Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029707.350ON38138120100.0
Kpol_530.317.350ON38037717500.0
NCAS0A141607.350ON45137816490.0
KLTH0H01254g7.350ON38137716300.0
Kwal_56.246427.350ON38137516250.0
Skud_4.897.350ON38537716250.0
CAGL0L01111g7.350ON38137716200.0
KLLA0D12342g7.350ON38437816190.0
YDL168W (SFA1)7.350ON38638216170.0
Suva_4.787.350ON38537716160.0
Smik_4.707.350ON38638016090.0
TBLA0E00390singletonON38337515960.0
SAKL0F11374g7.350ON38337815960.0
KAFR0B008807.350ON38137715860.0
Ecym_47237.350ON38137515740.0
ZYRO0F11704g7.350ON38237915350.0
ACL148C7.350ON38137415320.0
TDEL0C019807.350ON38537515300.0
NDAI0A018907.350ON42237713790.0
KNAG0C037907.350ON38237813550.0
SAKL0A00880gsingletonON38837611621e-158
KLTH0G18986g8.16ON3543652784e-27
KLLA0B00451gsingletonON3863682761e-26
Suva_4.3943.118ON3513882681e-25
KLLA0D19929gsingletonON3863412682e-25
SAKL0B00814g8.16ON3543632662e-25
SAKL0C10164g3.118ON3513882653e-25
Ecym_53313.118ON3483792636e-25
AER032W3.118ON3513882636e-25
SAKL0F06270gna 1ON3513882601e-24
TBLA0I011402.480ON3773842592e-24
YOL086C (ADH1)3.118ON3483812565e-24
CAGL0J01441g2.480ON3723842566e-24
KLLA0B09064gna 2ON3743842568e-24
Suva_15.813.118ON3483812531e-23
KLTH0G15686g3.118ON3513882531e-23
NCAS0I01720singletonON3513762522e-23
TPHA0M007303.118ON3503822512e-23
Suva_13.2612.480ON3753872522e-23
TPHA0G032102.480ON3773782522e-23
KAFR0A007902.480ON3773872523e-23
CAGL0I07843g3.118ON3523812513e-23
Smik_13.520na 3ON3483822504e-23
KAFR0G014203.118ON3513872495e-23
Skud_13.477na 3ON3483822486e-23
KNAG0K020003.118ON3503752487e-23
ZYRO0C12562gna 1ON3483822479e-23
Skud_2.2723.118ON3513882452e-22
Smik_15.713.118ON3483812452e-22
KLTH0D05588g2.480ON3893772462e-22
TBLA0E034403.118ON3513882452e-22
TBLA0E03430singletonON3513882442e-22
Kwal_26.77992.480ON3873812452e-22
YBR145W (ADH5)3.118ON3513822433e-22
ZYRO0B05940g3.118ON3793912443e-22
KLLA0F21010g3.118ON3503822424e-22
YMR303C (ADH2)na 3ON3483822424e-22
Ecym_73912.480ON3753842434e-22
ABR229C8.16ON3533592425e-22
Skud_13.2402.480ON3753822425e-22
Suva_13.494na 3ON3483812416e-22
Skud_15.683.118ON3483812416e-22
KLLA0F13530g2.480ON3753852401e-21
Smik_2.2843.118ON3513882391e-21
NDAI0A069303.118ON3513842381e-21
Kwal_56.231983.118ON3513892382e-21
Smik_13.2662.480ON3753822363e-21
KLLA0F18260gsingletonON3482832354e-21
YMR083W (ADH3)2.480ON3753822346e-21
TDEL0A025602.480ON3733782347e-21
ABL033C2.480ON3733892347e-21
TDEL0D050503.118ON3513862328e-21
Kpol_1036.193.118ON3533832329e-21
NCAS0I023503.118ON3513872311e-20
NDAI0H021602.480ON3813822312e-20
KLTH0D00616g7.3ON3823922302e-20
Kpol_1058.118.16ON3532762293e-20
NCAS0A077802.480ON3733872293e-20
KLTH0E05588gna 1ON3483782283e-20
SAKL0E02838g2.480ON3772632284e-20
AAR084WsingletonON3852892285e-20
SAKL0B08184gna 2ON3733882242e-19
ZYRO0G03388g2.480ON3703832232e-19
Kwal_26.6684singletonON3563552213e-19
TDEL0C003908.16ON3533532213e-19
TDEL0H044607.3ON3822782213e-19
Kpol_431.82.480ON3802532196e-19
KAFR0L02010singletonON3513902188e-19
Kwal_55.19574singletonON3563572179e-19
ZYRO0G03410gsingletonON3733662171e-18
KLLA0F00506g7.3ON3852352171e-18
ZYRO0F02552g8.16ON3512932142e-18
YLR070C (XYL2)8.16ON3563842143e-18
Suva_12.260singletonON3573772133e-18
TDEL0F03190na 1ON3513772124e-18
KNAG0E025902.480ON3742682134e-18
YAL060W (BDH1)7.3ON3822382126e-18
KAFR0L02000singletonON3613842116e-18
Suva_10.1548.16ON3563702091e-17
CAGL0D00198g7.3ON3833732091e-17
KNAG0K01040singletonON3913232082e-17
KLLA0D05511g8.16ON3543542063e-17
NCAS0J003008.16ON3572692046e-17
Smik_1.67.3ON3822382021e-16
KLTH0A00418gsingletonON3563801983e-16
Skud_1.37.3ON3822381975e-16
TBLA0A042907.3ON3952391951e-15
YJR159W (SOR1)na 4ON3573631922e-15
Smik_48.1singletonON3573801903e-15
Kwal_55.20564singletonON2162241844e-15
Suva_1.77.3ON3822381905e-15
YDL246C (SOR2)singletonON3573631895e-15
Kwal_26.67397.3ON3822981896e-15
Skud_20.2singletonON3573651886e-15
Skud_4.2singletonON3573651886e-15
SAKL0D14872g7.3ON3833061842e-14
SAKL0D14894g7.2ON3853051833e-14
NDAI0H020507.3ON3852821816e-14
NCAS0A076607.3ON3862441808e-14
Kpol_1049.187.2ON3862411791e-13
KAFR0I001607.2ON3853851772e-13
NCAS0A076707.2ON4393041754e-13
KNAG0D00110singletonON3622821701e-12
Kwal_56.229853.253ON3463681567e-11
KAFR0C005803.253ON3343301559e-11
KLLA0F00528g7.2ON3812911551e-10
KNAG0I00120singletonON3812291541e-10
TDEL0D037203.253ON3353551532e-10
Smik_2.1703.253ON3342501504e-10
YAL061W (BDH2)7.2ON4173121514e-10
KAFR0I001707.3ON3813001497e-10
TPHA0J00170singletonON3613391488e-10
YBR046C (ZTA1)3.253ON3342491478e-10
Suva_1.67.2ON4172401489e-10
Skud_1.27.2ON4172411471e-09
NDAI0H02950singletonON3633051452e-09
Smik_1.57.2ON4172411452e-09
KNAG0E042007.2ON3853421433e-09
Kwal_47.17532na 5ON3733011425e-09
SAKL0H22088gna 5ON3763251417e-09
Suva_4.2793.253ON3342261407e-09
NDAI0H020607.2ON3993041372e-08
NDAI0A063203.253ON3492461362e-08
KLLA0A10549g3.253ON3532421363e-08
Skud_2.1623.253ON3342501353e-08
NCAS0C03020singletonON3623561354e-08
KLTH0E07964gna 5ON3742541311e-07
TPHA0H03100singletonON3922411283e-07
ABL090W3.253ON3342851273e-07
KAFR0A08730singletonON3602821255e-07
NCAS0D01220na 6ON3623191255e-07
CAGL0M14047gna 7ON3593281231e-06
KNAG0K02680singletonON3592831231e-06
ZYRO0A03366g3.253ON3493261212e-06
Ecym_1093singletonON3832831212e-06
NDAI0G04880singletonON3613091202e-06
NCAS0I017303.253ON3492481185e-06
CAGL0H09944g3.253ON3333371132e-05
KLTH0B04972gna 8ON3603101132e-05
CAGL0H06853gsingletonON3603211122e-05
SAKL0D14938gsingletonON3782811123e-05
KNAG0B06990singletonON3583061104e-05
Skud_13.494na 7ON3603181104e-05
KLLA0F00638gna 9ON3822541096e-05
SAKL0H00374gsingletonON4283591062e-04
KLTH0C07854g3.253ON3583471024e-04
KLTH0C10538gsingletonON273161980.001
Suva_13.513na 7ON360310990.001
KLLA0E19889gna 8ON366172970.002
TDEL0A00140singletonON405154960.003
KLTH0B00506gna 9ON398317950.003
Smik_13.535na 7ON360321940.004
Kwal_8.605singletonON379347920.008
Kwal_27.12835singletonON364304900.012
TDEL0F02300na 5ON379292880.019
TPHA0A00140singletonON362353860.034
SAKL0C00264gsingletonON359345860.041
Kwal_26.9050singletonON36488860.043
YMR318C (ADH6)na 7ON360351850.044
Kpol_526.18singletonON361214810.16
KAFR0H03770singletonON365232790.26
Smik_26.3singletonON12580740.33
ZYRO0G10318gna 5ON37698770.50
Suva_6.13singletonON6859661.4
Suva_7.5singletonON212107721.5
YCR102CsingletonON368119731.6
TDEL0A063308.688ON72371731.7
YLR460Cna 10ON376119703.1
KLTH0F01056g1.29ON77154713.4
KAFR0C01550singletonON35985694.6
Kpol_1032.712.373ON36280669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02970
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   778   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   678   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   639   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   632   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   630   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   630   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   628   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   628   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   627   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   627   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   624   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      619   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   619   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   615   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   610   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   595   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   594   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   593   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    535   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   526   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   452   e-158
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...   111   4e-27
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   110   1e-26
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...   107   1e-25
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   107   2e-25
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...   107   2e-25
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   106   3e-25
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...   105   6e-25
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...   105   6e-25
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...   104   1e-24
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   104   2e-24
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...   103   5e-24
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   103   6e-24
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...   103   8e-24
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...   102   1e-23
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...   102   1e-23
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}              101   2e-23
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...   101   2e-23
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...   101   2e-23
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...   101   2e-23
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...   101   3e-23
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...   101   3e-23
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...   100   4e-23
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...   100   5e-23
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...   100   6e-23
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....   100   7e-23
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...   100   9e-23
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    99   2e-22
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    99   2e-22
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    99   2e-22
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    99   2e-22
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               99   2e-22
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    99   2e-22
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    98   3e-22
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    99   3e-22
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    98   4e-22
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    98   4e-22
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    98   4e-22
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    98   5e-22
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    98   5e-22
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    97   6e-22
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    97   6e-22
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    97   1e-21
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    97   1e-21
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    96   1e-21
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    96   2e-21
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    96   3e-21
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    95   4e-21
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    95   6e-21
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    95   7e-21
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    95   7e-21
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    94   8e-21
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    94   9e-21
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     94   1e-20
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     94   2e-20
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    93   2e-20
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    93   3e-20
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    93   3e-20
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    92   3e-20
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    92   4e-20
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    92   5e-20
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    91   2e-19
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    91   2e-19
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    90   3e-19
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    90   3e-19
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    90   3e-19
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    89   6e-19
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              89   8e-19
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    88   9e-19
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    88   1e-18
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    88   1e-18
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    87   2e-18
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    87   3e-18
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    87   3e-18
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    86   4e-18
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    87   4e-18
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    86   6e-18
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              86   6e-18
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    85   1e-17
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    85   1e-17
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    85   2e-17
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    84   3e-17
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       83   6e-17
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     82   1e-16
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    81   3e-16
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     80   5e-16
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    80   1e-15
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    79   2e-15
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    78   3e-15
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    75   4e-15
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     78   5e-15
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    77   5e-15
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    77   6e-15
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     77   6e-15
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    77   6e-15
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    75   2e-14
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    75   3e-14
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    74   6e-14
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    74   8e-14
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    74   1e-13
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    73   2e-13
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    72   4e-13
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   70   1e-12
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    65   7e-11
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    64   9e-11
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    64   1e-10
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  64   1e-10
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    64   2e-10
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    62   4e-10
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    63   4e-10
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    62   7e-10
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                62   8e-10
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    61   8e-10
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     62   9e-10
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      61   1e-09
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    60   2e-09
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     60   2e-09
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    60   3e-09
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    59   5e-09
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    59   7e-09
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    59   7e-09
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    57   2e-08
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    57   2e-08
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    57   3e-08
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    57   3e-08
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    57   4e-08
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    55   1e-07
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    54   3e-07
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    54   3e-07
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    53   5e-07
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               53   5e-07
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    52   1e-06
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    52   1e-06
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    51   2e-06
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    51   2e-06
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    51   2e-06
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     50   5e-06
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    48   2e-05
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    48   2e-05
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    48   2e-05
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    48   3e-05
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             47   4e-05
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    47   4e-05
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    47   6e-05
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    45   2e-04
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    44   4e-04
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    42   0.001
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    43   0.001
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    42   0.002
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 42   0.003
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    41   0.003
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    41   0.004
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    40   0.008
Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]...    39   0.012
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    39   0.019
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 38   0.034
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    38   0.041
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    38   0.043
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    37   0.044
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    36   0.16 
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    35   0.26 
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      33   0.33 
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    34   0.50 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    30   1.4  
Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)      32   1.5  
YCR102C Chr3 complement(304361..305467) [1107 bp, 368 aa] {ON} P...    33   1.6  
TDEL0A06330 Chr1 (1108746..1110917) [2172 bp, 723 aa] {ON} Anc_8...    33   1.7  
YLR460C Chr12 complement(1059757..1060887) [1131 bp, 376 aa] {ON...    32   3.1  
KLTH0F01056g Chr6 complement(80904..83219) [2316 bp, 771 aa] {ON...    32   3.4  
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    31   4.6  
Kpol_1032.71 s1032 (157929..159017) [1089 bp, 362 aa] {ON} (1579...    30   9.8  

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/381 (100%), Positives = 381/381 (100%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE
Sbjct: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60

Query: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ 120
           GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ
Sbjct: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180
           GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT
Sbjct: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180

Query: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240
           TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA
Sbjct: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240

Query: 241 TDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           TDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA
Sbjct: 241 TDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 361 NAAFEDLHNGSCLRTVLDTST 381
           NAAFEDLHNGSCLRTVLDTST
Sbjct: 361 NAAFEDLHNGSCLRTVLDTST 381

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/377 (85%), Positives = 351/377 (93%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MS VGKPITC AA+AYEA KPL V EIVVDPPKAHEVRIKI+ TAVCHTDAY+LSGVDPE
Sbjct: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60

Query: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ 120
           GLFPCVLGHEGSGIVES+G +VT VK GDHV+ALYTAECGKCKFCLSGKTNLCGSVRATQ
Sbjct: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180
           GKGVMPDGT RFH+K G+P+YHFMGCSTFS+YTVVADVS+VA D +   +   LLGCGVT
Sbjct: 121 GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT 180

Query: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240
           TGYGAAIKTAN+QKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+NNDKK+WS EFGA
Sbjct: 181 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA 240

Query: 241 TDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           TDFVNP EL + +DIVSKL+EMTDGGLDFTFDCTGNVNVMR+ALEACHKGWGQSIIIGVA
Sbjct: 241 TDFVNPSELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ+G+LKVDEFIT RRPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 361 NAAFEDLHNGSCLRTVL 377
           N AFE+LH+G+CLRTVL
Sbjct: 361 NDAFEELHHGNCLRTVL 377

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/378 (83%), Positives = 345/378 (91%), Gaps = 1/378 (0%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S  GKPITCTAA+AY A KPLTV +IVVDPPKAHEVRIKI  TAVCHTDAY+LSG+DPEG
Sbjct: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130

Query: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121
            FP +LGHEGSGIVES+G  VTNVKVGDHVIALYTAECGKCKFC SGKTNLCGSVRATQG
Sbjct: 131 AFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQG 190

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
           KGVMPDGT+RFH++ G+P+ HFMGCSTFSQYTVVADVS+VA D     +  +LLGCGVTT
Sbjct: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVTT 250

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           GYGAAIKTAN+QKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+NNDKK WSF+FGAT
Sbjct: 251 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310

Query: 242 DFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           DFVNPKE LK+ E IV KLIEMTDGGL++TFDCTGNV VMR+ALEACHKGWG+SIIIGVA
Sbjct: 311 DFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGVA 370

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
            AG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLI+DYQ+G LKVDEFIT RRPFTEI
Sbjct: 371 GAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430

Query: 361 NAAFEDLHNGSCLRTVLD 378
           N AFEDLH+G CLRTVLD
Sbjct: 431 NDAFEDLHHGDCLRTVLD 448

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/377 (80%), Positives = 336/377 (89%), Gaps = 1/377 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GKPITCTAA+AYEA KPLTV EIVVDPPKAHEVRIK+  TAVCHTDAY+LSGVDPEG FP
Sbjct: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEG+G+VES+G  VTNVK GDHVIALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 64  SILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGT+RFH+K G+ + HFMGCSTFSQYTVVADVS+VA D     + T LLGCGVTTGYG
Sbjct: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AA+KTA++QKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVD+N+ KK WS +FGATDFV
Sbjct: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243

Query: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NP K LKD + IV KL+EMTDGGLDFTFDCTGN +VMR+ALEACHKGWGQSIIIGVAAAG
Sbjct: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGL+ DY  G LKVDEFIT RR FT+IN+A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 364 FEDLHNGSCLRTVLDTS 380
           FEDLH+G CLRTVLD S
Sbjct: 364 FEDLHHGDCLRTVLDLS 380

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/375 (81%), Positives = 335/375 (89%), Gaps = 1/375 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GKPITC AA+AYEA KPLT+ EIVVDPPKAHEVR+KI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEG+GIVESIG  VTNVK GDHVIALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGTTRFH+K G+ I HFMGCSTFSQYTV+ADVS+VA D     + T LLGCGVTTGYG
Sbjct: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AA+KTAN+QKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVD+N+ KK W+ EFGATDFV
Sbjct: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243

Query: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NP K+LKD + IV  L+EMTDGGLD+TFDCTGN +VMR+ALEACHKGWG+SIIIGVAAAG
Sbjct: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLI DY  G LKVDEFIT RR FT+IN+A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 364 FEDLHNGSCLRTVLD 378
           FEDLH+G CLRTVLD
Sbjct: 364 FEDLHHGDCLRTVLD 378

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/377 (80%), Positives = 331/377 (87%), Gaps = 1/377 (0%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           + VGKPI C AA+AY A K L+V EI VDPPKAHEVRIKI  TAVCHTDAY+LSG DPEG
Sbjct: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63

Query: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEG+GIVES+G DV  VK GDHVIALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
           KGVMPDGTTRFH+  G+ IYHFMGCSTFS+YTVVADVS+VA D     +   LLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           GYGAAIKTAN+Q+GDTVAVFG GTVGLSV+QGAKSRGASKII VD+NN K+ +S  FGAT
Sbjct: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243

Query: 242 DFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           DF+NPKE L + + IV KLI+MTDGGLDFTFDCTGN N+MR+ALEACHKGWGQSIIIGVA
Sbjct: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQSG LKV+EFIT RRPF EI
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEI 363

Query: 361 NAAFEDLHNGSCLRTVL 377
           N AFEDLHNG CLRTVL
Sbjct: 364 NQAFEDLHNGDCLRTVL 380

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/377 (79%), Positives = 334/377 (88%), Gaps = 1/377 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GKPI C AA+AYEA KP  V +IVVDPPKAHEVRIKIV TAVCHTDAY+LSG DPEGLFP
Sbjct: 4   GKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFP 63

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           CVLGHEG+GIVES+G  VTNVK GDHVIALYTAEC KCKFCLSGKTNLCG+VRATQGKGV
Sbjct: 64  CVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGV 123

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGT+RFH+K G+ +YHFMGCSTFS+YTVVADVS+VA D++   E   LLGCGVTTGYG
Sbjct: 124 MPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYG 183

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AA+KTAN+QKGDTVAVFG GTVGLSV+QGA  RGAS+II +D N+ KKD+  +FGATDF+
Sbjct: 184 AAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243

Query: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NP K+LK++E IV+KLIEMTDGGLD TFDCTGNVNVMR+ALEACHKGWGQS+IIGVAAAG
Sbjct: 244 NPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAG 303

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           QEI+TRPFQLVTGRVW+GSAFGG+KGRSEM GLI+ Y+ G LKVDEFIT RR F EIN A
Sbjct: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363

Query: 364 FEDLHNGSCLRTVLDTS 380
           F+DLHNG CLRTVL  S
Sbjct: 364 FDDLHNGLCLRTVLSFS 380

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/378 (79%), Positives = 333/378 (88%), Gaps = 1/378 (0%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           +  GKPI C AA+AYEA KPLTV +I+VD PKAHEVR+++  TAVCHTDAY+LSGVDPEG
Sbjct: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63

Query: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121
            FP +LGHEG+GIVES+G  VTNVKVGDHV+ LYTAECGKCKFC S KTNLCGSVRATQG
Sbjct: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
           KGVMPDGTTRFH+  G+P+ HFMGCSTFSQYTVVADVSLV  D S       LLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           GYGAA+KTAN+Q+GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+N+ KK WS +FGAT
Sbjct: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243

Query: 242 DFVNP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
            FVNP K+LK+ E IVSKLI+MTDGGLDFTFDCTGNV VMR+ALEACHKGWGQSIIIGVA
Sbjct: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAG+EI+TRPFQL+TGRVW+GSAFGGIKGRSEMG L+  YQ G LKVD+FIT +RPFTEI
Sbjct: 304 AAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363

Query: 361 NAAFEDLHNGSCLRTVLD 378
           N AFEDLH+G CLRTVLD
Sbjct: 364 NNAFEDLHHGDCLRTVLD 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/382 (79%), Positives = 332/382 (86%), Gaps = 3/382 (0%)

Query: 1   MSA--VGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVD 58
           MSA  VGKPI C AA+AY+A KPL+V EI VD PKAHEVRIKI  TAVCHTDAY+LSG D
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 59  PEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRA 118
           PEGLFPCVLGHEG+GIVES+G DV  VK GDHVIALYTAECGKCKFC SGKTNLCG+VRA
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
           TQGKGVMPDGTTRFH+  G+ IYHFMGCSTFS+YTVVADVS+VA D     +   LLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
           VTTG+GAA+KTAN+QKGDTVAVFG GTVGLSV+QGAK RGASKII +D+NN KK +  +F
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 239 GATDFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297
           GATDFVNPKE L   + IV KLIEMTDGGLDFTFDCTGN  +MR+ALEACHKGWGQSIII
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 298 GVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357
           GVAAAG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ G LKV+EFIT RRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 358 TEINAAFEDLHNGSCLRTVLDT 379
            EIN AFEDLHNG CLRTVL +
Sbjct: 361 KEINQAFEDLHNGDCLRTVLKS 382

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/377 (79%), Positives = 331/377 (87%), Gaps = 1/377 (0%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S VGKPI C AAIAY+A KPL+V EI VDPPKAHEVRIKI  TAVCHTDAY+LSG DPEG
Sbjct: 4   STVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEG+GIVES+G DVT VK GDHVIALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
           +G+MPD TTRFH+  G+ IYHFMGCSTFS+YTVVADVS+VA D     +  +LLGCGVTT
Sbjct: 124 RGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTT 183

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           GYGAA+KTAN+QKGDTVAVFG GTVGLSV+QGAK+RGASKII +D+NN KK + F+FGAT
Sbjct: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGAT 243

Query: 242 DFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           DF+NPKE L   + IV KLIE TDGGLDFTFDCTGN  +MR+ALEACHKGWGQSIIIGVA
Sbjct: 244 DFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ+G LKV+EFIT RRPF EI
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEI 363

Query: 361 NAAFEDLHNGSCLRTVL 377
           N AFEDLH G CLRTVL
Sbjct: 364 NQAFEDLHQGDCLRTVL 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 331/380 (87%), Gaps = 3/380 (0%)

