +  +G H+   +S L IPG FL+++ LPEL +LADDMIY+S EKD +D AWYSKR
Sbjct: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185

Query: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256
           L VS AYIS++LFMA+D+S N++ T++FAK ++ ++  +G  YNN EE+AW+ LL +VN+
Sbjct: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245

Query: 257 VKSRMSRA 264
            +S++ R 
Sbjct: 246 ARSQLVRG 253

>Kwal_14.2384 s14 complement(734924..736510) [1587 bp, 528 aa] {ON}
           YKR016W - Hypothetical ORF [contig 225] FULL
          Length = 528

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 160 GPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKRLGVSS---------AYISSKLF 209
           GP LLD  + +L +LA   +  SNE+ ++ ++   K L  SS          +IS+K F
Sbjct: 393 GPQLLDVVVTQLDKLASQQLVLSNEQLYNRWSLLQKDLSTSSLLPPNAGILGHISAKFF 451

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,438,639
Number of extensions: 938857
Number of successful extensions: 2427
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2453
Number of HSP's successfully gapped: 27
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)