Query: 1   MSA--VGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVD 58
           MSA  VGKPI C AA+AY+A KP +V EI VD PKAHEVRIKI  TAVCHTDAY+LSG D
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 59  PEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRA 118
           PEGLFPC+LGHEG+GIVES+G  V  VK GDHVIALYTAECGKCKFC SGKTNLC +VRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
           TQGKGVMPDGTTRFH+  GK IYHFMGCSTFS+YTVVADVS+VA D     + + LLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
           VTTGYGAA+KTAN+QKGDTVAVFG GTVGLSV+QGAK RGASKII VD+NN+KK +  +F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 239 GATDFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297
           GATDF+NPKE L   + IV KL+EMTDGGLDFTFDCTGN  +MR+ALEACHKGWGQSIII
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 298 GVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357
           GVAAAG+EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQSG LKV+EFIT RRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 358 TEINAAFEDLHNGSCLRTVL 377
            EIN AFEDLHNG CLRTVL
Sbjct: 361 KEINHAFEDLHNGDCLRTVL 380

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/375 (78%), Positives = 334/375 (89%), Gaps = 1/375 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GKPI C AA+AY+A +PLTV EI+V+PP+AHEVRIKI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 6   GKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGAFP 65

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           CVLGHEGSGIVES+G  V++VKVGDHVIALYTAECG CKFC SGKTNLCGSVR TQGKGV
Sbjct: 66  CVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGKGV 125

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGT+RF +  G+ + HFMGCSTFSQYTVVADVS+VA +K+   +   LLGCGVTTGYG
Sbjct: 126 MPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTGYG 185

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AAIKTAN+QK DTVAVFGAGTVGLSVVQGA++RGASKII+VD+N+ K+ +S +FGATDF+
Sbjct: 186 AAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATDFI 245

Query: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NP  +LK  E IVSKL+EMTDGGLD TFDCTGNV VMR+ALE CHKGWGQSIIIGVAAAG
Sbjct: 246 NPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAAAG 305

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           QEI+TRPFQLVTGRVW+GSAFGG+KGRSEMGGLI+ YQ G LKVD+FIT +RPFTEINAA
Sbjct: 306 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEINAA 365

Query: 364 FEDLHNGSCLRTVLD 378
           FEDLH+G CLRTVLD
Sbjct: 366 FEDLHHGDCLRTVLD 380

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/378 (81%), Positives = 338/378 (89%), Gaps = 1/378 (0%)

Query: 4   VGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLF 63
           VGKPITC AA+AYEA KPLTV EI+V+PPKAHEVRI+I  TAVCHTDAY+LSGVDPEG F
Sbjct: 5   VGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAF 64

Query: 64  PCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123
           P +LGHEG+G+VES+G  VTNVK GDHV+ALYTAEC KCKFC SGKTNLCGSVRATQGKG
Sbjct: 65  PSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKG 124

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
           VMPDGT+RF  K+G+ I HFMGCSTFSQYTVVADVS+VA D     +   LLGCGVTTGY
Sbjct: 125 VMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTGY 184

Query: 184 GAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
           GAAIKTAN+QKGDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVD+N+ KK W+ +FGATDF
Sbjct: 185 GAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244

Query: 244 VNP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAA 302
           VNP K+LK+ E IVSKLIE+TDGGLDFTFDCTGN  VMR+ALEACHKGWGQSIIIGVAAA
Sbjct: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304

Query: 303 GQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINA 362
           GQEI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGL+ DY  G LKVDEFIT RRPFTEINA
Sbjct: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364

Query: 363 AFEDLHNGSCLRTVLDTS 380
           AF+DLH+G CLRTVLD S
Sbjct: 365 AFDDLHHGDCLRTVLDLS 382

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/377 (77%), Positives = 332/377 (88%), Gaps = 1/377 (0%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S  GK I C AA+AYEA KPL V +++VD PKAHEVRIKI+ TA+CHTDAY+LSGVDPEG
Sbjct: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62

Query: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           LFPC+LGHEGSGIVESIG  VT+VKVGDHVI LYTAEC KCKFC SGKTNLCG+VR TQG
Sbjct: 63  LFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQG 122

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
           KGVMPDGT+RFH  +GK I+HFMGCSTFS+YTVVADVS+VA DK VS EP +LLGCGVTT
Sbjct: 123 KGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT 182

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           G+GAA+K AN+QKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVD+N++KK +S++FGAT
Sbjct: 183 GFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242

Query: 242 DFVNP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           DFVNP  +LKD E IV+KLI MTDGGLD+TFDCTGNV+VMRNALEACHKGWGQS IIGVA
Sbjct: 243 DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVA 302

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAGQEI+TRPFQLVTGRVWRG+AFG IKGR++M  L+ DY+ G LK+DEFIT RR F EI
Sbjct: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362

Query: 361 NAAFEDLHNGSCLRTVL 377
           N  FEDLH G+CLRTVL
Sbjct: 363 NDGFEDLHMGTCLRTVL 379

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/375 (78%), Positives = 327/375 (87%), Gaps = 1/375 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GK I C AAIAY A  PL +  I VDPPKAHEVRIKI  TA+CHTDAY+LSGVDPEG+FP
Sbjct: 6   GKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFP 65

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEGSGIVES+G  VTNVKVGDHVI LYTAEC +CKFC+SGKTNLCGSVRATQGKG+
Sbjct: 66  SILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGL 125

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGT+RF +  G+ IYHFMGCSTFS+YTVVADVS+VA D+    +   LLGCGVTTGYG
Sbjct: 126 MPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYG 185

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AA+KTA++QKGDTVAVFGAGTVGLSVVQGA+SRGASKIIVVD+N+DKK WSF+FGATDF+
Sbjct: 186 AAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFI 245

Query: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NP K+L D E IVSKLI+MTDGGLD TFDCTGN  VMR+ALEACHKGWGQSIIIGVAAAG
Sbjct: 246 NPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           QEI+TRPFQLVTGRVW+GSAFGGIKGRSEMG LI DY +G LKVDEF+T  RPF+EIN  
Sbjct: 306 QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG 365

Query: 364 FEDLHNGSCLRTVLD 378
             DLH+G CLRTVL+
Sbjct: 366 LTDLHHGDCLRTVLN 380

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/379 (77%), Positives = 331/379 (87%), Gaps = 1/379 (0%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MS  GKP+T  AA+AYEA KPL+V EI VDPPKAHEVRI++ KTAVCHTDAY+LSG DPE
Sbjct: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60

Query: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ 120
           G FP +LGHEG+GIVES+G  VT+VK GDHV+ALYTAECGKCKFC SGKTNLCGSVRATQ
Sbjct: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180
           GKGVMPDGT+RF +K G+ + HFMGCSTFS+YTVVADVS+VA D     E   LLGCGVT
Sbjct: 121 GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVT 180

Query: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240
           TGYGAA+KTAN+QKGDTVA+FGAGTVGLSV QGAK+RGAS+II+VD+N+ KK +  EFGA
Sbjct: 181 TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240

Query: 241 TDFVNPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGV 299
           TDF+NP  +L++ + IV KLIEMTDGGLDFTFDCTGNV VMR+ALEACHKGWG S++IGV
Sbjct: 241 TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGV 300

Query: 300 AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
           AA+GQEI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ G LKVDEFIT RRPF +
Sbjct: 301 AASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360

Query: 360 INAAFEDLHNGSCLRTVLD 378
           IN AFEDLH G  LRTVL+
Sbjct: 361 INEAFEDLHAGDSLRTVLN 379

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/374 (76%), Positives = 334/374 (89%), Gaps = 1/374 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GKPI CTAA+AY A +PL + ++ VDPPKAHEVRIKIV +A+CHTDAY+LSG DPEGLFP
Sbjct: 6   GKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGLFP 65

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           C+LGHEGSGIVES+G  VTNVK GDHV+ LYTAEC +CKFC+SGKTNLCG+VRATQGKGV
Sbjct: 66  CILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGT+RF +  G+ +YHFMGCSTFS+YTVVADVS+VA D+    E   LLGCGVTTGYG
Sbjct: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTGYG 185

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AA+KTA++Q+GDTVAVFGAGTVGLSVVQGAK+R AS+IIVVD+N+ K++W+ +FGATDF+
Sbjct: 186 AAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFI 245

Query: 245 NPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NPK +LK+ E IV++LIEMTDGGLD TFDCTGN  VMR+ALEACHKGWGQSIIIGVAAAG
Sbjct: 246 NPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           QEI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGL++DY +GTLKV EF+T +RPF EIN+ 
Sbjct: 306 QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365

Query: 364 FEDLHNGSCLRTVL 377
           FEDLH+G CLRTVL
Sbjct: 366 FEDLHHGDCLRTVL 379

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/375 (78%), Positives = 327/375 (87%), Gaps = 1/375 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GK ITC AA+AYEA KPLTV EI V+ P+AHEVRIKI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 8   GKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFP 67

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEG+GIVES+G  VTNVK GDHVIALYTAEC KCKFC SGKTNLC SVRATQGKGV
Sbjct: 68  SILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGV 127

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MPDGT+RF ++ G+ + HFMGCSTFSQYTVVADVS+VA D S   E   LLGCGVTTGYG
Sbjct: 128 MPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTGYG 187

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AA KTAN+QKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VD+N+ K+ +  EFGATDF+
Sbjct: 188 AATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFI 247

Query: 245 NPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NPK +LKD + IV KLIEMTDGGLD+TFDCTGN  VMR+ALEACHKGWG S+IIGVAAA 
Sbjct: 248 NPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAE 307

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLI+DY+ GTLKVDEFIT  RPFTEIN A
Sbjct: 308 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKA 367

Query: 364 FEDLHNGSCLRTVLD 378
           FEDLH G CLRTVLD
Sbjct: 368 FEDLHAGDCLRTVLD 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/377 (71%), Positives = 295/377 (78%), Gaps = 47/377 (12%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           GKPITCTAA+AYEA KPLTV +IVVDPPKAHEVRIKI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 91  GKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGAFP 150

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
            +LGHEGSGIVES+G  VTNVKVGDHVIALYTAECG+CKFC SG                
Sbjct: 151 SILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX------------- 197

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
                                                A DK+   +   LLGCGVTTGYG
Sbjct: 198 ---------------------------------XXXXAVDKNAPMDSICLLGCGVTTGYG 224

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           AAIKTAN+QKGDTVAVFGAGTVGLSVVQGAK+RGASKIIVVD+N+ KK WS +FGATDF+
Sbjct: 225 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATDFI 284

Query: 245 NPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NPK +LK+ E IVSKLIEMTDGGL++TFDCTGN  VMR+ALEACHKGWG+SIIIGVAAAG
Sbjct: 285 NPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVAAAG 344

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ+G LKVDEFIT RRPFTEIN A
Sbjct: 345 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEINNA 404

Query: 364 FEDLHNGSCLRTVLDTS 380
           FEDLH+G CLRTVLD S
Sbjct: 405 FEDLHHGDCLRTVLDLS 421

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 304/378 (80%), Gaps = 6/378 (1%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           G+ ITCTAA+AY A KPLTV +I V+ P     R        C+     +  V       
Sbjct: 6   GQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWFGSEVR 63

Query: 65  CV---LGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121
           CV    G  G+G+VES+G DVT+VKVGDHVIALYTAEC +CK C SGKTNLC +VRATQG
Sbjct: 64  CVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
           KGVMPDGT+RF +  G+P+ HFMGCSTF++YTVVADVS+VA D+    E   LLGCGVTT
Sbjct: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           GYGAA+KTAN+QKGDTVAVFGAGT+GLSVVQGAK+R ASKIIVVD+N+ KK ++F+FGAT
Sbjct: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243

Query: 242 DFVNPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           DFVNPK +LKD + IV KL+EMTDGGLDFTFD TGNV VMR+ALEACHKGWGQSIIIGVA
Sbjct: 244 DFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           AAG+EI+TRPFQLVTGRVW+GSAFGG+KGRSEMG LI+DY  G LK+DEFIT +RPF EI
Sbjct: 304 AAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363

Query: 361 NAAFEDLHNGSCLRTVLD 378
           N  FEDLH+G CLRTVL+
Sbjct: 364 NEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 205/376 (54%), Positives = 278/376 (73%), Gaps = 2/376 (0%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           G+PI CTAA+AY  NKPL + +I+VDPP+ HEVR+K+  TA+C TD ++L G++PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           CVLGHEGSGIVES G+ V  VK GDHV+ LY  ECG C  C S K+NLC  ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
           MP G++R H+ + K ++HFMGCS+FSQY VV+D+S V        +   LLGCGVTTG+G
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           A I    ++ GD VAVFG+GTVGLSVVQ        ++IVVD+ ++K++W+  FGATDF+
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 245 NPKELKDSEDIVSKLIEMTDG-GLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           NP+++  ++ ++  LI+ + G G DFTFDCTG+ +VMR ALE+C KGWG S+IIG+A AG
Sbjct: 245 NPQKIPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGAG 304

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           +EI+T P+ L+ GR W G AFGG+KGRSE+  L++ Y +  +K+DE+IT +RP  EIN A
Sbjct: 305 EEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINEA 364

Query: 364 FEDLHNGSCLRTVLDT 379
            ++L +G  L+TVLDT
Sbjct: 365 LKELEDGLVLKTVLDT 380

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score =  111 bits (278), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 106/365 (29%), Positives = 169/365 (46%), Gaps = 55/365 (15%)

Query: 28  VVDPPKAHEVRIKIVKTAVCHTDA-YSLSGVDPEGLF--PCVLGHEGSGIVESIGADVTN 84
           + DP   H V+++I KT +C +D  Y ++G   + +   P +LGHE SG+V  +G++V+ 
Sbjct: 26  ITDP---HYVKLQIKKTGICGSDVHYYVAGAIGDFVVKKPMILGHESSGLVVEVGSEVSR 82

Query: 85  VKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFM 144
           V+VGD V               +G+ NLC  ++      +           DG  + +++
Sbjct: 83  VRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI-----------DGTLVKYYL 131

Query: 145 GCSTFSQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANIQKGDTVAVF 201
               F          LV     VS+E  AL   L  GV      A K A +     VAVF
Sbjct: 132 APEDF----------LVKLPDHVSYEEGALVEPLSVGVH-----ANKLAGVAFNQRVAVF 176

Query: 202 GAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIE 261
           GAG VGL     A++ GAS+++ +D+   K   S  FG T FVN   +KD +D+V K IE
Sbjct: 177 GAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNSANIKDEDDLV-KEIE 235

Query: 262 MTDGGL--DFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW 319
              GG   D  FDCTG    +R  ++ C+ G G  + +G+   G +    P   +  +  
Sbjct: 236 RVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM---GHDDVNFPIGAIGAKEL 291

Query: 320 R-----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFE-DLHNGS-C 372
           +       AFG  +   ++        SG + V   +T R  F +  AA+E ++ +GS  
Sbjct: 292 KVLGCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSEV 345

Query: 373 LRTVL 377
           ++T++
Sbjct: 346 IKTII 350

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  110 bits (276), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 101/368 (27%), Positives = 159/368 (43%), Gaps = 43/368 (11%)

Query: 6   KPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE----- 60
           +P    A + Y AN        +       +  IK+  T++C TD     G  PE     
Sbjct: 27  QPGMMKAMVYYGANDLRFEDRAIPKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIA 86

Query: 61  ----GLFP-CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGS 115
               G F   VLGHEG+GIV  +G  V N+K GD VI      CG C+ C  G    C  
Sbjct: 87  VKNEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC-- 144

Query: 116 VRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALL 175
                    M DG            Y   G       T  AD SL A  + +S E   LL
Sbjct: 145 ---------MNDGGWALG-------YSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLL 188

Query: 176 GCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWS 235
              + T +   ++  N++ GD+VA+ GAG VG+  V  ++    S +IVVD+++++ + +
Sbjct: 189 SDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMA 248

Query: 236 FEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLDFTFDCTGNVNVMRNALEACHKGWGQS 294
            E GAT  +N  +    ED V+K++E+T+G G+D   +  G     +   + C     Q 
Sbjct: 249 KEMGATHTINSGK----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QI 296

Query: 295 IIIGVAAAGQEIATRPFQLVTGRVW--RGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFIT 352
           I  G   A   +  +P      ++W    +   G+   +    L+K+  SG L+ D+ ++
Sbjct: 297 IKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVS 356

Query: 353 GRRPFTEI 360
               F ++
Sbjct: 357 HHCNFKDM 364

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score =  107 bits (268), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 112/388 (28%), Positives = 169/388 (43%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MS+   P +  A + YE N  L   +I V  PKA+E+ + +  + VCH+D ++  G  P 
Sbjct: 1   MSSQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPF 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
            L FP + GHEG+G+V  +G++V   KVGD   I      C  C++C  G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                   DGT   HD             TF +Y     V      ++V     A + C 
Sbjct: 119 --------DGTGFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K AN+  G  V + GA G +G   +Q A + G  ++I +D    KK     
Sbjct: 159 GVTVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEG 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA----CHKGWGQ 293
            G   F++       +DIV  +I+ TDGG         NV+V   A+EA    C    G 
Sbjct: 217 LGGEVFID---FTKEKDIVGAVIKATDGGSHGVI----NVSVSEAAIEASTRYCRPN-GT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+ A     +    Q+V      GS  G    R++    +  +    +K    + G
Sbjct: 269 VVLVGMPAHAYCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARHLVKSPIRLAG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
                EI   FE + NGS + R V+DTS
Sbjct: 326 LSDVPEI---FEKMENGSIVGRYVVDTS 350

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  107 bits (268), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/341 (28%), Positives = 156/341 (45%), Gaps = 47/341 (13%)

Query: 39  IKIVKTAVCHTDAYSLSGVDPE---------GLFP-CVLGHEGSGIVESIGADVTNVKVG 88
           IK+  T++C TD     G +PE         G F   +LGHEG GI++ +G  V N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 89  DHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCST 148
           D VI    + CG C+ C     + C     T G G                I  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 149 FSQY--TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTV 206
            ++Y  T  AD SL +  +++S E   +L   + T +   ++  N++ GDTVA+ GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 207 GLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG- 265
           G+  V  ++    S +IVVD+++++   + E G+T  +N  +    ED VSK++E T+G 
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK----EDAVSKILEYTNGR 275

Query: 266 GLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW--RGSA 323
           G+D   +  G     +   + C +     I  G   A   +  +P      ++W    + 
Sbjct: 276 GVDCVMEAVG----AQATWDICQR----VIKEGGHLANVGVHGKPVNFEIDKLWIKNLTI 327

Query: 324 FGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAF 364
             G+   +  G L+K   SG LK +  +T    F E++  +
Sbjct: 328 TSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNY 368

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score =  107 bits (266), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 111/363 (30%), Positives = 166/363 (45%), Gaps = 60/363 (16%)

Query: 35  HEVRIKIVKTAVCHTDA-YSLSGVDPEGLF----PCVLGHEGSGIVESIGADVTNVKVGD 89
           H V++ I KT +C +D  Y  +G    G F    P VLGHE SG+V  +G+ VT+VKVGD
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGD 87

Query: 90  HVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTF 149
            V           K   SG  NLC S+       +           DG  + +++    F
Sbjct: 88  RVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI-----------DGTLLKYYLSPEDF 136

Query: 150 SQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANIQKGDTVAVFGAGTV 206
                     LV    SVSFE  A    L  GV      A K A+++ G  V VFGAG V
Sbjct: 137 ----------LVKLPDSVSFEEGACVEPLSVGVH-----ANKLADVRFGSKVVVFGAGPV 181

Query: 207 GLSVVQGAKSR--GASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTD 264
           GL  + GA SR  GA+ ++ VD+ + K + + EFGAT  VN  + K  +D+V ++  +  
Sbjct: 182 GL--LAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSKFKSEDDLVKEIQRVLS 239

Query: 265 GGL-DFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG-----QEIATRPFQLV-TGR 317
           G   +  F+C+G    +R  ++AC  G G+ + +G+          E+ ++  Q++ T R
Sbjct: 240 GEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGKDNVNFPISEVVSKELQVLGTFR 298

Query: 318 VWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFE--DLHNGSCLRT 375
              G     +K  SE          G + V   IT R  F +   A+E    H    ++T
Sbjct: 299 YCFGDYNDSVKLISE----------GKVNVKPLITHRFKFQDAIKAYEFNIEHGEDVVKT 348

Query: 376 VLD 378
           ++D
Sbjct: 349 IID 351

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score =  106 bits (265), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 107/388 (27%), Positives = 174/388 (44%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I YE    L   +I V  PK++E+ I I  + VCHTD ++  G  P 
Sbjct: 1   MSAPQIPETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVR 117
               P V GHEG+GIV  +G +V   K+GD+  I      C  C++C LS ++N      
Sbjct: 61  PTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGC 177
                   PD     +  DG          +F QY     V              A + C
Sbjct: 116 --------PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLC 157

Query: 178 GVTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSF 236
              T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFK 215

Query: 237 EFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQ 293
           E G   F+   +   ++D+V  +++ T+GG         NV+V   A+EA     +  G 
Sbjct: 216 ELGGEVFI---DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+    +  +    Q+V      GS  G    R++    +  +  G +K    + G
Sbjct: 269 VVLVGLPGGAKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIMVVG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
               +E+ + +E +  G+ + R V+DTS
Sbjct: 326 ---LSELPSIYEKMEKGAIVGRYVVDTS 350

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score =  105 bits (263), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 104/379 (27%), Positives = 167/379 (44%), Gaps = 40/379 (10%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T  A I YE    L  T+I V  PK  E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G +V   K+GD   I      C  C++C     + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            PD     +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+A +Q G+ VA+ GA G +G   VQ AK+ G  +I+ +D   +KK    E G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           ++     +S+D+V+++I++T+GG     + + +   +  + E C    G  +++G+  AG
Sbjct: 220 ID---FAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGL-PAG 274

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITGRRPFTEINA 362
            ++ +  F  V   +   S  G   G R++    I  +  G +     + G     E+  
Sbjct: 275 AQMRSEVFSHVVKSI---SVVGSYVGNRADSREAIDFFTRGLVSAPIKVVGLSQLAEV-- 329

Query: 363 AFEDLHNGSCL-RTVLDTS 380
            +E +  G    R V+DTS
Sbjct: 330 -YEKMEKGMIAGRYVVDTS 347

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score =  105 bits (263), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 106/388 (27%), Positives = 173/388 (44%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I YE   PL  T+I V  PKA E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSAPTIPRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G +V   K+GD   I      C  C++C     + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC----- 115

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P+     +  DG          +F QY     V              A + C 
Sbjct: 116 -------PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN++ GD VA+ GA G +G   +Q A + G  +++ +D   +K+    +
Sbjct: 159 GITVY-KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQ 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQS 294
            G   F++    + S+DIV+ +++ T+GG         NV+V   A+E+     +  G  
Sbjct: 217 LGGEVFID---FRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIESSTEYVRSNGTV 269

Query: 295 IIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITG 353
           +++G+   G +  +  F  V   +   S  G   G R++    +  +  G +K    + G
Sbjct: 270 VLVGL-PGGAKCKSDVFSHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIQVVG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
               +E+   +E +  G+ + R V+DTS
Sbjct: 326 ---LSELPQIYEKMEKGAVVGRYVVDTS 350

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/388 (27%), Positives = 174/388 (44%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I YE    L   +I V  PK++E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSASQIPKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVR 117
               P V GHEG+G+V +IG +V   K+GD+  I      C  C++C LS ++N      
Sbjct: 61  PTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGC 177
                   P+     +  DG          +F QY     V              A + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLC 157

Query: 178 GVTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSF 236
              T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D   +K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFK 215

Query: 237 EFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQ 293
           E G   F+   +   ++D+V  +++ T+GG         NV+V   A+EA     +  G 
Sbjct: 216 ELGGEVFI---DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+    +  +    Q+V      GS  G    R++    +  +  G +K    + G
Sbjct: 269 VVLVGLPGGAKCKSDVFNQVVKSTTIVGSYVG---NRADTREALDFFARGLVKSPIKVVG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
               +E+ + +E +  G+ + R V+DTS
Sbjct: 326 ---LSELPSIYEKMEKGAIVGRYVVDTS 350

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  104 bits (259), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 168/384 (43%), Gaps = 50/384 (13%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T  A + YE   PL  T I V  PK +E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G++V N ++GD+  I      C  C+ C  G  + C           
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQA-------- 144

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     V      K+V     A + C   T Y 
Sbjct: 145 --DLSGYTHD------------GSFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 185 AAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+KTA+++ G  VA+ GA G +G   VQ AK+ G  +++ +D  ++KK      G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH-----KGWGQSIIIG 298
           V   +   +  IV  + ++T+GG        G +NV  + L         +  G  +++G
Sbjct: 249 V---DFTKTHSIVKDIQDVTNGGPH------GVINVSVSELATSMSTEYVRPAGTVVLVG 299

Query: 299 VAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357
           +  A   + +  F  V   +  +GS  G    R++    +  +Q G +K    I G    
Sbjct: 300 L-PANSYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFQRGLVKSPIKIVG---L 352

Query: 358 TEINAAFEDLHNGSCL-RTVLDTS 380
           +E+   +E +     L R VLDTS
Sbjct: 353 SELPMVYELMAQNKILGRYVLDTS 376

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score =  103 bits (256), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 166/381 (43%), Gaps = 44/381 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE++  L   +I V  PKA+E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G +V   K+GD+  I      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +    +DIV  +++ TDGG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 I---DFTKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMP 272

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           A  +  +    Q+V      GS  G    R++    +  +  G +K    + G     EI
Sbjct: 273 AGAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI 329

Query: 361 NAAFEDLHNGSCL-RTVLDTS 380
              +E +  G  + R V+DTS
Sbjct: 330 ---YEKMEKGQIVGRYVVDTS 347

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score =  103 bits (256), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 100/384 (26%), Positives = 168/384 (43%), Gaps = 38/384 (9%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
            S +  P +    I YE    L   ++ V  PK +E+ I +  + VCHTD ++  G  P 
Sbjct: 22  QSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPL 81

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
           G   P V GHEG+G+V + G+ VTN ++GD+  I      C  C+FC  G  + C     
Sbjct: 82  GAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA-- 139

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                   D +   HD             +F QY     +      K       A + C 
Sbjct: 140 --------DLSGYTHD------------GSFQQYATADAIQAAQIPKGTDLAQVAPILCA 179

Query: 179 VTTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K ++++ G  VA+ G AG +G   VQ AK+ G  +++ +D  ++K+     
Sbjct: 180 GVTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFES 237

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297
            G   FV   +   ++D+VS++ E+T+GG     + + +   +  ++E   +  G  +++
Sbjct: 238 LGGNHFV---DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLV 293

Query: 298 GVAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRP 356
           G+  AG  + +  F  V   +  +GS  G    R++    I  +  G +K    + G   
Sbjct: 294 GL-PAGATVKSDVFNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVKSPIKVVGLSE 349

Query: 357 FTEINAAFEDLHNGSCLRTVLDTS 380
             E+    E   N    R V+DTS
Sbjct: 350 LPEVYKLMEA--NKIIGRYVVDTS 371

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score =  103 bits (256), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 108/384 (28%), Positives = 171/384 (44%), Gaps = 48/384 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE    L   +I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 89

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V ++G +V    +GD   I      C  C++C LS ++N C          
Sbjct: 90  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESN-C---------- 138

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
             PD     +  DG          +F QY     V      K       A + C   T Y
Sbjct: 139 --PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY 186

Query: 184 GAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATD 242
             A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K     + G   
Sbjct: 187 -KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEA 244

Query: 243 FVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGV 299
           FV   +   ++D+V+++ E+T+GG         NV+V   A+ A     +  G  +++G+
Sbjct: 245 FV---DFTKTKDMVAEIQEITNGGPHGVI----NVSVSEAAMNASTQFVRPTGTVVLVGL 297

Query: 300 AAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFT 358
             AG  I +  F  V   +  +GS  G    R++    I  + +G +     + G    +
Sbjct: 298 -PAGAVIKSEVFSHVVKSINIKGSYVG---NRADTREAINFFANGHVHSPIKVVG---LS 350

Query: 359 EINAAFEDLHNGSCL-RTVLDTST 381
           E+   +E +  G  L R V+DTS 
Sbjct: 351 ELPKVYELMEQGKILGRYVVDTSN 374

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score =  102 bits (253), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 105/381 (27%), Positives = 165/381 (43%), Gaps = 44/381 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE++  L   +I V  PKA+E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G +V    +GD   I      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V      K       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +    +DIV  +I+ TDGG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 I---DFTTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEASTRYCRANGTTVLVGMP 272

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           A  +  +    Q+V      GS  G    R++    +  +  G +K    + G     EI
Sbjct: 273 AGAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI 329

Query: 361 NAAFEDLHNGSCL-RTVLDTS 380
              +E +  G  + R V+DTS
Sbjct: 330 ---YEKMEKGQIVGRYVVDTS 347

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score =  102 bits (253), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 108/388 (27%), Positives = 169/388 (43%), Gaps = 44/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MSA   P T    I YE    L   +I V  PKA+E+ + +  + VCHTD ++  G  P 
Sbjct: 1   MSAHEIPKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
            +  P V GHEG+G+V ++G +V   KVGD   I      C  C+ C  G  + C     
Sbjct: 61  PVKLPLVGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC----- 115

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P+     +  DG          +F QY     V              A + C 
Sbjct: 116 -------PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN+Q GD VA+ G AG +G   VQ AK+ G  +++ +D   +K+    +
Sbjct: 159 GITVY-KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQ 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQS 294
            G   F++ +  KD E    ++I+ T+GG         NV+V   A+E+     +  G  
Sbjct: 217 LGGEVFIDFRTCKDIE---GEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTV 269

Query: 295 IIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGR 354
           +++G+ A  +  +    Q+V      GS  G    R++    +  +  G ++    + G 
Sbjct: 270 VLVGLPAGAKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFVRGLVRSPIKVVGL 326

Query: 355 RPFTEINAAFEDLHNGSCL-RTVLDTST 381
               EI   FE +  G  + R V+DTS 
Sbjct: 327 STLPEI---FEKMEKGQIVGRYVVDTSN 351

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 170/376 (45%), Gaps = 45/376 (11%)

Query: 13  AIAYEANK-PLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPCVLGHE 70
           AI +E+N  PL   +I V  PK++E+ + I  + VCHTD ++  G  P +   P V GHE
Sbjct: 12  AIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHE 71

Query: 71  GSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGT 129
           G+GIV +IG +V   K+GD+  +      C  C++C  G  + C            P+  
Sbjct: 72  GAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC------------PNAD 119

Query: 130 TRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT 189
              +  DG          +F QY     V         +    A + C   T Y  A+K+
Sbjct: 120 LSGYTHDG----------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKS 168

Query: 190 ANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKE 248
           AN++ G+ VA+ GA G +G   +Q A + G  +++ +D  +DK     +     F+   +
Sbjct: 169 ANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI---D 224

Query: 249 LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQSIIIGVAAAGQE 305
              ++D++S++ ++T+GG         NV+V   A+EA  K     G  +++G+    + 
Sbjct: 225 FTKTKDVISEVNKVTNGGAHGVI----NVSVSEAAIEASTKYCRANGTVVLVGLPGGAKC 280

Query: 306 IATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFE 365
            +    Q+V      GS  G    R++    +  +  G +K    +    P + +   FE
Sbjct: 281 KSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAPIHVA---PLSTLPTIFE 334

Query: 366 DLHNGSCL-RTVLDTS 380
            +  G  + R V+DTS
Sbjct: 335 KMEKGQIVGRYVVDTS 350

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score =  101 bits (251), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/382 (27%), Positives = 173/382 (45%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE N PL   +I V  P  +E+ I ++ + VCHTD ++  G  P  +  P 
Sbjct: 6   PKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V  +G+ V   KVGD+  I      C  C+ C LS ++N            
Sbjct: 66  VGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC----------- 114

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
             P+     +  DG          +F QY     V           +  A + C   T Y
Sbjct: 115 --PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY 162

Query: 184 GAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATD 242
             AIK+AN++ GD +A+ GA G +G   +Q  K+ G  +I+ +D   +K++   + G   
Sbjct: 163 -KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEY 220

Query: 243 FVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGV 299
           F++  + K   DI++++ + T+GG         NV+V   A+EA     +  G  +++G+
Sbjct: 221 FIDFTQCK---DIIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTVVLVGL 273

Query: 300 AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            A     +    Q+V      GS  G    R++    I  +  G +K    + G    ++
Sbjct: 274 PAGAVCKSNVFNQVVKSTKIVGSYVG---NRADTREAIDFFVRGLVKSPIKVVG---LSQ 327

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           + + F+D+  G  + R V+DTS
Sbjct: 328 LASVFDDMQAGKIVGRVVVDTS 349

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 168/387 (43%), Gaps = 46/387 (11%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S +  P T    I YE N  L   +I V  PK +E+ I +  + VCHTD ++  G  P  
Sbjct: 26  STIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  L-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V  +G++V   KVGD   I      C  C+FC SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
                 PD     +  DG          +F Q+     +      +       A + C  
Sbjct: 140 ------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
            T Y  A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D   +K+    + 
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQL 241

Query: 239 GATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSI 295
           G   F+   +   ++D+VS + E T GG         NV+V   A+       +  G  +
Sbjct: 242 GGEVFI---DFTKTKDMVSDIQEATKGGPQGVI----NVSVSEAAISLSTEYVRPTGTVV 294

Query: 296 IIGVAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGR 354
           ++G+ A    + +  F  V   +  +GS  G    R++    +  +  G +K    I G 
Sbjct: 295 LVGLPANAY-VKSEVFSHVIKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG- 349

Query: 355 RPFTEINAAFEDLHNGSCL-RTVLDTS 380
              +E+   ++ +  G  L R V+DTS
Sbjct: 350 --LSELPMVYDLMEKGKILGRYVVDTS 374

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 163/378 (43%), Gaps = 38/378 (10%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE N PL   +I V  PK++E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 33  PKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPL 92

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G +V N K+GD   I      C  C+ C +G    C           
Sbjct: 93  VGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHA-------- 144

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     V              A + C   T Y 
Sbjct: 145 --DLSGYTHD------------GSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY- 189

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+KTA+++ GD VA+ G AG +G   VQ A + G  ++I +D   DKK    + G   F
Sbjct: 190 KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVF 248

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           +   +   S+DIV  + E T GG     + + +   +  +++      G  +++G+ A  
Sbjct: 249 I---DFTKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPANA 304

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
              +    Q+V     +GS  G    R++    +  +  G +K    + G    +E+   
Sbjct: 305 VVKSDVFNQVVKSIQIKGSYVG---NRADTREALDFFTRGLVKSPIKVVG---LSELPKV 358

Query: 364 FEDLHNGSCL-RTVLDTS 380
           +E +  G  L R V+DTS
Sbjct: 359 YELMETGKILGRYVVDTS 376

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score =  101 bits (252), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 166/387 (42%), Gaps = 43/387 (11%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S +  P      I YE   PLT  ++ V  PK +E+ I +  + VCHTD ++  G  P  
Sbjct: 25  STIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLP 84

Query: 62  L-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+GIV + G++V N ++GD   I      C  C+ C  G  + C      
Sbjct: 85  VKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHA--- 141

Query: 120 QGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
                  D +   HD             +F QY            +       A + C  
Sbjct: 142 -------DLSGYTHD------------GSFQQYATADATQAAQIPRGTDLAEVAPILCAG 182

Query: 180 TTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
            T Y  A+KTA +Q G+ VA+ GA G +G   +Q AK+ G  +++ +D    K     E 
Sbjct: 183 VTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKEL 240

Query: 239 GATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSI 295
           G   F++  + K++E ++  + E T GG         NV+V   A+ A     +  G  +
Sbjct: 241 GGETFIDFTKYKNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVV 296

Query: 296 IIGVAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGR 354
           I+G+  AG  + +  F  V   +  +GS  G    R++    I  +  G +K    + G 
Sbjct: 297 IVGM-PAGAYVKSDVFSHVVKSISIKGSYVG---NRADTREAIDFFSRGLVKSPITVVG- 351

Query: 355 RPFTEINAAFEDLHNGSCL-RTVLDTS 380
              +E+   +E +     L R V+DTS
Sbjct: 352 --LSELPKIYELMEKNKILGRYVVDTS 376

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 164/381 (43%), Gaps = 44/381 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE N  L   +I V  PKA+E+ I +  + VCHTD ++  G  P     P 
Sbjct: 8   PETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPL 67

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G +V   K+GD+  I      C  C++C     + C           
Sbjct: 68  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC----------- 116

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P+     +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 117 -PEADLSGYTHDG----------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY- 164

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN+  G+ VA+ G AG +G   VQ AK+ G  +I+ +D  ++KK    E G   F
Sbjct: 165 KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIF 223

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           V   +   S+++   ++  T+GG         NV+V   A+E+     +  G  +++G+ 
Sbjct: 224 V---DFTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLP 276

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           A  +  +     +V      GS  G    R++    +  +  G +K    I G     EI
Sbjct: 277 ANAKCSSDVFNHVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKIAGLSELPEI 333

Query: 361 NAAFEDLHNGSCL-RTVLDTS 380
              +E +  G  + R V+DTS
Sbjct: 334 ---YEKMEKGQIVGRYVVDTS 351

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score =  100 bits (250), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 108/382 (28%), Positives = 166/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE+N  L   +I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V +IG +V   KVGD   I    + C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +    +DIVS +++ TDGG         NV+V   A+EA     +  G  +++G+ 
Sbjct: 220 I---DFTKEKDIVSAVVKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGL- 271

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            AG +  +  F  V   +   S  G   G R++    +  +  G +K    + G     E
Sbjct: 272 PAGAKCCSDVFNHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPE 328

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           I   +E +  G    R V+DTS
Sbjct: 329 I---YEKMEKGQIAGRYVVDTS 347

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score =  100 bits (249), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 107/387 (27%), Positives = 170/387 (43%), Gaps = 48/387 (12%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MSA   P T    I YE    L   +I V  PKA+E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSAPVIPKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVR 117
            +  P V GHEG+G+V ++G +V   K+GD+  I      C  C++C LS ++N      
Sbjct: 61  DVKLPLVGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGC 177
                   P+     +  DG          +F QY     V      +       A + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILC 157

Query: 178 GVTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSF 236
              T Y  A+K+AN+  G+ VA+ GA G +G   +Q AK+ G  +I+ +D  ++K     
Sbjct: 158 AGITVY-KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFK 215

Query: 237 EFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQ 293
           E G   F+   +   ++DI + +IE T+GG         NV+V   A+E+     +  G 
Sbjct: 216 ELGGEVFI---DFTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFIT 352
            +++G+   G    +  F  V   +   S  G   G R++    I  +  G +K    I 
Sbjct: 269 CVLVGL-PGGAYCKSEVFSHVVKSI---SIVGSYVGNRADTREAIDFFTRGLVKAPIHIA 324

Query: 353 GRRPFTEINAAFEDLHNGSCL-RTVLD 378
              P + +   FE +  G  + R V+D
Sbjct: 325 ---PLSAVPEIFEKMEKGQIVGRYVVD 348

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score =  100 bits (248), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 106/382 (27%), Positives = 166/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE+N  L    I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V +IG +V   KVGD   +    + C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQSIIIGVA 300
           +   +    +DI+  +++ TDGG         NV+V   A+EA  K     G  +++G+ 
Sbjct: 220 I---DFTKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTKYCRANGTVVLVGL- 271

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            AG + ++  F  V   +   S  G   G R++    +  +  G +K    + G     E
Sbjct: 272 PAGAKCSSDVFNHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSSLPE 328

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           I   +E +  G    R V+DTS
Sbjct: 329 I---YEKMEKGQIAGRYVVDTS 347

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 101/375 (26%), Positives = 167/375 (44%), Gaps = 45/375 (12%)

Query: 14  IAYEANK-PLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPCVLGHEG 71
           + +E+N  PL   EI V  PKA+E+ I +  + VCHTD ++  G  P  +  P V GHEG
Sbjct: 12  VIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEG 71

Query: 72  SGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTT 130
           +GIV ++G  V N  +GD+  I      C  C+ C     + C            P    
Sbjct: 72  AGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNC------------PQADL 119

Query: 131 RFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTA 190
             +  DG          +F QY     V              A + C   T Y  A+K+A
Sbjct: 120 SGYTHDG----------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSA 168

Query: 191 NIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKEL 249
           N++ GD VA+ GA G +G   +Q A + G  +++ +D   +K +   + G   F++  + 
Sbjct: 169 NLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFIDFTKC 227

Query: 250 KDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVAAAGQEI 306
           K   D++++++E+TDGG         NV+V   A+EA     +  G  +++G+ A     
Sbjct: 228 K---DVIAEILEVTDGGAHGVI----NVSVSEAAIEASTRYCRANGTVVLVGLPANAYCK 280

Query: 307 ATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFED 366
           +    Q+V      GS  G    R++    +  +  G +K    I    P +++   F+ 
Sbjct: 281 SEVFSQVVKSISIVGSYVG---NRADTRQALDFFARGLVKSPIHIA---PLSDLPEIFDK 334

Query: 367 LHNGSCL-RTVLDTS 380
           +  G  + R V+DTS
Sbjct: 335 MAKGQIVGRYVVDTS 349

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 99.8 bits (247), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 110/382 (28%), Positives = 162/382 (42%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T  A I  E N PL   +I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G V ++G+DV N K+GD   I      C  C+ C     + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            PD     +  DG          +F QY     V         +    A + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ A++ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQSIIIGVA 300
           ++        DI   +I+ T+GG         NV+V   A+ A  K     G S+++G+ 
Sbjct: 220 ID---FTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGM- 271

Query: 301 AAGQEIATRPF-QLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            AG    +  F Q+V      GS  G    R++    +  +  G +K    I G     E
Sbjct: 272 PAGAICKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVKAPIKIVGLSTLPE 328

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           I   FE +  G    R V+DTS
Sbjct: 329 I---FEKMEKGLIAGRYVVDTS 347

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 107/388 (27%), Positives = 166/388 (42%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MS+   P T  A + YE +  L   ++ V  PK +E+ + +  + VCH+D ++  G  P 
Sbjct: 1   MSSQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
            L FP + GHEG+G+V  +G++V   KVGD   I      C  C++C  G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                   DGT   HD             TF +Y     V      ++V     A + C 
Sbjct: 119 --------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K AN+  G  V + GA G +G   VQ A + G  ++I +D    K+    E
Sbjct: 159 GITVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEE 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA----CHKGWGQ 293
                F++       +D+V  +I+ TDGG         NV+V   A+EA    C    G 
Sbjct: 217 LHGEIFID---FTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEASTRYCRPN-GT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+ A     +    Q+V      GS  G    R++    +  +  G +K    + G
Sbjct: 269 VVLVGMPAHAYCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSPIHLAG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
                EI   F  +  G  + R V+DTS
Sbjct: 326 LSDVPEI---FGKMERGQIVGRYVVDTS 350

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/381 (26%), Positives = 166/381 (43%), Gaps = 44/381 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE++  L   +I V  PKA+E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G +V    +GD+  I      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +    +DIV+ +++ TDGG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 I---DFTKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMP 272

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           A  +  +    Q+V      GS  G    R++    +  +  G +K    + G     EI
Sbjct: 273 ANAKCSSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI 329

Query: 361 NAAFEDLHNGSCL-RTVLDTS 380
              +E +  G  + R V+DT+
Sbjct: 330 ---YEKMEKGQIVGRYVVDTA 347

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 99/377 (26%), Positives = 161/377 (42%), Gaps = 38/377 (10%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P      I YE    L   ++ V  PK +E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G +VTN ++GD+  I      C  C+ C  G    C           
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHA-------- 156

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     V      K       A + C   T Y 
Sbjct: 157 --DLSGYTHD------------GSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY- 201

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +++ +D   DKK    + G   F
Sbjct: 202 KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETF 260

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           ++    + ++D+V  + E T GG     + + +   +  + E   +  G  +++G+ A  
Sbjct: 261 ID---FRTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEYV-RPTGSVVLVGLPANA 316

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
              +     +V     +GS  G    R++    I  +  G +K    I G    +E+  A
Sbjct: 317 YVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFARGLVKAPIKIIG---LSELPEA 370

Query: 364 FEDLHNGSCL-RTVLDT 379
           ++ +  G  L R V+DT
Sbjct: 371 YKLMEAGKILGRYVVDT 387

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 105/388 (27%), Positives = 171/388 (44%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I Y+   PL   ++ V  PK +E+ I I  + VCHTD ++  G  P 
Sbjct: 1   MSAPVIPQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVR 117
           +   P + GHEG+G+V  +G++V   K+GD+  +      C  C+ C LS ++N      
Sbjct: 61  DTKLPLIGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC----- 115

Query: 118 ATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGC 177
                   P+     +  DG          +F +Y     V      +       A L C
Sbjct: 116 --------PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLC 157

Query: 178 GVTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSF 236
              T Y  A+K+A++  G  VA+ GA G +G   +Q AK+ G  +++ +D   +KK    
Sbjct: 158 AGVTVY-KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFH 215

Query: 237 EFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQ 293
           E G   F++ +  KD E   + +I+ T+GG         NV+V   A+E+     +  G 
Sbjct: 216 ELGGEVFLDFRLEKDME---AAIIKATNGGAHGVI----NVSVSEAAIESSTRYVRSNGT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+ A     +    Q+V      GS  G    R++    +  +  G +K    I G
Sbjct: 269 VVLVGLPANAYCKSEVFAQVVKSYKIVGSYVG---NRADTREALDFFSRGLVKSPIHIVG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
                EI   +E +  G  + R V+DT+
Sbjct: 326 LSTLPEI---YEKMEKGQIVGRYVVDTT 350

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 107/388 (27%), Positives = 172/388 (44%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I YE+   L   ++ V  PK +E+ I I  + VCHTD ++  G  P 
Sbjct: 1   MSAPVIPKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVR 117
           +   P + GHEG+G+V  +GA+V   K+GD+  +      C  C+ C LS ++N      
Sbjct: 61  DTKLPLIGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC----- 115

Query: 118 ATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGC 177
                   P+     +  DG          +F +Y     V      +       A + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILC 157

Query: 178 GVTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSF 236
              T Y  A+K+A++  G+ VA+ GA G +G   VQ AK+ G  +++ +D   +KK    
Sbjct: 158 AGVTVY-KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFH 215

Query: 237 EFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQ 293
           E G   F++ +  KD E   + +I+ T+GG         NV+V   A+EA     +  G 
Sbjct: 216 EMGGEVFLDFRLEKDME---AAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+ A     +    Q+V      GS  G    R++    +  +  G +K    I G
Sbjct: 269 VVLVGLPANAYCKSEVFSQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKSPIHIVG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
                EI   +E +  G  + R V+DT+
Sbjct: 326 LSTLPEI---YEKMEKGQIVGRYVVDTT 350

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/381 (27%), Positives = 164/381 (43%), Gaps = 44/381 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE    L   ++ V  PK +E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G +VTN ++GD   I      C  C+ C  G    C           
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHA-------- 154

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     V      K ++    A + C   T Y 
Sbjct: 155 --DLSGYTHD------------GSFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+KTA++  G  VA+ G AG +G   VQ AK+ G  +++ +D  ++KK+   + G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +   ++D+V  + E T GG         NV+V   A+       +  G  +++G+ 
Sbjct: 259 I---DYTTTKDMVGAIQEATQGGPQGVI----NVSVSEAAISLSTQYVRPTGSVVLVGLP 311

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           A     +     +V     +GS  G    R++    I  +  G +K    I G    +E+
Sbjct: 312 ANAYVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFNRGLIKAPIKIIG---LSEL 365

Query: 361 NAAFEDLHNGSCL-RTVLDTS 380
             A++ +  G  L R V+DTS
Sbjct: 366 PQAYKMMEAGKILGRYVVDTS 386

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 98.2 bits (243), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/382 (26%), Positives = 165/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P    A + YE +  L   ++ V  PK +E+ + +  + VCH+D ++  G  P  L FP 
Sbjct: 7   PEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           + GHEG+G+V  +G++V   KVGD   I      C  C++C  G  + C  +        
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL-------- 118

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             DGT   HD             TF +Y     V       +V+    A + C   T Y 
Sbjct: 119 --DGTGFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY- 163

Query: 185 AAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K AN+  G  V + GA G +G   +Q A + G  ++I +D  N K+    + G   F
Sbjct: 164 KALKRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIF 222

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA----CHKGWGQSIIIGV 299
           +   +  + +DIV  +I+ T+GG         NV+V   A+EA    C    G  +++G+
Sbjct: 223 I---DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEASTRYCRPN-GTVVLVGM 274

Query: 300 AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            A     +    Q+V      GS  G    R++    +  +  G +K    + G     E
Sbjct: 275 PAHAYCNSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSPIHLAGLSDVPE 331

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           I   F  +  G  + R V++TS
Sbjct: 332 I---FAKMEKGEIVGRYVVETS 350

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 109/391 (27%), Positives = 166/391 (42%), Gaps = 49/391 (12%)

Query: 1   MSAVGKPI---TCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGV 57
           MSA   P+   T    +  E+N PL   EI V  PK +E+ I +  + VCHTD ++  G 
Sbjct: 26  MSAAPAPVIPKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGD 85

Query: 58  DP-EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGS 115
            P     P V GHEG+G V ++G++V N KVGD   I      C  C+ C     + C  
Sbjct: 86  WPLPTKLPLVGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC-- 143

Query: 116 VRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALL 175
                     PD     +  DG          +F QY     V              A +
Sbjct: 144 ----------PDADLSGYTHDG----------SFQQYATADAVQAAHIPPGTDLAEVAPV 183

Query: 176 GCGVTTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDW 234
            C   T Y  A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++ 
Sbjct: 184 LCAGITVY-KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEEL 241

Query: 235 SFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GW 291
               G   F+   + +   DIV  ++  T+GG         NV+V   A+ A  K     
Sbjct: 242 FKTLGGEVFI---DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRAC 294

Query: 292 GQSIIIGVAAAGQEIATRPF-QLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEF 350
           G S+++G+  AG    +  F Q+V      GS  G    R++    +  +  G +     
Sbjct: 295 GTSVLVGM-PAGAVCKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVHAPIN 350

Query: 351 ITGRRPFTEINAAFEDLHNGSCL-RTVLDTS 380
           +    P + +   FE +  G  + R V+DTS
Sbjct: 351 VV---PLSTLPEIFEKMEKGQIIGRYVVDTS 378

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 167/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE    L   +I V  PKA+E+ I +  + VCHTD ++  G  P     P 
Sbjct: 6   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V ++G +V   K+GD   I      C  C++C LS ++N            
Sbjct: 66  VGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 114

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
             P+     +  DG          +F QY     V              A + C   T Y
Sbjct: 115 --PEADLSGYTHDG----------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY 162

Query: 184 GAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATD 242
             A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K     + G   
Sbjct: 163 -KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEY 220

Query: 243 FVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGV 299
           F+   +   S++I  ++IE T GG         NV+V   A+E      +  G  +++G+
Sbjct: 221 FI---DFTKSKNIPEEVIEATKGGAHGVI----NVSVSEFAIEQSTNYVRSNGTVVLVGL 273

Query: 300 AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
               +  +    Q+V      GS  G    R++    I  +  G +K    + G    +E
Sbjct: 274 PRDAKCKSDVFNQVVKSISIVGSYVG---NRADTREAIDFFSRGLVKAPIHVVG---LSE 327

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           + + +E +  G+ + R V+DTS
Sbjct: 328 LPSIYEKMEKGAIVGRYVVDTS 349

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 166/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T  A I YE+N  L   +I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G +V   K+GD+  I      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F +Y     V      +       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN++ G   A+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +    +DIVS +++ T+GG         NV+V   A+EA     +  G  +++G+ 
Sbjct: 220 I---DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEASTRYCRANGTVVLVGL- 271

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            AG + ++  F  V   +   S  G   G R++    +  +  G +K    + G     E
Sbjct: 272 PAGAKCSSDVFNHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSSLPE 328

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           I   +E +  G    R V+DTS
Sbjct: 329 I---YEKMEKGQIAGRYVVDTS 347

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 109/384 (28%), Positives = 171/384 (44%), Gaps = 46/384 (11%)

Query: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-F 63
           G P+T  A I YE    L   +I V  PK +E+ + +  + VCHTD ++  G  P     
Sbjct: 29  GIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLATKL 88

Query: 64  PCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
           P V GHEG+GIV + G++VTN ++GD+  +      C  C++C +G  + C     +   
Sbjct: 89  PLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADLS--- 145

Query: 123 GVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTG 182
                G TR    DG          +F QY     V      +       A + C   T 
Sbjct: 146 -----GYTR----DG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGVTV 186

Query: 183 YGAAIKTANIQKGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           Y  A+KTAN+  G  VA+    G +G   VQ AK+ G  +++ +D    K     + G  
Sbjct: 187 Y-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKKLGGE 244

Query: 242 DFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQSIIIG 298
            F+   +   S+DIV+ + E T+GG         NV+V   A+    K     G  +++G
Sbjct: 245 VFI---DFTKSKDIVADIQEATNGGPHGAV----NVSVSEAAIVQSVKYIRPTGTVVLVG 297

Query: 299 VAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357
           +  A   + +  F  V   +  +GS  G    R++M   I  +  G +K    I G    
Sbjct: 298 L-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKIIG---L 350

Query: 358 TEINAAFEDLHNGSCL-RTVLDTS 380
           +E+  A+ +L  G+ + R V+DTS
Sbjct: 351 SELPTAYHELEAGNMVGRFVVDTS 374

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 150/359 (41%), Gaps = 44/359 (12%)

Query: 13  AIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDA-YSLSGVDPEGLF----PCVL 67
           AI YE ++P+ V E   DP   H V++KI KT +C +D  Y L G    G F    P VL
Sbjct: 16  AIVYE-HRPVPVIE---DP---HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 68  GHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPD 127
           GHE SG V  +G+DVT V++GD V           +   SG  NLC  +R          
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFA-------- 118

Query: 128 GTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAI 187
                      P Y      T  +Y +  +  LV    SVS E  AL  C        A 
Sbjct: 119 ---------ATPPYD----GTLVKYYISPEDFLVKLPDSVSLEEGAL--CEPLAVAVHAN 163

Query: 188 KTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPK 247
           + A  Q    V VFGAG VGL     AK+ GA+ + +VD++  K   +   G T  V+  
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVDSS 223

Query: 248 ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIA 307
           +    E + +KL       +D  FDC+G    +  A+  C  G G  + +G   + ++  
Sbjct: 224 DCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPG-GTHVQVG---SSRDYV 279

Query: 308 TRPFQLVTGRVWRGSAFGGIK-GRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFE 365
           + P    T +  R    G  +    +    ++   S  +     +T R PF     A++
Sbjct: 280 SFPLAEATVKQLR--ILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 102/382 (26%), Positives = 165/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE N  L   +I V  PK +E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 31  PKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPL 90

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G++V   KVGD   I      C  C+FC SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P+     +  DG          +F Q+     +              A + C   T Y 
Sbjct: 140 -PEADLSGYTHDG----------SFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY- 187

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D   +K+    + G   F
Sbjct: 188 KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVF 246

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +   ++D+VS + E T GG         NV+V   A+       +  G  +++G+ 
Sbjct: 247 I---DFTKTKDMVSDIQEATKGGPHGVI----NVSVSEAAISLSTEYVRPTGTVVLVGL- 298

Query: 301 AAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            A   + +  F  V   +  +GS  G    R++    +  +  G +K    I G    +E
Sbjct: 299 PANSYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFTRGLIKSPIKIVG---LSE 352

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           +   ++ +  G  L R V+DT+
Sbjct: 353 LPKVYDLMEQGKILGRYVVDTN 374

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 97.4 bits (241), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 106/381 (27%), Positives = 164/381 (43%), Gaps = 46/381 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE+N  L   +I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G +V   KVGD   I    + C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V      +       A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +    +DIV  +I+ TDGG         NV+V   A+EA     +  G  +++G+ 
Sbjct: 220 I---DFTKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGL- 271

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
            AG +  +  F  V   +   S  G   G R++    +  +  G +K    + G     E
Sbjct: 272 PAGAKCTSDVFNHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSHLPE 328

Query: 360 INAAFEDLHNGSCL-RTVLDT 379
           I   +E +  G    R V+DT
Sbjct: 329 I---YEKMEKGQIAGRYVVDT 346

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 97.4 bits (241), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 163/381 (42%), Gaps = 44/381 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE++  L   +I V  PKA+E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V ++G +V    +GD   I      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            P      +  DG          +F QY     V              A + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY- 160

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  ++I +D    K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVF 219

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           V   +    +DIV  +++ T+GG         NV+V   A+EA     +  G ++++G+ 
Sbjct: 220 V---DFTKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMP 272

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           A  +  +    Q+V      GS  G    R++    +  +  G +K    + G     EI
Sbjct: 273 ANAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKVVGLSTLPEI 329

Query: 361 NAAFEDLHNGSCL-RTVLDTS 380
              +E +  G  + R V+DTS
Sbjct: 330 ---YEKMEKGQIVGRYVVDTS 347

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 104/385 (27%), Positives = 168/385 (43%), Gaps = 44/385 (11%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S+   P T    I YE    L   ++ V  PKA+E+ I +  + VCHTD ++  G  P  
Sbjct: 26  SSFAIPETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLP 85

Query: 62  L-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+GIV + G +V N ++GD+  I      C  C+ C  G  + C      
Sbjct: 86  VKLPLVGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC------ 139

Query: 120 QGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
               +  D +   HD             +F QY     V      K       A + C  
Sbjct: 140 ----LQADLSGYTHD------------GSFQQYATADAVQAAQIPKGTDLAEIAPILCAG 183

Query: 180 TTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
            T Y  A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +++ +D  + K++   + 
Sbjct: 184 VTVY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQC 241

Query: 239 GATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSI 295
           G   F++    + S+D+V+ + E T+GG         NV+V   A+       +  G  +
Sbjct: 242 GGEVFID---FRKSKDMVADIQEATNGGPHGVI----NVSVSEAAISMSTEYVRPTGVVV 294

Query: 296 IIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRR 355
           ++G+ A     +     +V     +GS  G    R++       +  G +K    I G  
Sbjct: 295 LVGLPADAYVKSEVFSHVVKSISIKGSYVG---NRADTREATDFFTRGLVKSPIKIIG-- 349

Query: 356 PFTEINAAFEDLHNGSCL-RTVLDT 379
             +E+  A+E +  G  L R V+DT
Sbjct: 350 -LSELPEAYELMEQGKILGRFVVDT 373

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 166/388 (42%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MS+   P T  A + YE +  L   ++ V  PK +E+ + +  + VCH+D ++  G  P 
Sbjct: 1   MSSQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
            L FP + GHEG+G+V  +G++V   KVGD   I      C  C++C  G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                   DGT   HD             TF +Y     V      ++V+    A + C 
Sbjct: 119 --------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K AN+  G  V + GA G +G   +Q A + G  ++I +D    K+    +
Sbjct: 159 GITVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEK 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA----CHKGWGQ 293
            G   F+   +     D+   +I+ T+GG         NV+V   A+EA    C    G 
Sbjct: 217 LGGEIFI---DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEASTRYCRPN-GT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
            +++G+ A     +    Q+V      GS  G    R++    +  +  G ++    + G
Sbjct: 269 VVLVGMPAHAHCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIESPIHLAG 325

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
                EI   F  +  G  + R V+DTS
Sbjct: 326 LSDVPEI---FGKMEKGEIVGRYVVDTS 350

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 103/384 (26%), Positives = 164/384 (42%), Gaps = 38/384 (9%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MSA   P T  A I       L   +I V  PK+ E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSAPVIPKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+GIV  +G +V   KVGD   I      C  C++C  G  + C     
Sbjct: 61  ATKLPLVGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC----- 115

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P+     +  DG          +F QY     V      +       A + C 
Sbjct: 116 -------PNADLSGYTHDG----------SFQQYATADAVQAARIPQGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  +I+ +D   +K+    E
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRE 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297
            G   F+   +   ++DIV  +I+ T+GG     + + +   +  + E C    G  +++
Sbjct: 217 LGGEIFI---DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLV 272

Query: 298 GVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357
           G+    +  +    Q+V      GS  G    R++    +  +  G +K    I    P 
Sbjct: 273 GLPRDAKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIHIA---PL 326

Query: 358 TEINAAFEDLHNGSCL-RTVLDTS 380
           +++   F  +  G  + R V+DTS
Sbjct: 327 SDLPEIFGKMEKGQIVGRYVVDTS 350

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 107/389 (27%), Positives = 169/389 (43%), Gaps = 48/389 (12%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I YE   PL   +I V  P A E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSAPEIPKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVR 117
               P V GHEG+G+V ++G +V   K+GD+  I      C  C+ C LS ++N      
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC----- 115

Query: 118 ATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGC 177
                   P+     +  DG          +F QY     V      +       A + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLC 157

Query: 178 GVTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSF 236
              T Y  A+K+AN+  GD VA+ GA G +G   +Q A + G  +++ +D   +K +   
Sbjct: 158 AGITVY-KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFK 215

Query: 237 EFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQ 293
           + G   F++    KD E    ++I+ T+GG         NV+V   A+E+     +  G 
Sbjct: 216 QLGGEVFIDFTTCKDVE---GEIIKATNGGAHGVI----NVSVSEAAIESSTRYVRANGT 268

Query: 294 SIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFIT 352
            +++G+   G +  +  F  V   +   S  G   G R++    +  +  G +K    + 
Sbjct: 269 VVLVGL-PGGAKCRSDVFSHVVKSI---SIVGSYVGNRADTREALDFFSRGLVKSPIKVV 324

Query: 353 GRRPFTEINAAFEDLHNGSCL-RTVLDTS 380
           G     E+   FE +  G  + R V+DTS
Sbjct: 325 GLSTLPEV---FEKMEKGQIVGRYVVDTS 350

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 165/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE    L   +I V  PK +E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 31  PETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G++V   K+GD   I      C  C+FC SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            PD     +  DG          +F Q+     +      +       A + C   T Y 
Sbjct: 140 -PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D   +K+    + G   F
Sbjct: 188 KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVF 246

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           ++      ++D+VS + E T GG         NV+V   A+       +  G  +++G+ 
Sbjct: 247 ID---FTKTKDMVSDIQEATKGGPHGVI----NVSVSEAAISLSTEYVRPTGTVVLVGLP 299

Query: 301 AAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
           A    + +  F  V   +  +GS  G    R++    +  +  G +K    I G    +E
Sbjct: 300 ANAY-VKSEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG---LSE 352

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           +   ++ +  G  L R V+DTS
Sbjct: 353 LPKVYDLMEKGKILGRYVVDTS 374

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 128/283 (45%), Gaps = 36/283 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE    L   +I V  PKA+E+ I +  + VCHTD ++  G  P     P 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V ++G +V    +GD   I      C  C++C LS ++N            
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 112

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
             PD     +  DG          +F QY     V      K       A + C   T Y
Sbjct: 113 --PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY 160

Query: 184 GAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATD 242
             A+K+A+++ GD VA+ GA G +G   +Q AK+ G  +++ +D   +K     E G   
Sbjct: 161 -KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEY 218

Query: 243 FVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALE 285
           FV   +   S+D++ ++++ T+GG         NV+V   A+E
Sbjct: 219 FV---DYAVSKDLIKEIVDATNGGAHGVI----NVSVSEFAIE 254

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 165/382 (43%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE    L   +I V  PK +E+ I +  + VCHTD ++  G  P  +  P 
Sbjct: 31  PKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V  +G++V   KVGD   I      C  C+FC SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            PD     +  DG          +F Q+     +      +       A + C   T Y 
Sbjct: 140 -PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D   +K+    + G   F
Sbjct: 188 KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVF 246

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCT---GNVNVMRNALEACHKGWGQSIIIGVA 300
           +   +   ++++VS + E T GG     + +     +++    +  C    G  +++G+ 
Sbjct: 247 I---DFTKTKNMVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPC----GTVVLVGLP 299

Query: 301 AAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
           A    + +  F  V   +  +GS  G    R++    +  +  G +K    I G    +E
Sbjct: 300 ANAY-VKSEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG---LSE 352

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           +   ++ +  G  L R V+DTS
Sbjct: 353 LPKVYDLMEKGKILGRYVVDTS 374

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 94.7 bits (234), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 161/378 (42%), Gaps = 38/378 (10%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPC 65
           P T    I YE    L   +I V  PK +E+ I I  + VCHTD ++  G  P  +  P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G DVTN ++GD   +    + C  C++C  G  + C           
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA-------- 140

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     +      K       A + C   T Y 
Sbjct: 141 --DLSGYTHD------------GSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+KT+  + G  VA+ G AG +G   VQ A + G  +++ +D    K++     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303
           V+      ++D+VS + E T+GG     + + +   ++ + E   +  G  +++G+ A  
Sbjct: 245 VD---FTKTKDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAHA 300

Query: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
              +     +V     +GS  G    R++    I  +    +K    I G    +E+   
Sbjct: 301 YVKSEIFSHVVKSISIKGSYVG---NRADTREAIDFFSRNLVKSPIKIIG---LSELPKV 354

Query: 364 FEDLHNGSCL-RTVLDTS 380
           +E +  G  L R V+DTS
Sbjct: 355 YELMEEGKILGRYVVDTS 372

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 94.7 bits (234), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 101/389 (25%), Positives = 173/389 (44%), Gaps = 48/389 (12%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSG---V 57
           +S+   P T  A + YE    L  T+I V  PK +E+ + I  + VCHTD ++  G   +
Sbjct: 23  LSSTAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAI 82

Query: 58  DPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSV 116
            P+   P V GHEG+G+V + GA+VTN ++GD+  +      C +C+FC  G    C + 
Sbjct: 83  KPK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCET- 139

Query: 117 RATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLG 176
                    P  +   HD             TF QY     +              A + 
Sbjct: 140 ---------PTLSGYTHD------------GTFQQYATADAIHAAHIPPGTDLAKVAPIL 178

Query: 177 CGVTTGYGAAIKTANIQKGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWS 235
           C   T Y  A+KTA +  G  VA+    G +G   VQ A + G  +++ +D  N+K+   
Sbjct: 179 CAGITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALF 236

Query: 236 FEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSI 295
              G   FV   +   ++DIVS + E T GG     + + + N +  ++E   +  G  +
Sbjct: 237 RSLGGETFV---DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVV 292

Query: 296 IIGV---AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFIT 352
           ++G+   A    ++ T   + +     +GS  G    R++    I+ +  G ++    I 
Sbjct: 293 LVGLPPDATVKSDVLTHVLKSIN---IKGSYVG---NRADTKEAIEFFTRGLVQSPIKII 346

Query: 353 GRRPFTEINAAFEDLHNGSCL-RTVLDTS 380
           G    +++  A++ +  G+ + R V+DTS
Sbjct: 347 G---LSQLEEAYKAMEEGTSIGRYVVDTS 372

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 94.0 bits (232), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 104/386 (26%), Positives = 165/386 (42%), Gaps = 44/386 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60
           MSA   P T    I YE N  L   +I V  P  +E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSAPTIPETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GL-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
            +  P V GHEG+G+V ++G++V N KVGD+  I      C  C+ C  G  + C     
Sbjct: 61  PVKLPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNC----- 115

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P      +  DG          +F QY     V              A + C 
Sbjct: 116 -------PQADLSGYTHDG----------SFQQYATTDAVQAAKISPGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+A ++ G  VA+ GA G +G   VQ AK+ G  +++ +D  ++K     E
Sbjct: 159 GLTVY-KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKE 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEAC---HKGWGQS 294
            G   F++  + K   DI+ ++++ T+GG         NV+V   A+ A     +  G  
Sbjct: 217 LGGEYFIDFTKCK---DIIGEVVKATNGGAHGVI----NVSVSEAAISASTRYARANGTV 269

Query: 295 IIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGR 354
           +++G+ A     +    Q+V      GS  G    R++    +  +  G +K    + G 
Sbjct: 270 VLVGLPAGAYCKSEVFNQVVKSIKIVGSYVG---NRADTREALDFFNRGLVKAPIKVVGL 326

Query: 355 RPFTEINAAFEDLHNGSCL-RTVLDT 379
               EI   ++ +  G    R V+DT
Sbjct: 327 STLPEI---YDKMIKGQIFGRYVVDT 349

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 94.0 bits (232), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 108/383 (28%), Positives = 168/383 (43%), Gaps = 48/383 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE N  L   ++ V  PK  E+ I ++ + VCHTD ++  G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+G+V  +G+ V   K+GD   I      C  C+ C LS ++N            
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC----------- 117

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
             P+     +  DG          +F QY     V      +       A + C   T Y
Sbjct: 118 --PEADLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY 165

Query: 184 GAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATD 242
             A+K+A ++ GD VA+ G AG +G   VQ AK+ G  +++ +D  ++K+ +    G   
Sbjct: 166 -KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEV 223

Query: 243 FVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGV 299
           FV+       +DIV  + E T+GG      C  NV+V   A+EA     +  G  +++G+
Sbjct: 224 FVD---FMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEASTQYVRTNGTVVLVGL 276

Query: 300 AAAGQEIATRPF-QLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFT 358
             AG    +  F Q+V      GS  G    R++    +  +  G +K    + G     
Sbjct: 277 -PAGAYCKSEVFDQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKPTIKVVGLSTLP 332

Query: 359 EINAAFEDLHNGSCL-RTVLDTS 380
           EI   +E +  G  + R V+DTS
Sbjct: 333 EI---YEKMEKGQIVGRYVVDTS 352

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 104/387 (26%), Positives = 165/387 (42%), Gaps = 44/387 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MSA   P T  A I       L   +I V  PK++E+ I +  + VCHTD ++  G  P 
Sbjct: 1   MSAPVIPKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G  V   K+GD+  I      C  C++C  G  + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNC----- 115

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P      +  DG          +F QY     V              A + C 
Sbjct: 116 -------PHADLSGYTHDG----------SFQQYATADAVQAARIAPGSDLAEVAPVLCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K     +
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKD 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQS 294
            G   F+   +   ++DIV  +I+ T+GG         NV+V   A++A  K     G +
Sbjct: 217 LGGEVFI---DFTKTKDIVGDIIKATNGGAHGVI----NVSVSEQAIDASVKYCRANGTA 269

Query: 295 IIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGR 354
           +++G+    Q  +    Q+V      GS  G    R++    +  +  G +K    I   
Sbjct: 270 VLVGMPGGAQVKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIHIAKL 326

Query: 355 RPFTEINAAFEDLHNGSCL-RTVLDTS 380
               EI   FE +  G  + R V+D S
Sbjct: 327 SDVPEI---FEKMEKGQIVGRYVVDCS 350

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 162/382 (42%), Gaps = 46/382 (12%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T  A + YE   PL   +I V  PKA+E+ I +  + VCHTD ++  G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEGSG+V  +G +V   KVGD   I      C  C+ C +G  + C           
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHA-------- 148

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     V      +  +    A + C   T Y 
Sbjct: 149 --DLSGYTHD------------GSFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +D    K++     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVF 252

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVA 300
           +   +   S+D+V  + E T GG         NV+V   A+       +  G  +++G+ 
Sbjct: 253 I---DFTKSKDMVKDIQEATKGGPQGVI----NVSVSEAAISLSTQYVRPTGTVVLVGLP 305

Query: 301 AAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
           A    + +  F  V   +  +GS  G    R++    +  +  G +K    I G    +E
Sbjct: 306 AHAY-VKSEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIVG---LSE 358

Query: 360 INAAFEDLHNGSCL-RTVLDTS 380
           +   ++ +  G  L R V+DTS
Sbjct: 359 LPKVYDLMEKGQILGRYVVDTS 380

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 101/392 (25%), Positives = 165/392 (42%), Gaps = 76/392 (19%)

Query: 13  AIAYEANKPLTVTEIVVDPPKAHE--VRIKIVKTAVCHTD----------------AYSL 54
           A+AY   K +  T+ +  P  +HE  V I +    VC +D                 +++
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 55  SGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAEC--------------G 100
           SG   +GL P  +GHE SGIV  +G+DV+ VKVGDHV+      C              G
Sbjct: 63  SG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 101 KCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCST--FSQYTVVADV 158
            C  C +G  N C  +                        +  +GC +  F++  V+++ 
Sbjct: 119 LCIACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLSER 155

Query: 159 SLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRG 218
           ++V    S+  +  AL+     + +  A++ + +Q G T  V GAG +GL+ V   +S G
Sbjct: 156 NVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHG 213

Query: 219 ASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGN 276
           A  IIV +  + ++  +   GA  F NP E  D  +++  L ++  G  G +F++DC G 
Sbjct: 214 AGTIIVSEPADTRRQKAEALGAQTF-NPTEHGD--NVIEALRKLAPGGEGFNFSYDCCGT 270

Query: 277 VNVMRNALEACHKGWGQSIIIGVAAAG-QEIATRPFQLVTG-RVWRGSAFGGIKGRSEMG 334
                  L   H    + + + +A  G + I   P  + T  R   GS     +   E+ 
Sbjct: 271 SETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQDFEEVV 327

Query: 335 GLIKDYQSGTLKVDEFITGRRPFTEINAAFED 366
             +   +    KV   ITGR     I   FE+
Sbjct: 328 DAMDKGKIDINKVKTMITGRE---RIENGFEN 356

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 128/276 (46%), Gaps = 34/276 (12%)

Query: 19  NKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLF----PCVLGHEGSGI 74
           N+P+   E        H V+++I  T +C +D +  +     G F    P VLGHE SGI
Sbjct: 21  NRPIPSIE------DQHFVKVQIKATGICGSDVHFCTH-GAIGSFIVKEPMVLGHESSGI 73

Query: 75  VESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHD 134
           V  +G++VT V VGD V           +  +SG  NLC  ++      V          
Sbjct: 74  VVEVGSEVTKVAVGDRVAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV---------- 123

Query: 135 KDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQK 194
            DG  + +F     F  Y +  DV+   F++    EP A+           A+K A ++ 
Sbjct: 124 -DGTLLKYFQVPEDFV-YKLPDDVT---FEEGALVEPLAVAV--------HAVKLAGVKF 170

Query: 195 GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSED 254
           GD V VFGAG VGL V    K+ GA++++ +D+ + K D S E G+T  +N K++ +   
Sbjct: 171 GDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAINSKDMAEEAL 230

Query: 255 IVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKG 290
            +    ++     +   DCTG    +R+++ AC  G
Sbjct: 231 ALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG 266

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 108/387 (27%), Positives = 164/387 (42%), Gaps = 46/387 (11%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S V  P      I YE   PL   +I V  PKA+E+ I +  + VCHTD ++  G  P  
Sbjct: 24  STVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLA 83

Query: 62  L-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRAT 119
              P V GHEGSG V ++G +V   K+GD   I      C  C+ C SG  + C      
Sbjct: 84  TKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHA--- 140

Query: 120 QGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
                  D +   HD             +F QY     V      K  +    A + C  
Sbjct: 141 -------DLSGYTHD------------GSFQQYATADAVQAARIPKGTNMAEVAPILCAG 181

Query: 180 TTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
            T Y  A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +D    K++     
Sbjct: 182 ITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSL 239

Query: 239 GATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQSI 295
           G   FV+      ++DIV+++ E T GG         NV+V   A+    K     G  +
Sbjct: 240 GGEIFVD---FTKTKDIVAEIQEATRGGPQGVI----NVSVSEAAISLSTKYVRPTGTVV 292

Query: 296 IIGVAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGR 354
           ++G+ A    + +  F  V   +  +GS  G    R++    +  +  G +K    I G 
Sbjct: 293 LVGLPAHSY-VKSEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIIG- 347

Query: 355 RPFTEINAAFEDLHNGSCL-RTVLDTS 380
              +E+   ++ +  G  L R V+DTS
Sbjct: 348 --LSELPNVYKLMEEGKILGRYVVDTS 372

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 169/378 (44%), Gaps = 49/378 (12%)

Query: 13  AIAYEANK-PLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPCVLGHE 70
           A+ +E N   L   +I V  P A+E+ I +  + VCHTD ++  G  P     P V GHE
Sbjct: 9   AVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHE 68

Query: 71  GSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKGVMPDG 128
           G+G+V  IG +V   K+GD   I      C  C+ C LS ++N              P  
Sbjct: 69  GAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNC-------------PHA 115

Query: 129 TTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIK 188
               +  DG          +F QY     V      +       A + C   T Y  A+K
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALK 164

Query: 189 TANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPK 247
           +AN++ G+ VA+ G AG +G   VQ AK+ G  ++I +D  ++K+    + G   FV   
Sbjct: 165 SANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV--- 220

Query: 248 ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQSIIIGVAAAGQ 304
           + + S+D+V++++E+T GG         NV+V   A+E+     +  G  +++G+   G 
Sbjct: 221 DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIESSTHYVRANGTVVLVGL-PGGA 275

Query: 305 EIATRPFQLVTGRVWRGSAFGGIKG-RSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363
           +  +  F  V   +   S  G   G R++    +  +  G +K    I G    +E+   
Sbjct: 276 KCCSDVFNHVVKSI---SIVGSYVGSRADTRQALDFFARGLVKSPIKIVG---LSELPDV 329

Query: 364 FEDLHNGSCL-RTVLDTS 380
           FE +  G    R V+DT+
Sbjct: 330 FEKMEKGQIAGRYVVDTA 347

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 116/263 (44%), Gaps = 30/263 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P T    I YE+   L   +I V  PK +E+ I +  + VCHTD ++  G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V GHEG+G+V + G +V N ++GD   I      C  C+ C  G  + C          +
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------L 142

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
             D +   HD             +F QY     V      K       A + C   T Y 
Sbjct: 143 HADLSGYTHD------------GSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 185 AAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
            A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +I+ +D    K++     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 244 VNPKELKDSEDIVSKLIEMTDGG 266
           +   +   ++DIVS + E T GG
Sbjct: 249 I---DFTKTKDIVSAIQEATKGG 268

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 130/289 (44%), Gaps = 34/289 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           MS+   P T  A +  +   PL   EI V  PK  E+ I +  + VCHTD ++  G  P 
Sbjct: 35  MSSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPL 94

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G +V   +VGD   I      C  C+ C  G  + C     
Sbjct: 95  PTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC----- 149

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P+     +  DG          +F QY     V              A + C 
Sbjct: 150 -------PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCA 192

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN++ G+ VA+ GA G +G   +Q A++ G  +++ +D  ++K+    +
Sbjct: 193 GITVY-KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRK 250

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
            G   FV   + + S+D+V+ +++ T GG         NV+V   A+E+
Sbjct: 251 LGGEVFV---DFRKSKDVVADVVKATGGGAHGVI----NVSVSEAAIES 292

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 101/388 (26%), Positives = 165/388 (42%), Gaps = 46/388 (11%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           M+    P      I YE    L   +I V  PK +E+ I +  + VCHTD ++  G  P 
Sbjct: 23  MATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPL 82

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V ++G +V   K+GD   I      C  C++C     + C     
Sbjct: 83  PTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNC----- 137

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                  P      +  DG          +F QY     V      +       + + C 
Sbjct: 138 -------PHADLSGYTHDG----------SFQQYATADYVQAARIPEGTDLAEVSPILCA 180

Query: 179 VTTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K +   +
Sbjct: 181 GVTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKK 238

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH---KGWGQS 294
            G   F++       +++V  + E T+GG         NV+V   A+ A     +  G  
Sbjct: 239 LGGEVFID---FTKHKNLVEAVQEATNGGPHGVI----NVSVSEAAMTASTQFVRPTGTV 291

Query: 295 IIIGVAAAGQEIATRPFQLVTGRV-WRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITG 353
           +++G+  AG  I +  F  V   +  +GS  G    R++    I  +  G +K    + G
Sbjct: 292 VLVGL-PAGAVIKSEVFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSPIHVVG 347

Query: 354 RRPFTEINAAFEDLHNGSCL-RTVLDTS 380
               +E+   +E +  G  L R V+DT+
Sbjct: 348 ---LSELPKVYELMEKGKILGRYVVDTA 372

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 93/383 (24%), Positives = 161/383 (42%), Gaps = 38/383 (9%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-E 60
           S +  P T    I YE+   L   ++ V  P+ +E+ + +  + VCHTD ++  G  P +
Sbjct: 21  STISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLD 80

Query: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRAT 119
              P V GHEG+G+V + G +V N ++GD   I      C  C+ C  G  + C      
Sbjct: 81  TKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHA--- 137

Query: 120 QGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
                  D +   HD             TF QY     +      K       A + C  
Sbjct: 138 -------DLSGYTHD------------GTFQQYATADAIQAAHIPKGTDLAGVAPILCAG 178

Query: 180 TTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
            T Y  A++++  + G+ VA+ G AG +G    Q A++ G  +++ +D   DK       
Sbjct: 179 VTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSL 236

Query: 239 GATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIG 298
           G   F+   +    +DI + ++E T GG     + + +   M  ++E   +  G  +++G
Sbjct: 237 GGEIFI---DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVG 292

Query: 299 VAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFT 358
           + A     +     +V     +GS  G    R++    ++ +  G +K    I G    +
Sbjct: 293 LPANAVIKSNVFNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIVG---LS 346

Query: 359 EINAAFEDLHNGSCL-RTVLDTS 380
           E+   +E +  G  L R V+DTS
Sbjct: 347 ELPKIYELMEAGKILGRYVVDTS 369

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 162/355 (45%), Gaps = 38/355 (10%)

Query: 32  PKAHEVRIKIVKTAVCHTDA-YSLSGVDPEGLF--PCVLGHEGSGIVESIGADVTNVKVG 88
           P  H V++ I  T +C +D  Y  SG   + +   P VLGHE SG V  +G+ V ++KVG
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIKVG 86

Query: 89  DHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCST 148
           D V                G+ NLC  +       +           DG  + +++  + 
Sbjct: 87  DRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI-----------DGTLVKYYVSPAD 135

Query: 149 FSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGL 208
           F    +V     V+F++    EP   L  GV      A K A +  G  V VFGAG VGL
Sbjct: 136 F----LVKLPDHVSFEEGACIEP---LSVGVH-----ANKLAKVHFGSVVVVFGAGPVGL 183

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSE-DIVSKLIEMTDGG- 266
                AK+ GAS++I VD+ ++K + +  FGAT  +N K L   E D VS  +    GG 
Sbjct: 184 LTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNYLGGA 243

Query: 267 -LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFG 325
             D  F+C+G    + + + +   G G  + IG+   G+     P   V+G+    S  G
Sbjct: 244 LADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSGKEM--SVIG 297

Query: 326 GIK-GRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFE-DLHN-GSCLRTVL 377
             +    +    ++   +G ++V + IT R  F +  AA++ ++ N G  ++T++
Sbjct: 298 CFRYSFGDYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNIANGGEVVKTII 352

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 153/353 (43%), Gaps = 42/353 (11%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLF----PCVLGHEGSGIVESIGADVTNVKVGDH 90
           H+V+I+I  T +C +D +  +     G F    P VLGHE +G+V  +G  V++VKVGD 
Sbjct: 29  HDVKIQIKATGICGSDVHYFTQ-GSIGDFVVKSPLVLGHESAGVVVEVGDAVSSVKVGDR 87

Query: 91  VIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFS 150
           V           K  +SG  NLC  +            T  +   DG  + +++    F 
Sbjct: 88  VAVEPGVPSRYSKETMSGHYNLCPHMAFA--------ATPPY---DGTLVKYYLSPEDF- 135

Query: 151 QYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSV 210
              V      ++F++    EP   L   V      A + AN   G  V V GAG VGL  
Sbjct: 136 ---VYKLADHISFEEGAVVEP---LSVAVH-----ANRLANTAFGQAVLVLGAGPVGLLA 184

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGL--D 268
              AK+ GA+ ++ VD+   K + + +FGAT  V  K   D  D+VS L+  + GGL  D
Sbjct: 185 GAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVLFKPDSDENDLVS-LVTKSLGGLHPD 243

Query: 269 FTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIK 328
             F+C+G    +R A+++  +G G  + +G+           F        + + F G  
Sbjct: 244 VVFECSGAEKCIRAAVKSVKRG-GTFVQVGMGKDNINFPINEFS------QKEATFKGCF 296

Query: 329 GRSE--MGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNGSCLRTVLDT 379
              E      +K   +G + V   IT   PF +   A++  HN    + V  T
Sbjct: 297 RYYEGDFDDAVKLLSTGKVNVKPLITKVFPFEQAVEAYK--HNVEHAKDVTKT 347

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 117/278 (42%), Gaps = 55/278 (19%)

Query: 36  EVRIKIVKTAVCHTDAYSLS----------GVDPEG--LFPCVLGHEGSGIVESIGADVT 83
           EV I++    +C TD +  S          G  P      P  +GHE SGIV  IG+ VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 84  NVKVGDHVIALYTAEC-------------GK-CKFCLSGKTNLCGSVRATQGKGVMPDGT 129
            VKVGDHV+      C             GK C  C  G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 130 TRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT 189
                              F++   V+    +   K +  +  AL+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 190 ANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKEL 249
           A  QKG T  V GAG +GL+ +   K  GASKI+V +L   ++D +   G   F NP E 
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAEH 243

Query: 250 KDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMRNALE 285
           KD+   +++L ++ +G  G D  FDC+G       AL 
Sbjct: 244 KDA---IAELRKIPEGATGFDAAFDCSGVKATFNTALH 278

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 113/253 (44%), Gaps = 30/253 (11%)

Query: 17  EANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGL-FPCVLGHEGSGIV 75
           E N  L  T+I V  PK++E+ I +  + VCHTD ++  G  P  +  P V GHEG+G+V
Sbjct: 46  EHNGELKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVV 105

Query: 76  ESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHD 134
             IG +V   K+GD   I      C  C+ C +G    C             D +   HD
Sbjct: 106 VGIGENVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHA----------DLSGYTHD 155

Query: 135 KDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQK 194
                        +F QY     V      +       A + C   T Y  A+KTAN++ 
Sbjct: 156 ------------GSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKP 202

Query: 195 GDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSE 253
           G+ VA+ G AG +G   VQ AK+ G  +++ +D   +K+      G   FV   +   S+
Sbjct: 203 GEWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV---DFTKSK 258

Query: 254 DIVSKLIEMTDGG 266
           DIV+ +   T GG
Sbjct: 259 DIVADIQNATKGG 271

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 104/390 (26%), Positives = 165/390 (42%), Gaps = 50/390 (12%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSG-VDP 59
           MSA   P T  A I  E    L   +I V  PK++E+ I ++ + VCH+D +   G +  
Sbjct: 1   MSAPTIPKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPL 60

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V  +G++V   K+GD+  I      C  C+FC       C     
Sbjct: 61  PLKLPLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHA-- 118

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
                   D T   HD             +F QY     V      +       A L C 
Sbjct: 119 --------DFTGTVHD------------GSFQQYATADAVQAARIPQGTDLAAIAPLLCA 158

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  A+K+AN++ G  VA+ GA G +G   +Q A + G  +++ +D   +K  +   
Sbjct: 159 GLTAY-KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKT 216

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHK---GWGQS 294
            G   F+   + K S+D+V+ +I+ TDGG         N+ V   A+    K     G S
Sbjct: 217 LGGEVFI---DYKKSKDVVADVIKATDGGAHGVL----NIAVDPRAISMSTKYVRSNGTS 269

Query: 295 IIIGV---AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFI 351
           +++ +   A    E+ T   Q+V      GS  G    R++    I  +  G +K+   +
Sbjct: 270 VLVSLPKDAVCESEVFT---QVVKSTSIVGSCVG---NRADTREAIDFFTRGLIKIPIHM 323

Query: 352 TGRRPFTEINAAFEDLHNGSCL-RTVLDTS 380
               P + +   ++ L     + R V+DTS
Sbjct: 324 A---PLSSLPQIYDKLMQNEVVGRFVVDTS 350

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 158/357 (44%), Gaps = 48/357 (13%)

Query: 35  HEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHEGSGIVESIGADVTNVKVGDHV 91
           +  ++ +  T +C +D   Y   G+    L  P VLGHE SG+V  +G  V  +KVGD V
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRV 89

Query: 92  IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ 151
                          +GK NLC  +       +           DG  + +++  + F  
Sbjct: 90  AIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI-----------DGTLVKYYLSPADF-- 136

Query: 152 YTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVV 211
             +V     V+F++    EP   L  GV +      K A ++ G TV VFGAG VGL   
Sbjct: 137 --LVKLPDHVSFEEGACIEP---LSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLLTG 186

Query: 212 QGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKEL--KDSEDIVSKLIEMTDGGL-D 268
             AK+ GAS ++ VD+ + K + +  FGAT  +N  +L   D + +  ++ ++  G L D
Sbjct: 187 AVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGGALAD 246

Query: 269 FTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGR------VWRGS 322
             F+C+G  + +   ++A   G G  + IG+   G+     P   V+G+       +R S
Sbjct: 247 VVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGKEMTLVGCFRYS 302

Query: 323 AFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA--FEDLHNGSCLRTVL 377
            +G  K    +        +G + V + IT R  F +   A  F   H G  ++T++
Sbjct: 303 -YGDYKDAVNL------VSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKTII 352

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 158/366 (43%), Gaps = 39/366 (10%)

Query: 21  PLTVTE-IVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPCVLGHEGSGIVESI 78
           PL   E + V  P ++EV I +  + VCHTD ++  G  P +   P V GHEG+G+V + 
Sbjct: 40  PLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAK 99

Query: 79  GADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDG 137
           G DV   ++GD   +    + C  C+ C  G    C     +        G++  HD   
Sbjct: 100 GKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMS--------GSS--HD--- 146

Query: 138 KPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDT 197
                     TF QY  +  +       +V     A + C   + Y  A+K  N+Q    
Sbjct: 147 ---------GTFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQW 196

Query: 198 VAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIV 256
           VA+FGA G +G   VQ AK+ G   + +     ++K      G   F++  ++   ++I 
Sbjct: 197 VAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFLDYTQV---DNIP 253

Query: 257 SKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVT- 315
           + + + T GG     + T ++      ++ C +  G  + +GV      + T  F +V  
Sbjct: 254 AAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQH 312

Query: 316 GRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNGSCL-R 374
           G   +GSA G    R++    +  +  G +K    I G    +E+  AFE L +G    R
Sbjct: 313 GFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQTTGR 366

Query: 375 TVLDTS 380
            VLDTS
Sbjct: 367 LVLDTS 372

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 108/235 (45%), Gaps = 43/235 (18%)

Query: 58  DPEGL-FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAEC--------------GKC 102
           D  GL  P  +GHE SGIV  +G  VTN+K GDHV+   T  C               +C
Sbjct: 61  DVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAEC 120

Query: 103 KFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVA 162
             C  G  N C  +    G GV   G                    F++  VV++  +V 
Sbjct: 121 AACQRGFYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVK 159

Query: 163 FDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKI 222
              ++  +  AL+     + +  A++ + +QKG +  V GAG +GL+ +   +  GASKI
Sbjct: 160 IPNTLPLDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKI 217

Query: 223 IVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTG 275
           +V +    +++ + + G   F +P E K  ED V+ L ++  G  G DF +DC+G
Sbjct: 218 VVSEPAEIRRNQAAKLGVETF-DPSEHK--EDAVNILKKLAPGGEGFDFAYDCSG 269

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 132/293 (45%), Gaps = 43/293 (14%)

Query: 19  NKPLTVTEIVVDPPK---AHEVRIKIVKTAVCHTDA-YSLSGVDPEGLF----PCVLGHE 70
            KP  +T    D P+    H V++ I  T +C +D  Y   G    G F    P VLGHE
Sbjct: 10  QKPGVITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAI--GQFVVKSPMVLGHE 67

Query: 71  GSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTT 130
            SGIV  +G+ VTNVKVGD V              +SG  NLC           M    T
Sbjct: 68  SSGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPH---------MVFAAT 118

Query: 131 RFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAI 187
             +D             T ++Y +  +  +      +SFE  AL   +  GV      A 
Sbjct: 119 PPYD------------GTLTKYYLAPEDFVYKMPDHLSFEEGALAEPMSVGVH-----AN 161

Query: 188 KTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPK 247
           K A  + G  V V GAG VGL     A++ GA++++ VD+  +K + S +FGAT  V+  
Sbjct: 162 KLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSS 221

Query: 248 ELKDSEDIVSKLIEMTDGGL-DFTFDCTGNVNVMRNALEACHKGWGQSIIIGV 299
              D E  VS++ ++  G L +   +C+G    +R  ++AC K  G  + +G+
Sbjct: 222 S--DEERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM 271

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 172/384 (44%), Gaps = 47/384 (12%)

Query: 8   ITCTAAIAYEANKPLTVTEIVVDPPK---AHEVRIKIVKTAVCHTDA-YSLSGVDPEGLF 63
           +T   AI  E    +T+T + +  PK    +EV I+I  T +C +D  Y   G     + 
Sbjct: 4   LTTQEAIVLERPGKITLTNVSI--PKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVV 61

Query: 64  --PCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCL-SGKTNLCGSVRATQ 120
             P VLGHE SGIV  IG +V  +KVGD V AL      +    +  G+ NL  +++   
Sbjct: 62  ESPMVLGHESSGIVALIGENVKTLKVGDRV-ALEPGIPDRFSPEMKEGRYNLDPNLKFA- 119

Query: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180
                   T  F   DG    ++     F  Y +  DVS   F++    EP   L   + 
Sbjct: 120 -------ATPPF---DGTLTKYYKTMKDFV-YKLPDDVS---FEEGALIEP---LSVAI- 161

Query: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240
                A K A I+ G    VFGAG +GL   + A   GA+ ++ VDL  +K + + +FGA
Sbjct: 162 ----HANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGA 217

Query: 241 TDFVNPKELKDS---EDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297
           T  VN  +L      + ++ K I     G D  F+C+G    +R  +E C  G G  + +
Sbjct: 218 THIVNSGDLPHGVTVDSVIKKAI--GKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQV 274

Query: 298 GVAAAGQEIATRPFQLV-TGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRP 356
           G+   GQE    P  ++ T  +     F   +G  +    I+   S  L +  FIT R  
Sbjct: 275 GM---GQEEIQFPISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYS 329

Query: 357 FTEINAAFEDL--HNGSCLRTVLD 378
           F +   AFE+   H  + ++T+++
Sbjct: 330 FKDAVEAFEETSHHPLNNIKTIIE 353

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 159/377 (42%), Gaps = 62/377 (16%)

Query: 19  NKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHEGSGIV 75
            +P+ + E   DP   H V+I I  T +C +D   Y   G+    L  P VLGHE SG V
Sbjct: 21  QRPVPIIE---DP---HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQV 74

Query: 76  ESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDK 135
             +G+ VT VKVGD V                G+ NLC  +       +           
Sbjct: 75  VEVGSAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI----------- 123

Query: 136 DGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANI 192
           DG  + +++    F          LV   + VS+E  A    L  GV +      K A +
Sbjct: 124 DGTLVKYYLSPEDF----------LVKLPEGVSYEEGACVEPLSVGVHSN-----KLAGV 168

Query: 193 QKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKEL--- 249
           + G  V VFGAG VGL     A++ GAS ++ +D+ ++K D + EFGAT   N  +    
Sbjct: 169 RFGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPAD 228

Query: 250 --KDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIA 307
             ++  D V KL  ++    D  F+C+G    +   ++    G G  + IG+   G+   
Sbjct: 229 KTQELADEVEKL--LSGHHADIVFECSGADACIDAGVKITKVG-GTMVQIGM---GKNYT 282

Query: 308 TRPFQLVTGRVWR-----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINA 362
             P   V+G+  +       +FG  +        +K   SG + V   IT R  F +   
Sbjct: 283 NFPIAEVSGKEMKLIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFKFEDAAK 336

Query: 363 A--FEDLHNGSCLRTVL 377
           A  F   H G  ++T++
Sbjct: 337 AYDFNIAHGGEVVKTII 353

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 99/377 (26%), Positives = 163/377 (43%), Gaps = 46/377 (12%)

Query: 13  AIAYEANK-PLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPCVLGHE 70
           A+ ++ N   L   +I V  P+ +E+ I +  + VCHTD ++  G  P     P V GHE
Sbjct: 11  AVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 70

Query: 71  GSGIVESIGADV-TNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDG 128
           G+GIV + G+ V    ++GD   I      C  C++C     + C            P  
Sbjct: 71  GAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNC------------PQA 118

Query: 129 TTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIK 188
               +  DG          +F QY     V      K       A + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALK 167

Query: 189 TANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPK 247
           +AN++ G+ VA+ GA G +G   VQ AK+ G  +++ +D  ++K     + G   F+   
Sbjct: 168 SANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI--- 223

Query: 248 ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEAC---HKGWGQSIIIGVAAAGQ 304
           +   S+D+++++I+ TDGG         NV+V   A+ A     +  G  +++G+ A   
Sbjct: 224 DFTKSKDVIAEVIKATDGGAHGVI----NVSVSEGAISASTRYARANGTVVLVGLPANAY 279

Query: 305 EIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAF 364
             +    Q+V      GS  G    R++    +  +  G +K    I G     EI   +
Sbjct: 280 CKSEVFNQVVKSVAIVGSYVG---NRADTREALDFFARGLVKSPIKIVGLSTLPEI---Y 333

Query: 365 EDLHNGSCL-RTVLDTS 380
           E +  G  + R V+DTS
Sbjct: 334 EKMEKGQIVGRYVVDTS 350

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 117/268 (43%), Gaps = 27/268 (10%)

Query: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61
           S V  P T    I YE    L   +I V  PK +E+ + +  + VCHTD ++  G  P  
Sbjct: 22  STVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLS 81

Query: 62  L-FPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRAT 119
           +  P V GHEG+G+V + G++V N ++GD   I      C  C+ C SG  + C      
Sbjct: 82  VKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHA--- 138

Query: 120 QGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
                  D +   HD             +F QY     V      +  +    A + C  
Sbjct: 139 -------DLSGYTHD------------GSFQQYATADAVQAAKIPEGTNLAEVAPVLCAG 179

Query: 180 TTGYGAAIKTANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238
            T Y  A+K A++  G  V + G AG +G   VQ  K+ G  ++I +D    K++     
Sbjct: 180 ITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSL 237

Query: 239 GATDFVNPKELKDSEDIVSKLIEMTDGG 266
           G   F++  + K   D+V+ + + T+GG
Sbjct: 238 GGEVFIDFTKQKTDSDMVAAIQKATNGG 265

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 103/238 (43%), Gaps = 38/238 (15%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG--------------KCKFCLSG 108
            P  +GHE SGIV  +G  VT VKVGDHV+    + C                C  C  G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             NLC       G GV+  G                    F++  VV+   ++   K + 
Sbjct: 127 SENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+     T +  A+K +  +KG +  V GAG +GL  +   K  GASKI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
             + + + + G   F   K    S +I+  L +  D G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKKLGVEVFNPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 159/384 (41%), Gaps = 38/384 (9%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP- 59
           +S +  P T  A +  E    L   +I V   KA+E+ I +  + VCH+D Y      P 
Sbjct: 11  LSVMTLPKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPM 70

Query: 60  EGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRA 118
               P V GHEG+G+V  +G++V N K+GD   +    + C  C+ C  G    C     
Sbjct: 71  TSKLPLVGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LK 127

Query: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178
           ++  G   +G                   +F QY  V  +       +      A   C 
Sbjct: 128 SEYNGFTRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCA 168

Query: 179 VTTGYGAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFE 237
             T Y  AIK+ANI+ G  +A+ GA G +G   +Q  K+ G  +++ +D    K +   E
Sbjct: 169 GVTVY-KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKE 226

Query: 238 FGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297
            G   F+   +   S+D+V+ ++  T+GG           + +  +++      G  +I+
Sbjct: 227 LGGEVFI---DFTKSKDLVADVVSATNGGAHGVLSIAATEDAINTSVKYVRSN-GTCVIV 282

Query: 298 GVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357
            V   G    +  F  V   +     +  +  R+E    I  +  G +K    I    P 
Sbjct: 283 SV-PDGAYCKSDVFNQVVKSISIVGTY--VANRAETREAIDFFARGLVKAPIEIV---PL 336

Query: 358 TEINAAFEDLHNGSCL-RTVLDTS 380
           +++   ++ + +G  + R VLDTS
Sbjct: 337 SQLLQVYKKIESGEVIGRYVLDTS 360

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 105/370 (28%), Positives = 161/370 (43%), Gaps = 47/370 (12%)

Query: 9   TCTAAIAYEANKPLTVTEIVVDPPK---AHEVRIKIVKTAVCHTDAYSLSGVDPEGLF-- 63
           T   A+  E    + +T + +  PK   A++V ++I  T +C +D +  +          
Sbjct: 5   TTQEAVVLEQPGKIVLTNVNI--PKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVK 62

Query: 64  -PCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCL-SGKTNLCGSVRATQG 121
            P VLGHE SG+V  IG +V  +KVGD V AL      +    L  G+ NL         
Sbjct: 63  SPMVLGHESSGVVVLIGDNVKTLKVGDRV-ALEPGFPNRFSSELKEGRYNL--------- 112

Query: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181
                D   +F      P Y      T ++Y       +      VSFE  AL+      
Sbjct: 113 -----DPDLKFA---ATPPYD----GTLTKYYRAPKDFVYKIPDHVSFEEGALMEPLSVA 160

Query: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
            +  A + A ++ G    VFGAG VGL   + A   GA+ ++ VDL+  K + + +FGAT
Sbjct: 161 VH--ANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGAT 218

Query: 242 DFVNPKELKD---SEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIG 298
             VN  +L     +E ++ K I     G D  F+C+G    +R  +E C  G G  + +G
Sbjct: 219 HMVNSGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-GTYVQVG 275

Query: 299 VAAAGQEIATRPFQLVTGR--VWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRP 356
           +   GQE    P   +  +   ++GS F   +G  +    I+   SG L +   IT R  
Sbjct: 276 M---GQEEIQFPISKIPAKEITFQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQ 329

Query: 357 FTEINAAFED 366
           F E   AF++
Sbjct: 330 FKEAIEAFDE 339

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 158/373 (42%), Gaps = 89/373 (23%)

Query: 29  VDPPKA---HEVRIKIVKTAVCHTDAYS----------------LSGVDPEGLFPCVLGH 69
           +D PK    HE+ I +    +C TD +                 LSG+D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 70  EGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSGKTNLCGS 115
           E SGIV+ +G  VT  K GD V+   T  CG               C  C  G  N C +
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 116 VRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALL 175
             + QG G +  G                    F++  VV +  +V     +  +  AL+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 176 GCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWS 235
              ++  + AA + A  ++G    V G+G +GL+++   K   A KI+V +    +++ +
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 236 FEFGATDFVNPKELKDSEDIVSKLIEMT--DGGLDFTFDCTGNVNVMRNALE-ACHKGWG 292
            +     F NP   + +++ + KL E++  D G D+TFDC+G  +    A++ AC +G  
Sbjct: 231 EKLNVVVF-NPTHTR-AQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH- 287

Query: 293 QSIIIGVAAAG-QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQS-------GT 344
              I+ VA  G + +A  P  +          +G  K    MG + +D++        G 
Sbjct: 288 ---IVNVAIWGPKPVAFHPMDM---------TYGEKKLTGTMGYVTRDFEEVVDAIDKGY 335

Query: 345 LKVDE---FITGR 354
           + ++E    ITGR
Sbjct: 336 ISIEECKLLITGR 348

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 133/323 (41%), Gaps = 50/323 (15%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAEC--------------GKCKFCLSG 108
            P  +GHE +GIV  +G+ VT  KVGDHV    T  C               KC  C  G
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C  +    G GV   G                    F++  V+ +         + 
Sbjct: 127 MYNVCSHL-GLIGNGVQSGG--------------------FAERVVINESHCYKLPNHIP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            E  AL+     + +  A++ +  + G +V + G G +GLS +      G ++I+V +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDI-VSKLIEMTDGGLDFTFDCTGNVNVMRNALEAC 287
             ++D + + GA  + +P +    E+I   + +     G D+ FDC+G    +R+++E C
Sbjct: 224 KIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-C 281

Query: 288 HKGWGQSIIIGVAAAGQEIATRPFQLVTG-RVWRGSAFGGIKGRSEMGGLIKDYQSGTL- 345
               G ++ + + A G+ I   P  +    + + GS         +  G+I   + GT+ 
Sbjct: 282 LTFRGTAVNVAMWATGKPIDFFPMDITQQEKSYTGSM---CYTHHDFEGVIDALEKGTID 338

Query: 346 --KVDEFITGRRPFTEINAAFED 366
             K    IT + P   +   FED
Sbjct: 339 PEKAQHMITAKVP---LERGFED 358

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 104/354 (29%), Positives = 159/354 (44%), Gaps = 40/354 (11%)

Query: 34  AHEVRIKIVKTAVCHTD-AYSLSGVDPEGLF--PCVLGHEGSGIVESIGADVTNVKVGDH 90
           +H V+I + KT +C +D  Y   G   E +   P VLGHE SG+V  +G DVT V+VGD 
Sbjct: 29  SHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDR 88

Query: 91  VIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFS 150
           V               SG  NLC           M    T  +D             T  
Sbjct: 89  VAIEPGVPSRYSDETKSGHYNLCPH---------MAFAATPPYD------------GTLV 127

Query: 151 QYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGA-AIKTANIQKGDTVAVFGAGTVGLS 209
           +Y +  +  LV     VSFE  A   C      G  A + A    G  V VFGAG VGL 
Sbjct: 128 KYYLAPEDFLVKLPDHVSFEEGA---CAEPLAVGVHANRLAETSFGKNVVVFGAGPVGLV 184

Query: 210 VVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLI--EMTDGGL 267
               A + GAS ++ VD+  +K + S +FGAT+ +N  + K SED ++++I  E+     
Sbjct: 185 TGAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYK-SEDELTEVIKSELKGEQP 243

Query: 268 DFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGI 327
           +   DC+G    +R A++   K  G  + +G+   G++    P  ++  +  R    G  
Sbjct: 244 EIAIDCSGAEICIRTAIKVL-KAGGSYVQVGM---GKDNINFPIAMIGAKELR--VLGSF 297

Query: 328 KGR-SEMGGLIKDYQSGTLKVDEFITGRRPFTE-INAAFEDLHNGS-CLRTVLD 378
           +   ++    +K    G + V + IT    F E I+A   +L +GS  ++T++D
Sbjct: 298 RYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEAIDAYNFNLEHGSEVVKTMID 351

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 121/269 (44%), Gaps = 43/269 (15%)

Query: 35  HEVRIKIVKTAVCHTDA--YSLSGVDPEGLF----PCVLGHEGSGIVESIGADVTNVKVG 88
           H V+++I  T +C +D   Y    +   G F    P VLGHE SGI+  +G+ V  +KVG
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSI---GDFVVKSPMVLGHESSGIIAEVGSAVKTLKVG 87

Query: 89  DHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCS- 147
           D V           +  +SG  NLC                         P  HF     
Sbjct: 88  DRVALEPGYPSRYTEATMSGHYNLC-------------------------PFMHFAATPP 122

Query: 148 ---TFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAG 204
              T ++Y +     +     +VS+E  ALL   ++ G  A  K A  + GD V VFGAG
Sbjct: 123 CDGTLTKYYLTPFDFVYKLPDNVSYEEGALLE-PLSVGVHAN-KQAGTRFGDKVVVFGAG 180

Query: 205 TVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDI-VSKLIEMT 263
            VGL     AK  GA +++ +D+ ++K + +  FGAT  +N  +L+ +++  ++  I+  
Sbjct: 181 PVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEK 240

Query: 264 DGGL--DFTFDCTGNVNVMRNALEACHKG 290
            GG+  D   +CTG    +R  + A   G
Sbjct: 241 LGGVDPDIVLECTGAEPCIRAGIRALKTG 269

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 104/238 (43%), Gaps = 38/238 (15%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG--------------KCKFCLSG 108
            P  +GHE SGIV  +G  VT VKVGDHV+    + C                C+ C  G
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             NLC +     G GV+  G                    F++   V++  ++   K + 
Sbjct: 127 SENLC-THGGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+     T +  A+K +  +KG +  V GAG +GL  +   K  GA KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
             + + +   G   F   K  + S +++  L +  D G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKNLGVEVFNPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 97/380 (25%), Positives = 172/380 (45%), Gaps = 42/380 (11%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPC 65
           P+T  A I  + +  L +  I V  PKA+E+ I +  + VCH+D ++  G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFC-LSGKTNLCGSVRATQGKG 123
           V GHEG+GIV ++GA V   K+GD+  I    + C  C+ C LS + N C     +    
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPN-CAYADIS---- 124

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
               G TR    DG          +F QY     V         +    + + C   T +
Sbjct: 125 ----GFTR----DG----------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF 166

Query: 184 GAAIKTANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATD 242
             A+KTAN+  G+ VA+ GA G +G   +Q AK+ G S ++ +D   +K+    + G   
Sbjct: 167 -KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDV 224

Query: 243 FVNPKELKDSEDIVSKLIEMTDGGLDF--TFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300
           F+   +   SE++V +++  T GG       + + + N +  ++  C    G  +++G+ 
Sbjct: 225 FL---DFSKSENLVPEVVSATGGGGGAHGVLNLSASENAINTSVRFCRAN-GVIVLVGIP 280

Query: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360
           +    ++     +V      GS+ G    R++    +  Y  G ++    + G    +++
Sbjct: 281 SGATCVSEVFDHVVKSIKIVGSSVG---NRADTREALDFYSRGLIRPAIKVAG---LSQV 334

Query: 361 NAAFEDLHNGSCL-RTVLDT 379
              F+ + NG  + R V++T
Sbjct: 335 PQIFKKMDNGEIVGRCVVNT 354

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 38/238 (15%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG--------------KCKFCLSG 108
            P  +GHE SGI+  +G  VT VKVGDHV+    + C                C+ C  G
Sbjct: 67  LPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             NLC       G GV+  G                    F++  VV++  ++   K + 
Sbjct: 127 SENLCAH-SGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+     T +  A+K +  +KG +  V GAG +GL  +   K  GA KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
             +   +       F   +    S +++  L E  D G D+++DC+G       +L+A
Sbjct: 224 ERRLKMAKSLDVEVFNPAQHGHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 102/239 (42%), Gaps = 40/239 (16%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSG 108
            P  +GHE +G+V  +G  V   KVGDHV+   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C  +    G GV   G         + + +   C     + V  D+ L   D +  
Sbjct: 127 YYNICSKL-GLCGAGVQSGGFAE------RVVMNESHC-----HKVPDDLPL---DIAAL 171

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +P A+           A++  N +KG +  V G+G +GL ++      G + I+V +  
Sbjct: 172 IQPIAVC--------WHALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMRNALE 285
             ++D++ E GAT F +P  L   E+ +  L  +  G  G D+TFDC+GN      ++E
Sbjct: 224 KIRRDFAKELGATVF-DPSSLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 153/363 (42%), Gaps = 60/363 (16%)

Query: 35  HEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHEGSGIVESIGADVTNVKVGDHV 91
           H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  +G  VT VKVGD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 92  IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ 151
                           G+ NLC  +       +           DG  + +++    F  
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVKYYLSPEDF-- 137

Query: 152 YTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGL 208
                   LV   + VS+E  A    L  GV +      K A ++ G  V VFGAG VGL
Sbjct: 138 --------LVKLPEGVSYEEGACVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGL 184

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKEL-----KDSEDIVSKLIEMT 263
                A++ GA+ +I VD+ ++K   + +FGAT+  N  +      +D  D V KL+   
Sbjct: 185 LTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLL--- 241

Query: 264 DGG--LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWR- 320
            GG   D  F+C+G  +V  +A     K  G  + +G+   G+     P   V+G+  + 
Sbjct: 242 -GGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMKL 296

Query: 321 ----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFED--LHNGSCLR 374
                 +FG  +    +        +G + V   IT +  F +   A++    H G  ++
Sbjct: 297 IGCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVK 350

Query: 375 TVL 377
           T++
Sbjct: 351 TII 353

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 100/380 (26%), Positives = 163/380 (42%), Gaps = 59/380 (15%)

Query: 14  IAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHE 70
           IA E  +P+   E   DP   H V++ I  T +C +D   Y   G+    L  P VLGHE
Sbjct: 17  IAIE-QRPVPTIE---DP---HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHE 69

Query: 71  GSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTT 130
            SG V  +G  VT VKVGD V                G+ NLC  +       +      
Sbjct: 70  SSGEVVEVGNAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI------ 123

Query: 131 RFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAI 187
                DG  + +++    F          LV   + VS+E  A    L  GV +      
Sbjct: 124 -----DGTLVKYYLSPEDF----------LVKLPEGVSYEEGACVEPLSVGVHSN----- 163

Query: 188 KTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPK 247
           K A ++    V VFGAG VGL     A++ GAS ++ VD+ ++K   + +FGAT+  N  
Sbjct: 164 KLAGVRFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSS 223

Query: 248 ELK--DSEDIVSKLIEMTDGG-LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQ 304
           ++    ++++ S++ ++  G   D  F+C+G  +V  +A     K  G  + +G+   G+
Sbjct: 224 KIPTDKAQELASEVEKLLGGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGM---GK 279

Query: 305 EIATRPFQLVTGRVWR-----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359
                P   V+G+  +       +FG  +    +        +G + V   IT R  F +
Sbjct: 280 NYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFED 333

Query: 360 INAAFED--LHNGSCLRTVL 377
              A++    H G  ++T++
Sbjct: 334 AAKAYDYNISHGGDVVKTII 353

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 75.5 bits (184), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 100/224 (44%), Gaps = 28/224 (12%)

Query: 13  AIAYEANK-PLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPCVLGHE 70
           AI + +N   L   +I V  P + E+ I +  + VCHTD ++  G  P     P V GHE
Sbjct: 9   AIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 71  GSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGT 129
           G+G+V ++G +V   KVGD   I      C  C++C  G  + C            P   
Sbjct: 69  GAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNC------------PHAD 116

Query: 130 TRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT 189
              +  DG          +F QY     V      +       A + C   T Y  A+K+
Sbjct: 117 LSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKS 165

Query: 190 ANIQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDLNNDKK 232
           A+++ G  VA+ GA G +G   VQ A++ G  +++ +D  +DK+
Sbjct: 166 ADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKR 208

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 102/238 (42%), Gaps = 38/238 (15%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG--------------KCKFCLSG 108
            P  +GHE SGI+  +G  VT VKVGDHV+    + C                C  C  G
Sbjct: 67  LPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             NLC       G GV+  G                    F++  VV++  ++   K + 
Sbjct: 127 CENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+     T +  A++ +  +KG +  V GAG +GL  +   K  GA +I+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
             + + +   G   F   K  + S + +  L +  D G D+++DC+G       +L+A
Sbjct: 224 ERRMELARRLGVEIFDPRKHGEKSVESLRALTKSHD-GFDYSYDCSGIQATFDASLKA 280

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 152/363 (41%), Gaps = 60/363 (16%)

Query: 35  HEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHEGSGIVESIGADVTNVKVGDHV 91
           H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  +G  VT VKVGD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 92  IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ 151
                           G  NLC  +       +           DG  + +++    F  
Sbjct: 91  AIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI-----------DGTLVKYYLSPEDF-- 137

Query: 152 YTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGL 208
                   LV   + VS+E  A    L  GV +      K A ++ G  V VFGAG VGL
Sbjct: 138 --------LVKLPEGVSYEEGACVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGL 184

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKEL-----KDSEDIVSKLIEMT 263
                A++ GA+ +I VD+ ++K   + +FGAT+  N  +      +D  D V KL+   
Sbjct: 185 LTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLL--- 241

Query: 264 DGG--LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWR- 320
            GG   D  F+C+G  +V  +A     K  G  + +G+   G+     P   V+G+  + 
Sbjct: 242 -GGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMKL 296

Query: 321 ----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFED--LHNGSCLR 374
                 +FG  +    +        +G + V   IT +  F +   A++    H G  ++
Sbjct: 297 IGCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVK 350

Query: 375 TVL 377
           T++
Sbjct: 351 TII 353

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 129/298 (43%), Gaps = 66/298 (22%)

Query: 13  AIAYEANKPLTVTEIVVDP--PKAHEVRIKIVKTAVCHTD----------------AYSL 54
           A+AY   K +  T  + +P    + +V+I I    VC +D                 +++
Sbjct: 3   ALAYFGQKDIRFTNDLPEPTIQASDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKHAM 62

Query: 55  SGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG-------------- 100
           SGV   GL P  +GHE SG+V  IG  V N+KVGDHV+   T  C               
Sbjct: 63  SGV---GL-PQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDE 118

Query: 101 KCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCST--FSQYTVVADV 158
           +C  C     N C  +                        +  +GC +  F++  V+++ 
Sbjct: 119 ECAACKKDFYNCCSELG-----------------------FCGLGCHSGGFAEKVVISEK 155

Query: 159 SLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRG 218
            +V   K +  +  AL+     + +  A++ + ++ G +  + GAG +GL+ V   +  G
Sbjct: 156 HVVKVPKDIPLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHG 213

Query: 219 ASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSE-DIVSKLIEMTDGGLDFTFDCTG 275
           A  I+V + +  ++  +   GA  F NP +  D   D + K+   +D G DF++DC+G
Sbjct: 214 AGTIVVSEPSASRRKQAEALGALTF-NPFDHGDKAVDELRKIPPGSD-GFDFSYDCSG 269

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 151/365 (41%), Gaps = 54/365 (14%)

Query: 29  VDPPKAHEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHEGSGIVESIGADVTNV 85
           +D P  H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  +G  VT V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 86  KVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMG 145
           K+GD V                G+ NLC  +       +           DG  + +++ 
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVRYYLS 133

Query: 146 CSTFSQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANIQKGDTVAVFG 202
              F          LV     VS+E  A    L  GV +      K A ++ G  V VFG
Sbjct: 134 PEDF----------LVKLPDGVSYEEGACVEPLSVGVHSN-----KLAGVRFGTRVVVFG 178

Query: 203 AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELK-DSEDIVSKLIE 261
           AG VGL     A + GAS +I VD+ +++   + +FGA+   N  +   D    ++  +E
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 262 MTDGG--LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW 319
              GG   D  F+C+G  +V  +A     K  G  + +G+   G+     P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEM 294

Query: 320 R-----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFED--LHNGSC 372
           R       +FG  +    +        SG + V   IT R  F +   A++    H G  
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 373 LRTVL 377
           ++T++
Sbjct: 349 VKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 151/365 (41%), Gaps = 54/365 (14%)

Query: 29  VDPPKAHEVRIKIVKTAVCHTDA--YSLSGVDPEGL-FPCVLGHEGSGIVESIGADVTNV 85
           +D P  H V++ I  T +C +D   Y   G+    L  P VLGHE SG V  +G  VT V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 86  KVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMG 145
           K+GD V                G+ NLC  +       +           DG  + +++ 
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVRYYLS 133

Query: 146 CSTFSQYTVVADVSLVAFDKSVSFEPTAL---LGCGVTTGYGAAIKTANIQKGDTVAVFG 202
              F          LV     VS+E  A    L  GV +      K A ++ G  V VFG
Sbjct: 134 PEDF----------LVKLPDGVSYEEGACVEPLSVGVHSN-----KLAGVRFGTRVVVFG 178

Query: 203 AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELK-DSEDIVSKLIE 261
           AG VGL     A + GAS +I VD+ +++   + +FGA+   N  +   D    ++  +E
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 262 MTDGG--LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW 319
              GG   D  F+C+G  +V  +A     K  G  + +G+   G+     P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEM 294

Query: 320 R-----GSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFED--LHNGSC 372
           R       +FG  +    +        SG + V   IT R  F +   A++    H G  
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 373 LRTVL 377
           ++T++
Sbjct: 349 VKTII 353

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 125/306 (40%), Gaps = 59/306 (19%)

Query: 13  AIAYEANKPLTVTEIVVDPP--KAHEVRIKIVKTAVCHTDAYSL-------------SGV 57
           A+AY   K +  +  +  P     +E+ I I    +C +D +                GV
Sbjct: 3   ALAYFGKKDIHFSADIAKPEIGADNELEIDISWCGICGSDLHEYLDGPIFFPEEGKTHGV 62

Query: 58  DPEGLFPCVLGHEGSGIVESIGADVT-NVKVGDHVIALYTAEC--------------GKC 102
              GL P  +GHE SGIV  +G  V  + KVGDHV+   T  C                C
Sbjct: 63  SGIGL-PQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPC 121

Query: 103 KFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVA 162
             C  G  N C  +    G G    G                    FS+  V+++  ++ 
Sbjct: 122 SACKRGIYNCCTHL-GFCGLGAHGGG--------------------FSEKVVISEQHVIK 160

Query: 163 FDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKI 222
             K +  +  AL+     + +  A+K +N++ G +  V GAG +GL+ +   +  GA KI
Sbjct: 161 IPKEIPLDIAALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKI 218

Query: 223 IVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVM 280
           +V +    +++ + + G   F NP E    E  V +L ++  G  G DF+FDC+G     
Sbjct: 219 VVSEPAQIRREQAAKLGVETF-NPFE--HGEKAVEELRKIPPGGDGFDFSFDCSGMKATF 275

Query: 281 RNALEA 286
              L A
Sbjct: 276 DTGLHA 281

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 128/305 (41%), Gaps = 57/305 (18%)

Query: 13  AIAYEANKPLTVTEIVVDP--PKAHEVRIKIVKTAVCHTDAYSLSG-------------V 57
           A+AY   K +  T+ + +P      ++ I I    +C TD +  +              +
Sbjct: 3   ALAYFGQKDIRFTDELPEPVISADDDLIIDIAWCGICGTDLHEYTDGPIFFPEDGHTHDI 62

Query: 58  DPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAEC--------------GKCK 103
              GL P  +GHE +G+V  IG  V   +VGDHV+   T+ C                C 
Sbjct: 63  SGNGL-PQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCA 121

Query: 104 FCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAF 163
            C  G  N+C  +    G GV   G                    FS+  V+    ++  
Sbjct: 122 ACKRGLYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKI 160

Query: 164 DKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKII 223
            K +  +  AL+     + +  AI+ + +  G +  V G G +GL  +   ++ GASKI+
Sbjct: 161 PKHIPLDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIV 218

Query: 224 VVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMR 281
           V +   ++++ +   GA  F +P E ++ E  V  L ++  G  G D++FDC+G     R
Sbjct: 219 VSEPAKNRRELAKLMGAEVF-DPTEWEEHE-AVEYLRKVAPGGDGFDYSFDCSGLPVTFR 276

Query: 282 NALEA 286
            ++ A
Sbjct: 277 ASVHA 281

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 129/282 (45%), Gaps = 33/282 (11%)

Query: 23  TVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSG----------VDPEG--LFPCVLGHE 70
           T+ E  ++ P   EV I++    +C TD +  +            +P      P  +GHE
Sbjct: 17  TLPEPKINSPD--EVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNPLSNIPLPQPMGHE 74

Query: 71  GSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTT 130
            SG V++IG++VT V+VGD V+    A CG CK       +     R         +G  
Sbjct: 75  FSGFVKAIGSNVTKVEVGDKVVV--EAGCG-CKDVHRWPDSKLYEKRKDTFCSACENGID 131

Query: 131 RFHDKDGKPIYHFMGCST----FSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAA 186
              +      Y F G       F++  VV +  +V   + V  +  AL+   ++  +  A
Sbjct: 132 NCCEN-----YDFTGLGVVGGAFAERVVVGERHIVKLPEEVPTDVGALVE-PISVAW-HA 184

Query: 187 IKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNP 246
           ++ +  +KG +  + GAG +GL+ +   K+ GASKI+V +L   ++  + + G   F +P
Sbjct: 185 VRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRILASKMGVEVF-DP 243

Query: 247 KELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMRNALEA 286
              K  ++ V++L  +  G  G D+ FDC+G       AL+A
Sbjct: 244 S--KHGDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 104/244 (42%), Gaps = 46/244 (18%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG----------------KCKFCL 106
            P  +GHE  G V++IG  VT V VGD V+    A CG                +C  C 
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYGKEQCTACR 124

Query: 107 SGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKS 166
            G  N C     T G GV+                       F++  VV +  +V   + 
Sbjct: 125 KGFDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEE 163

Query: 167 VSFEPTALLGCGVTTGYGAAIKTANIQKGD--TVAVFGAGTVGLSVVQGAKSRGASKIIV 224
           V  +  AL+       +  A+K A  +KG      V GAG +GL+ +   K+ GASKI+V
Sbjct: 164 VPTDVGALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVV 221

Query: 225 VDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTD--GGLDFTFDCTGNVNVMRN 282
            +L   +++ + + G   F +P +  D +  + KL E+ +   G DF FDC+G       
Sbjct: 222 SELAAIRRELALKMGVEVF-DPSKHGDEKQGIKKLREIPEDHDGFDFAFDCSGVETTFNT 280

Query: 283 ALEA 286
           AL +
Sbjct: 281 ALHS 284

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 105/241 (43%), Gaps = 41/241 (17%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAEC--------------GKCKFCLSG 108
            P  +GHE SGI+ S+G      K+GDHV+   TA C                C+ C +G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C  +  T G GV   G         K + +   C     +  +   SL+       
Sbjct: 127 MPNICKYLGLT-GAGVEGGGFAE------KMVINEHHCHKIPHHMPLDVASLI------- 172

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +P ++           A+K ++ ++G +V + G G +GL  +   K  G   I+V +  
Sbjct: 173 -QPISVC--------WHAVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMRNALEA 286
             +++ + + GA  F +P  +   ++ +  L EM  G  G D+TFDC+G    ++ A+E 
Sbjct: 224 LIRRELAEKMGARVF-DPSNM-SLDNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIEC 281

Query: 287 C 287
           C
Sbjct: 282 C 282

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 91/385 (23%), Positives = 155/385 (40%), Gaps = 71/385 (18%)

Query: 13  AIAYEANKPLTVTEIVVDPP--KAHEVRIKIVKTAVCHTDAYS----------------L 54
           A+AY A   +  T+ +V+P      E+ ++I    +C TD +                 L
Sbjct: 3   ALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGETNEL 62

Query: 55  SGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK------------- 101
           SG    GL P  +GHE +G V  IG  VT  KVGDHV+      C               
Sbjct: 63  SG---SGL-PQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKP 118

Query: 102 -CKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSL 160
            C  C  G  N+C ++    G GV   G               M  +    + V  D+ +
Sbjct: 119 WCSACKKGHYNVCSNL-GLIGNGVQSGGCAER-----------MCINESHCFKVPKDMPM 166

Query: 161 VAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGAS 220
              D +   +P A+           AIK A  ++G +V V G G +GL  +   +  G S
Sbjct: 167 ---DIAALIQPIAV--------SWHAIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCS 215

Query: 221 KIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVN 278
            I+V +    +++ +   GAT + +P +  ++E  +  L +M  G  G D+ FD +G   
Sbjct: 216 DIVVSEPAKVRRELAERMGATTY-DPSQ-HNTEKNIQNLRKMILGGDGFDYVFDNSGTPE 273

Query: 279 VMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVT-GRVWRGSAFGGIKGRSEMGGLI 337
            +  A+E C    G ++ + +    + +   P  +    +++ GS       + +  G+I
Sbjct: 274 TLETAIE-CLTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGSM---CYTQFDFEGVI 329

Query: 338 KDYQSGTLKVD---EFITGRRPFTE 359
             ++ G +  D     IT + P  +
Sbjct: 330 DAFERGLIDKDIARHMITAKVPIED 354

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 122/304 (40%), Gaps = 57/304 (18%)

Query: 13  AIAYEANKPLTVTEIVVDP--PKAHEVRIKIVKTAVCHTDAYSLSG-------------V 57
           A+AY     +  T  + +P      E+ I +    +C TD +                 +
Sbjct: 42  ALAYFGKNDIKFTNDLPEPTISAPDEMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCHEI 101

Query: 58  DPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG--------------KCK 103
             EGL P  +GHE +G +   G  VT  KVGD V+   T  C                C 
Sbjct: 102 SGEGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCA 160

Query: 104 FCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAF 163
            C  G  N+C ++    G GV   G                    F++  V+ +      
Sbjct: 161 ACKKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCYKV 199

Query: 164 DKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKII 223
              +S +  AL+     + +  A++ +  +KG +V + GAG +GL  +      G S+++
Sbjct: 200 PDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVV 257

Query: 224 VVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMR 281
           V +    ++D++ + GA   V     KD ++ +  L  +  G  G D+ FDC+GN   ++
Sbjct: 258 VSEPAKIRRDFAEKMGA--IVYDPSAKDHDESIKYLRSIAPGGDGFDYAFDCSGNPATLK 315

Query: 282 NALE 285
            A+E
Sbjct: 316 AAIE 319

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 121/282 (42%), Gaps = 27/282 (9%)

Query: 36  EVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-IA 93
           ++ +KI    VC +D +  SG   +   P ++GHE  G V  +G + T+ VKVGD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYT 153
                C KCK CL+G  + C +   T         +T + D        ++    ++ Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQTY--------STPYEDG-------YVSKGGYADYV 139

Query: 154 VVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQG 213
            V +   V   +++     A L CG  T +   ++      G  VA+ G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 214 AKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDC 273
           AK+ GA ++  +   + KK+ + + GA  F+  KE  D         E     LD    C
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWH-------EKYFDELDLVVVC 250

Query: 274 TGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLV 314
            G+V ++  N L       G+ + I +    + +  +PF LV
Sbjct: 251 AGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV 292

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 140/368 (38%), Gaps = 82/368 (22%)

Query: 14  IAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSG 73
           I YE + P  V E+       +E+ IK   T +   ++Y   G+ P    P VLG E SG
Sbjct: 33  IRYEQDYP--VPEL-----NDNEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASG 84

Query: 74  IVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFH 133
            V + G  V+   + D V                                          
Sbjct: 85  TVVAKGKAVSKFNLADKV------------------------------------------ 102

Query: 134 DKDGKPIYHFMGCSTFSQYTVVADVSLVA------FDKSVSFEPTALLGCGVTTGYGAAI 187
                    ++   TF+QYT +A+   ++       DK +     +L    V T    A 
Sbjct: 103 --------AYLSAGTFAQYTKIAETGHISKLPENTTDKQLELYAASL--VQVLTALTFAK 152

Query: 188 KTANIQKGDTVAVF-GAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNP 246
           +   ++KGD V ++  AG VGL+  Q  K  GA  I V    ++K   + EFGA   VN 
Sbjct: 153 EAYTVKKGDFVLLYAAAGGVGLAFNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVN- 210

Query: 247 KELKDSEDIVSKLIEMTDG-GLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG-Q 304
                 ED++++++E+T G G+D  +D  G  +     L A  +  G  +  G A+    
Sbjct: 211 ---SSKEDVLARVLEITQGQGVDVAYDSIGK-DTFETTLSALRRK-GTFVSFGNASGPVP 265

Query: 305 EIATRPFQLVTGRVWRGSAFGGIKGRSEMG----GLIKDYQSGTLKVDEFITGRRPFTEI 360
            IA         ++ R + FG I  + E       LIK   S   KV   IT   P  E 
Sbjct: 266 PIAISRLSPKNIKILRPTLFGYIASQEEWAYYSEELIKLLHSEEFKV--LITKIYPLEEY 323

Query: 361 NAAFEDLH 368
             A E+L 
Sbjct: 324 RKATEELE 331

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 89/330 (26%), Positives = 129/330 (39%), Gaps = 77/330 (23%)

Query: 36  EVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALY 95
           EV IK   T V + ++Y   G+ P  L P VLG E  G V +IG  V ++KVGD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 96  TAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVV 155
                                                          ++  +TF+Q+T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 156 ADVSLV-AFDKSVSFEPTALLGCGVTTGYGAAI---KTANIQKGDTVAVFGA-GTVGLSV 210
            + + V     + S E   L   G+  G  A     +  +++KGD V ++ A G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLDF 269
            Q  + RGA  I V    N+K   + E GA   +N KE    ++I+ K+ ++T G G+D 
Sbjct: 166 NQLLRMRGAHTIAVAS-TNEKLSLAKENGAEFLINSKE----DNILEKVQQITKGNGVDV 220

Query: 270 TFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLV-----TGRVWRGSAF 324
            FD  G  +     L +C K  G  +  G A+        PF L        R+ R   F
Sbjct: 221 AFDSVGK-DTFETTL-SCLKRKGTFVSYGNASG----PVPPFPLSRLSPKNIRLLRPQLF 274

Query: 325 GGIKGRSEMGG----LIKDYQSGTLKVDEF 350
           G +    E       LI    SG L +  F
Sbjct: 275 GYVAQADEFRHYTEELISLIDSGKLNIKLF 304

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 121/291 (41%), Gaps = 54/291 (18%)

Query: 13  AIAYEANKPLTVTEIVVDP--PKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP------ 64
           A+AY   + +  T  + +P   K  +V I IV   +C TD + L  +D    FP      
Sbjct: 3   ALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETH 60

Query: 65  --------CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK----------CKFCL 106
                     +GHE +G+V  +G+ VT  + GDHV+   T  C            CK C 
Sbjct: 61  EISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACK 120

Query: 107 SGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKS 166
            G  N+C  +    G GV   G                    F++  V+ +         
Sbjct: 121 RGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVPSW 159

Query: 167 VSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD 226
           +  +  AL+       +  A+K   +++G +  + G G +GL ++   +  G + I+V +
Sbjct: 160 IPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSE 217

Query: 227 LNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTG 275
               ++D + + GA    NP + K +E+ +  L  ++    G DFTFDC+G
Sbjct: 218 PAKIRRDLAEKMGAI-VSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 94/229 (41%), Gaps = 18/229 (7%)

Query: 64  PCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123
           P  +GHE SG V  +G  VT VKVGD V+   T  C         K     +  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCST----FSQYTVVADVSLVAFDKSVSFEPTALLGCGV 179
              D    +          FMG       F++  V  +  +V        +  AL+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 180 TTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFG 239
           +  + AA + +    G +  V GAG +GL+++   K++GASKIIV +    +++ +    
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMH 234

Query: 240 ATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACH 288
              F +P    D    + +       G DF FDC+G        L+A H
Sbjct: 235 VETF-DPSTHGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 141/355 (39%), Gaps = 89/355 (25%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIAL 94
           +E+ IK     +   +AY   G+ P  L P +LG E +G+V + G  V N  +GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTV 154
                                                           +M  STF+QYT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 155 VADVSLVA------FDKSVSFEPTALL-GCGVTTGYGAAIKTANIQKGDTVAVFGA-GTV 206
            +   L++       D  +     AL+ G    T    A K   +++GD + ++ A G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 207 GLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMT-DG 265
           GL + Q  K RGA  I VV    +K++ + +FGA   +N  +    EDI+ + +E+T D 
Sbjct: 163 GLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK----EDILKRALEITNDK 217

Query: 266 GLDFTFDCTGN--VNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLV-----TGRV 318
           G+D  FD  G    ++  NAL    K  G  +  G A+        PF L        R+
Sbjct: 218 GVDAVFDSVGKDTFDISLNAL----KLKGSFVSFGNASG----PVPPFALSRLSSKNIRL 269

Query: 319 WRGSAFGGIKGRSEMG----GLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHN 369
            R + FG +    +       L +   SG LK+   IT   P +E   A ++L +
Sbjct: 270 MRPTLFGYLAEPEDWDHYSKKLFELIDSGKLKIA--ITKTYPLSEYKIATQELES 322

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 109/250 (43%), Gaps = 70/250 (28%)

Query: 36  EVRIKIVKTAVCHTDAYSLSGVDPEGLFPC----VLGHEGSGIVESIGADVTNVKVGDHV 91
           ++ IK   T V + ++Y       +GL+PC    +LG E +G + + G DVTN ++GD V
Sbjct: 37  DLLIKNKYTGVNYIESYF-----RKGLYPCEKPYILGREAAGTIVAKGKDVTNFEIGDKV 91

Query: 92  IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ 151
                                                              ++  STF+Q
Sbjct: 92  --------------------------------------------------AYISNSTFAQ 101

Query: 152 YT-VVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT---ANIQKGDTVAVFGA-GTV 206
           YT   ++ +++   K  + E   L   G+     A   T    +++KGD + +F A G V
Sbjct: 102 YTKFPSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRKGDYILLFAAAGGV 161

Query: 207 GLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG- 265
           GL + Q  + +GA  I V    ++K + + E+GA   +N  +    EDI+ K++E+T+G 
Sbjct: 162 GLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK----EDILKKVLEITNGE 216

Query: 266 GLDFTFDCTG 275
           G+D +FD  G
Sbjct: 217 GVDASFDSVG 226

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 121/312 (38%), Gaps = 50/312 (16%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  +G  V N+KVGD V+   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C S     G GV   G                    F++  V+ +         V 
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+       +  AI+    + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMRNALEA 286
             +++ + + GA  + +P      E I   L  + DG  G D+TFDC+G + V  NA   
Sbjct: 224 KVRRELAEKMGARVY-DPTAHAAKESI-DYLRSIADGGDGFDYTFDCSG-LEVTLNAAIQ 280

Query: 287 CHKGWGQSIIIGVAAAGQEIATRPFQL-VTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTL 345
           C    G ++ + +     +I   P  + +  R + GS         +   +I+  + G +
Sbjct: 281 CLTFRGTAVNLAMWGH-HKIQFSPMDITLHERKYTGSM---CYTHHDFEAVIEALEEGRI 336

Query: 346 KVD---EFITGR 354
            +D     ITGR
Sbjct: 337 DIDRARHMITGR 348

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 117/300 (39%), Gaps = 62/300 (20%)

Query: 63  FPCVLGHEGSGIVESIG--------------------ADVTNVKVGDHVIALYTAECGKC 102
            P  +GHE SGIV  +G                    +DV     G H    Y  E  KC
Sbjct: 67  LPLAMGHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKH----YGEE--KC 120

Query: 103 KFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVA 162
             C  G  N C     T G G +  G                    F++  +V +  +V 
Sbjct: 121 PNCARGYDNCCAYAGFT-GLGFIGGG--------------------FAEQILVGEQHIVR 159

Query: 163 FDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKI 222
               +  +  AL+     T + A  K     KG T  + G+G +GL+++   K+ GASKI
Sbjct: 160 IPDEIPLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKI 217

Query: 223 IVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRN 282
           +V ++   ++  + +     F      K++ + +  L E  D G DF FDC+G    M  
Sbjct: 218 VVSEVAQVRRKLAEKMKVEVFDPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNT 276

Query: 283 ALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQS 342
           A+   H    +  I+ VA  G   +T  F ++   +   +  G I      G +++D++ 
Sbjct: 277 AI---HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI------GYVVRDFEE 324

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 82/339 (24%), Positives = 138/339 (40%), Gaps = 31/339 (9%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVT-NVKVGDHV-I 92
            +V IK++   VC +D +  +G        CV+GHE  G V  +G   T  VKVGD V +
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
              +  C +C+ C++G    C          + PDG+                   F  +
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGSK--------------AQGGFGSH 139

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQ 212
               +  +    K +     A L CG  T +   ++   +  G TV + G G +G   + 
Sbjct: 140 VRTHEYFVHPIPKELDTVNAAPLLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAIL 198

Query: 213 GAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFD 272
            AK+ GA K+I +  +  KK+   + GA +++   E  D +   +       G +DF   
Sbjct: 199 FAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEGDDWKQKFA-------GSIDFMLL 250

Query: 273 CTGNVNVMR-NALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRS 331
           C  + +    ++L +  K  G+   IG+      ++  P  L+ G  +  SA G      
Sbjct: 251 CNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLL-GIKFGFSALGSRNEFQ 309

Query: 332 EMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNG 370
           +M  L+K   +  L V+    G +   E   AFE + NG
Sbjct: 310 KMFELVKK-NNIKLWVETLPIGEKGLHE---AFERVENG 344

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 104/249 (41%), Gaps = 64/249 (25%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDP-EGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIA 93
            E+ IK   T V + ++Y   G+ P E   P VLG E SG V + G  VTN +VGD V  
Sbjct: 36  EELLIKNKYTGVNYIESYFRKGIYPCEK--PYVLGREASGTVVAKGKGVTNFEVGDQV-- 91

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYT 153
                                                            ++  STF+QY+
Sbjct: 92  ------------------------------------------------AYISNSTFAQYS 103

Query: 154 VVADV-SLVAFDKSVSFEPTALLGCG---VTTGYGAAIKTANIQKGDTVAVFGA-GTVGL 208
            ++    ++   K  S E   L   G   V T      +  +++KGD V +F A G VGL
Sbjct: 104 KISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGL 163

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GL 267
            + Q  K +GA  I V    ++K   + E+GA   +N  +    EDI+ ++++ T+G G+
Sbjct: 164 ILNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK----EDILRQVLKFTNGKGV 218

Query: 268 DFTFDCTGN 276
           D +FD  G 
Sbjct: 219 DASFDSVGK 227

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 93/240 (38%), Gaps = 40/240 (16%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  +G  VT  KVGD V+   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C S     G GV   G                    F++  V+ +       + V 
Sbjct: 127 LYNIC-SYLGLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+       +  AI   + + G T  + GAG +GL  +    + G S I V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 229 NDKKDWSFEFGATDF-VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEAC 287
             +++ + + GA  F       KDS D +  +    D G D+TFDC+G + V  NA   C
Sbjct: 224 KVRRELAEKMGARVFDPTAHAAKDSIDYLRSVAPGGD-GYDYTFDCSG-LEVTLNASVQC 281

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 96/241 (39%), Gaps = 42/241 (17%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  +G  V ++KVGD V+   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C S     G GV   G                    F++  V+ +         V 
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+       +  AI     + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKE--LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
             +++ + + GA  + +P E   K+S D +  + E  D G D+TFDC+G + +  NA   
Sbjct: 224 KLRRELAEKMGARVY-DPTEHAAKESIDYLRSIAEGGD-GFDYTFDCSG-LEITLNAAIQ 280

Query: 287 C 287
           C
Sbjct: 281 C 281

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 128/305 (41%), Gaps = 27/305 (8%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHV-IA 93
           ++V +KI    VC +D ++ SG   E   P V+GHE  G V  IG+    +KVGD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYT 153
                C +C  C S     C     T  K    D T  ++ K G           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 154 VVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQG 213
            + +   V   +++     A L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 214 AKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDC 273
           AK+ GA +   +  ++ KK+ + + GA  F+  KE     D  +K  +      D    C
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIATKE---EPDWATKYFDT----FDLIVVC 253

Query: 274 TGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSE 332
           + ++ ++  N +    K  G+ + I V    + +  +PF L+ G     SA GGI    +
Sbjct: 254 SNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIKQ 312

Query: 333 MGGLI 337
           M  L+
Sbjct: 313 MLDLV 317

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 96/241 (39%), Gaps = 42/241 (17%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSG 108
            P  +GHE +G V  +G  V ++KVGD V+   T  C                C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
             N+C S     G GV   G                    F++  V+ +         V 
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+       +  AI     + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKE--LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEA 286
             +++ + + GA  + +P E   ++S D +  + E  D G D+TFDC+G + V  NA   
Sbjct: 224 KLRRELAEKMGARVY-DPTEHAARESIDYLRSVAEGGD-GFDYTFDCSG-LEVTLNAAIQ 280

Query: 287 C 287
           C
Sbjct: 281 C 281

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/342 (23%), Positives = 141/342 (41%), Gaps = 59/342 (17%)

Query: 13  AIAYEANKPLTVTEIVVDPP--KAHEVRIKIVKTAVCHTDAYSLSG------VDPE---- 60
           A+ Y +   +  T+ + +P      E+ + IV   +C TD + L+       +D E    
Sbjct: 3   ALVYFSKGDIRFTDTLAEPEISTGDELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEI 62

Query: 61  ---GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CK 103
              GL P  +GHE +GIV ++G+ V   +VGDHV    T  C                C 
Sbjct: 63  SGNGL-PQAMGHEMAGIVTAVGSGVKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCT 121

Query: 104 FCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAF 163
            C  G  N C  +    G GV   G                    F++  VV +      
Sbjct: 122 SCQRGMYNCCDYL-GLIGNGVQSGG--------------------FAERIVVNESHCYKC 160

Query: 164 DKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKII 223
             ++ +E  AL+       +  AI  A  + G +V + G G +GL  +      G ++II
Sbjct: 161 PDNLPWEVAALIQPIAVCWH--AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEII 218

Query: 224 VVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMR 281
           V +    ++D++ + GA  + +P +    + I   L +M  G  G D+ FDC+G    ++
Sbjct: 219 VSEPVKLRRDYAEKMGAVVY-DPLQCSHEQSI-PNLRKMAPGADGFDYCFDCSGTPATLK 276

Query: 282 NALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTG-RVWRGS 322
            ++E C    G ++ + + A  + +   P  +    +++ GS
Sbjct: 277 ASIE-CLTFRGTAVNVAMWATNKAVNFYPMDITKQEKIYTGS 317

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 118/301 (39%), Gaps = 47/301 (15%)

Query: 32  PKA---HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPC----------VLGHEGSGIVESI 78
           PKA   H+V I++    +C ++ ++L          C          V+GHE  G V ++
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 79  GADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDG 137
           G  V+   VGD V +    + C +C  C SG    C +  +T  K   PDG         
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------- 137

Query: 138 KPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDT 197
                ++    ++ +    +         +  E  A L CG  T +    +    +    
Sbjct: 138 -----YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 198 VAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVS 257
           VAV G G +G   +  A++ GA ++      + K+D + + GA  FV   +         
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVATGDAD------- 244

Query: 258 KLIEMTDGGLDFTFD----CTGNVNVMR-NALEACHKGWGQSIIIGVAAAGQEIATRPFQ 312
                 + GLD TFD    C  + + +  NA+  C K     + +G+    +E++ +PF 
Sbjct: 245 -----WNAGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPFS 299

Query: 313 L 313
            
Sbjct: 300 F 300

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 122/325 (37%), Gaps = 52/325 (16%)

Query: 18  ANKPLTVTEIVVDPPK---AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPC--------- 65
           AN  LT  E     PK   AH+V I++    +C ++ +SL          C         
Sbjct: 21  ANPKLTSYE-----PKNFEAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKS 75

Query: 66  -VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123
            V+GHE  G V ++G++VT   +GD V +      C KC  C SG    C     T    
Sbjct: 76  QVVGHEVVGKVVAVGSNVTLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--- 132

Query: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
                 +R+ D        ++    ++ +    +         +  E  A L CG  T Y
Sbjct: 133 -----CSRYADG-------YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVY 180

Query: 184 GAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243
               +     K   VA+ G G +G   +  +K+ GA ++        KK+ + + GA  F
Sbjct: 181 SPIKRNIEGVKDPKVAIIGIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHF 239

Query: 244 VNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGN-----VNVMRNALEACHKGWGQSIIIG 298
           +   E            E  + GL+ TFD   N      ++  N L  C K     I +G
Sbjct: 240 IATGE------------EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVG 287

Query: 299 VAAAGQEIATRPFQLVTGRVWRGSA 323
           +    ++   +PF   +     GS+
Sbjct: 288 LPHVDEDFKVKPFSFFSNGCCIGSS 312

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 96/226 (42%), Gaps = 65/226 (28%)

Query: 60  EGLFPC----VLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGS 115
           +GL+PC    VLG E +G V + G DV N ++GD V                        
Sbjct: 56  KGLYPCEKPYVLGREATGTVVAKGKDVNNFQIGDQV------------------------ 91

Query: 116 VRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADV-SLVAFDKSVSFEPTAL 174
                                      ++  STF+QYT  +   +++   K  S E   L
Sbjct: 92  --------------------------AYISHSTFAQYTKFSSKGNVMRLPKCTSDEKMKL 125

Query: 175 LGCGVTTGYGAAIKT---ANIQKGDTVAVF-GAGTVGLSVVQGAKSRGASKIIVVDLNND 230
              G+     A   T    +++KGD + V+  AG VGL + Q  K +GA  I V    ++
Sbjct: 126 YAAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGVGLILNQLLKMKGAHAIAVAS-TDE 184

Query: 231 KKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLDFTFDCTG 275
           K D + + GA   +N  +    ED++ +++E+T+G G+D +FD  G
Sbjct: 185 KLDIAKKNGAEYLINSSK----EDVLERVLEITNGEGVDSSFDSIG 226

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 123/304 (40%), Gaps = 57/304 (18%)

Query: 13  AIAYEANKPLTVTEIVVDPP--KAHEVRIKIVKTAVCHTDAYSLSG-------------V 57
           A+AY     +  T  + +P      E+ I I    +C TD +                 +
Sbjct: 3   ALAYFGKNDIKFTNDLPEPKITAPDELIIDISWCGICGTDLHEFQDGPIFFPENGCCHEI 62

Query: 58  DPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECG--------------KCK 103
             EGL P  +GHE +GIV  IG  V   +VGD V+   T  C               +C 
Sbjct: 63  SGEGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECA 121

Query: 104 FCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAF 163
            C  G  N+C ++    G GV   G                    F++  V+ +      
Sbjct: 122 ACKKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAKCYKI 160

Query: 164 DKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKII 223
            + ++ +  AL+     + +  A++ +  + G +V + G G +GL  +      G ++++
Sbjct: 161 PEHLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVV 218

Query: 224 VVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG--GLDFTFDCTGNVNVMR 281
           V +    ++D + + GA   V     +D ++ +  L  +  G  G D+TFDC+GN   ++
Sbjct: 219 VSEPAKIRRDLAEKMGAV--VYDPMTRDHDESIKYLRSIAPGGDGFDYTFDCSGNPATLK 276

Query: 282 NALE 285
            A+E
Sbjct: 277 AAIE 280

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 102/246 (41%), Gaps = 61/246 (24%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIAL 94
           +++ IK     V + ++Y   G+ P  L P +LG E SG+V   G ++ N ++GD V   
Sbjct: 52  NDIIIKNKYAGVNYIESYFRKGIYPCAL-PAILGREASGVVVDKGTNIKNFEIGDKV--- 107

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTV 154
             A  G C                                             + +Q+T 
Sbjct: 108 --AYIGNC---------------------------------------------SMAQFTK 120

Query: 155 VADVSLVAFDKSVSFEPTALLGCGVTTGYGA---AIKTANIQKGDTVAVF-GAGTVGLSV 210
           + +  ++      + E   L   G+  G  A     +   ++KGD + V+  AG  GL  
Sbjct: 121 IDNSMIMKLSSDSTNEDLKLYAAGILQGLTALSFVTEAYEVKKGDYILVYAAAGGAGLIF 180

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLDF 269
            Q  K+RGA  +I V  +++K   + E GA   +N K    ++DI++K++E+TD  G+  
Sbjct: 181 DQLIKARGAH-VIAVCSSDEKLQLAKENGAEYLINSK----TDDILTKVMEITDNKGVQA 235

Query: 270 TFDCTG 275
            FD  G
Sbjct: 236 AFDSVG 241

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 106/242 (43%), Gaps = 28/242 (11%)

Query: 143 FMGCSTFSQYT-VVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAI---KTANIQKGDTV 198
           ++  STF+Q+T    +  L+   K +S E   ++   +  G        +  N+QKGD +
Sbjct: 112 YLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQKGDFI 171

Query: 199 AVF-GAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVS 257
            V+  AG VGL   Q  K+RGA + I V   ++K   + E+GA   +N       +DIV 
Sbjct: 172 LVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLIN----STKDDIVE 226

Query: 258 KLIEMTDG-GLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQL--- 313
           K+ E T+G G+   FD  G  +     L+   +  G  +  G A+     A  PF +   
Sbjct: 227 KVKEFTNGEGVAAAFDSIGK-DTFETTLQVVKRK-GTIVSFGNASG----AVPPFSINRL 280

Query: 314 --VTGRVWRGSAFGGIKGRSEM----GGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDL 367
                ++ R   F  +   SE       LI+   SG LK+   I+   P  +   A EDL
Sbjct: 281 SPKNLKLVRPQLFAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKDYKEATEDL 338

Query: 368 HN 369
            +
Sbjct: 339 ES 340

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 107/250 (42%), Gaps = 70/250 (28%)

Query: 36  EVRIKIVKTAVCHTDAYSLSGVDPEGLFPC----VLGHEGSGIVESIGADVTNVKVGDHV 91
           ++ IK   T V + ++Y       +GL+PC    VLG E +G++ + G DVTN + GD V
Sbjct: 37  DILIKNKYTGVNYIESYFR-----KGLYPCEKPYVLGREATGVIVAKGKDVTNFETGDQV 91

Query: 92  IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ 151
                                                              ++  STF+Q
Sbjct: 92  --------------------------------------------------AYISNSTFAQ 101

Query: 152 YT-VVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT---ANIQKGDTVAVFGA-GTV 206
           YT   ++ +++      S E   L   G+     A   T    +++KGD + V+ A G V
Sbjct: 102 YTKFPSEGTIMKLPSGTSDEKMKLYAAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGV 161

Query: 207 GLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG- 265
           GL + Q  + + A  I V     +K + + ++GA   ++  +    EDI+++++E+TDG 
Sbjct: 162 GLILNQLLRMKDAHAIAVAS-TYEKLETAKDYGAEFLIDSSK----EDILTRVLEITDGK 216

Query: 266 GLDFTFDCTG 275
           G+D +FD  G
Sbjct: 217 GVDASFDSVG 226

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 147/356 (41%), Gaps = 42/356 (11%)

Query: 26  EIVVDPPKA--HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVT 83
           ++  DP K   H++ IK+    VC +D ++ SG   +   P V+GHE  G V  +G +  
Sbjct: 25  KVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENCN 84

Query: 84  N-VKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIY 141
           + +K+GD V +      C  C+ C +     C     T G+   PDG   +  K G    
Sbjct: 85  SGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDG---YSSKGG---- 136

Query: 142 HFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT--ANIQKGDTVA 199
                  ++ Y  V +   V   +++     A L CG  T Y   ++      +K   V 
Sbjct: 137 -------YADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIVG 189

Query: 200 VFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKL 259
           + G G  GL     AK+ GA ++  +   + KK+ + + GA  F+  KE     D  +K 
Sbjct: 190 IGGIGHQGLLF---AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKE---EPDWGTKY 242

Query: 260 IEMTDGGLDFTFDCTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRV 318
            +      D    C  ++ +V  N +    K  G  + I V    + ++ +PF L  G  
Sbjct: 243 FDT----FDLIVVCASSLTDVDFNTVPNTMKIGGSIVSISVPEQNETLSLKPFGL-KGVS 297

Query: 319 WRGSAFGGIKGRSEMGGLIKDYQSGTLK--VDEFITGRRPFTEINAAFEDLHNGSC 372
              SA G I   SEM  L+K      +K  V+    G +   E   AFE +  G C
Sbjct: 298 ISNSALGSI---SEMRDLLKLVSENNIKLWVETIPIGEKGVKE---AFERMDKGDC 347

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 98/254 (38%), Gaps = 34/254 (13%)

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V+GHE  G V ++G +V+  KVGD V +    + C +C  C S     C     T     
Sbjct: 75  VVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP- 133

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            PDG              ++    ++ +    +         +  E  A L CG  T + 
Sbjct: 134 YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFS 179

Query: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
              +    +K   VA+ G G +G   +  +K+ GA ++  V     K+D + + GA  F+
Sbjct: 180 PIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI 238

Query: 245 NPKELKDSEDIVSKLIEMTDGGLDFTFD----CTGNVNVMR-NALEACHKGWGQSIIIGV 299
              E               + GLD TFD    C  + + +  NAL  C K     + +G+
Sbjct: 239 ATSEPN------------WNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVGL 286

Query: 300 AAAGQEIATRPFQL 313
               ++   +PF  
Sbjct: 287 PHIDEDFKVKPFSF 300

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 100/241 (41%), Gaps = 41/241 (17%)

Query: 63  FPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGK--------------CKFCLSG 108
            P  +GHE SG+VE +G      KVGDHV+   T  C                C  C  G
Sbjct: 67  LPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVS 168
            TN+C  + A  G G+   G                    F++  V+ +  +      + 
Sbjct: 127 MTNICAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIPDHMP 165

Query: 169 FEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLN 228
            +  AL+       +  A+K A+ +KG +  + G G +GL  +   K  G   I++ +  
Sbjct: 166 LDIGALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPA 223

Query: 229 NDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEM--TDGGLDFTFDCTGNVNVMRNALEA 286
             +++++ + GA  + +P  +   E  V  L EM     G D+TFDC+G    +  A+E 
Sbjct: 224 TIRREYAGKMGAKVY-DPTGVPFDES-VKTLREMGPNGDGFDYTFDCSGLPITLNAAIEC 281

Query: 287 C 287
           C
Sbjct: 282 C 282

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 111/285 (38%), Gaps = 72/285 (25%)

Query: 61  GLFPC----VLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSV 116
           GL+PC    VLG E  G+V +IGADV   KVGD V             CLS         
Sbjct: 57  GLYPCEKPYVLGREAVGVVAAIGADVRRFKVGDRVA------------CLS--------- 95

Query: 117 RATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVS--LVAFDKSVSFEPTAL 174
                                          TF+QYT V++ S  L   D     E  A+
Sbjct: 96  -----------------------------SGTFAQYTAVSEKSNVLKLPDDIQDGELQAV 126

Query: 175 LGCGVT--TGYGAAIKTANIQKGDTVAVF-GAGTVGLSVVQGAKSRGASKIIVVDLNNDK 231
            G  V   T      +    Q G+ V V+  AG VG  ++Q   +R   ++I V   ++K
Sbjct: 127 AGSLVNGLTALTLVDEAYKPQVGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEK 185

Query: 232 KDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLDFTFDCTGNVNVMRNALEACHKG 290
              +   GA   +N       EDIV+K++E TDG G+  ++D  G  +     L++  + 
Sbjct: 186 LQIAKSRGAEFLIN----SSREDIVAKVLEFTDGEGVGASYDSVGK-DTFETTLQSVKR- 239

Query: 291 WGQSIIIGVAAAGQEIATRPFQLVTG---RVWRGSAFGGIKGRSE 332
             +  I+    A   +     Q +T    ++ R   +G +  R E
Sbjct: 240 --KGTIVSFGNASGAVPPFSIQRLTPKNLKILRPQLYGYLATREE 282

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 119/282 (42%), Gaps = 27/282 (9%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-I 92
           +++ IKI    VC +D +  SG   +   P V+GHE  G V  +G+  T+ +KVGD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                 C  C  C +     C +V  T G    PDG              + G   ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG--------------YNGKGGYANY 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQ 212
             V +   V   +++     A L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 213 GAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFD 272
            AKS GA ++  +  ++ KK+ +F+ GA  F+     KD  D   K  +     LD    
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFI---ATKDEPDWGKKYFDT----LDLIVI 249

Query: 273 CTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQL 313
           C G++ +V  + L       G+ + I +  A +++    F L
Sbjct: 250 CAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL 291

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 130/319 (40%), Gaps = 37/319 (11%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-I 92
           H+++IK+    VC +D ++ SG       P V+GHE  G V  +G    N +KVGD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                 C +C  C +   + C    AT G G  PDG              ++    ++ +
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQ 212
             V +  +V   +++  E  A L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRNG-CGPGKKVGIVGIGGIGHQGVI 197

Query: 213 GAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKD----SEDIVSKLIEMTDGGLD 268
            A + GA ++  +   + KKD +F+ GA  F+  KE  D      D    ++   +   D
Sbjct: 198 FANAMGA-EVYAISRTSKKKDDAFKLGAHHFIATKEEPDWGTKYYDTFDLIVVCANSLTD 256

Query: 269 FTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIK 328
             FD   +            K  G+ + I +    Q +  +PF L  G     S  G IK
Sbjct: 257 IDFDVVPHT----------MKIGGRIVSISIPEMSQVLKLKPFGL-KGVSISNSHLGSIK 305

Query: 329 GRSEMGGLIKDYQSGTLKV 347
              E+  L+K      L++
Sbjct: 306 ---ELKTLLKLVSEKNLRI 321

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 132/328 (40%), Gaps = 37/328 (11%)

Query: 26  EIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TN 84
           E    P   ++V IKI    VC +D +  +G   +   P V+GHE  G V  +G    T 
Sbjct: 24  EFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGPKCKTG 83

Query: 85  VKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHF 143
           +K+GD V +      C +C+ C +     C     T  +            +DG     +
Sbjct: 84  LKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTTYSQPY----------EDG-----Y 128

Query: 144 MGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGA 203
           +    ++ Y  V +   V   +++  E  A L CG  T Y   ++      G  V + G 
Sbjct: 129 VSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKVGILGI 187

Query: 204 GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKD----SEDIVSKL 259
           G +G   +  AK+ GA ++  +  +N KK+ S + GA  ++  KE  D      D    +
Sbjct: 188 GGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPDWGTKYFDTFDLI 246

Query: 260 IEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW 319
           +       D  FD      VM  A+    K  G+ + I V    + +  +PF L+ G   
Sbjct: 247 VVCASSLTDVDFD------VMPKAM----KVGGRIVSISVPEQDEVLTMKPFGLI-GVSI 295

Query: 320 RGSAFGGIKGRSEMGGLIKDYQSGTLKV 347
             S  G I   +EM  L+K      +K+
Sbjct: 296 ANSILGSI---AEMKQLLKLVSENNIKI 320

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 114/283 (40%), Gaps = 27/283 (9%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-I 92
           H++ IKI    VC +D +  SG   +   P V+GHE  G +  +G    +  K+GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                 C +C  C++     C  V  T         ++R                 ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPYEDGYSSR---------------GGYANY 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQ 212
             V +   V   +S+     A L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 213 GAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFD 272
            AK+ GA ++  +   + K+D + + GA  F+  KE  D         E  D  LD    
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHK------EYFD-KLDLVVI 249

Query: 273 CTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLV 314
           C G++ ++  N L       G+ + I +    + +  +PF LV
Sbjct: 250 CAGSLTDIDFNTLPNILTVGGRIVSIAIPEQHEVLKMKPFGLV 292

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 126/326 (38%), Gaps = 72/326 (22%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIAL 94
           +E+ +K   + +   ++Y   G+ P    P +LG E SG V + G  V +  +GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--- 107

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTV 154
                                                           ++  S F+QYT 
Sbjct: 108 -----------------------------------------------AYLSGSAFAQYTK 120

Query: 155 V-ADVSLVAFDKSVSFEPTALLGCGVTTGYGAAI---KTANIQKGDTVAVFGA-GTVGLS 209
           V A   +V   K  + E   L   G+     A     +  N++KGD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 210 VVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLD 268
           + Q  K RGA  I VV    +K + + + GA   +    +   EDIV+++ E+T+  G+D
Sbjct: 181 LDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGI----ISSKEDIVTRVKEITNNQGVD 235

Query: 269 FTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTG--RVWRGSAFGG 326
             FD  G  +     + A  +   +   +    A   ++  P   +TG  ++ R S F  
Sbjct: 236 AAFDSIGK-DTFETTISALKR---KGTFVSYGNASGPVSPFPLTKLTGNIKILRPSLFSY 291

Query: 327 IKGRSEMGGLIKDY----QSGTLKVD 348
           I    E     +++     SG LK++
Sbjct: 292 IATSEEWKHYSREFVSLVSSGKLKIN 317

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 120/283 (42%), Gaps = 27/283 (9%)

Query: 34  AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV- 91
           A ++ +K+    VC +D +  +G       P V+GHE  G V  +G+     +KVGD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 92  IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ 151
           +      C +C  C S     C ++           GT  F   DG     ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNM----------TGTYNFPYPDG-----YISQGGYAS 160

Query: 152 YTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVV 211
           + +V +   +    ++     A L CG  T +   +++ N+  G +V V G G +G   V
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAV 219

Query: 212 QGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTF 271
             AK+ GA+ +  +   ++KKD + + GA  ++   E KD     +         LD   
Sbjct: 220 IFAKALGAN-VTAISRRSNKKDDALKLGADVYIAAVEDKDWHKTYANT-------LDLIV 271

Query: 272 DCTGNVNVMR-NALEACHKGWGQSIIIGVAAAGQEIATRPFQL 313
            C+ ++  +  + + +  K  G+ + I +  A + +  RP  L
Sbjct: 272 VCSSSLTELDFDRIPSLLKVGGKVLSIAIPEASERLVLRPLLL 314

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 131/309 (42%), Gaps = 34/309 (11%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-- 91
           H++ IKI    VC +D ++ SG   +   P V+GHE  G V  +G   T+ +K+GD V  
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 92  --IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTF 149
              A    ECG+CK   S     C     T         +T + D      Y+  G   +
Sbjct: 95  GAQAFSCLECGRCK---SDNEPYCTKSVWTY--------STNYEDG-----YNSKG--GY 136

Query: 150 SQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLS 209
           + Y  + +   +   +++     A L CG  T +   ++     +G  V + G G +G  
Sbjct: 137 ADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHM 195

Query: 210 VVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDF 269
            +  AK+ GA ++  +   + KKD S + GA  F+  KE     D  +K  +      D 
Sbjct: 196 ALIFAKAMGA-EVYAISRTSAKKDDSIKMGADHFIATKE---EPDWATKYFDT----FDL 247

Query: 270 TFDCTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIK 328
              C+ ++ ++  + +    K  G+ + I      + I  +PF L+ G     SA GGI 
Sbjct: 248 IVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSALGGIN 306

Query: 329 GRSEMGGLI 337
              +M  L+
Sbjct: 307 EIKQMLDLV 315

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 104/248 (41%), Gaps = 62/248 (25%)

Query: 34  AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIA 93
           ++E+ IK   + +   +AY   G+ P  L P + G E SGIV  +G DV N ++GD V  
Sbjct: 52  SNEMVIKNSYSGINFIEAYFRKGIYPCEL-PYLPGREASGIVAEVGKDVKNFQIGDKVAY 110

Query: 94  LYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYT 153
           L+            G+T                                       +++T
Sbjct: 111 LH------------GET--------------------------------------MAEFT 120

Query: 154 VVADVS-LVAFDKSVSFEPTALLGCGVTTGYGA--AIKTAN-IQKGDTVAVF-GAGTVGL 208
            + +   ++   K  S E   L   G+     A   I  A+ ++KG+ V V+  AG VGL
Sbjct: 121 KIKETDPIIKLSKDASDENLKLYAAGLLQSLTAITLINEAHEVKKGEYVLVYAAAGGVGL 180

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GL 267
            + Q  K +GA  I V     +K + +   GA   +N KE    E++V +++E+T+  G+
Sbjct: 181 LLDQLLKMKGAHTIAVCS-TKEKLELAKANGAEFSINSKE----ENVVQRVMEITNNKGV 235

Query: 268 DFTFDCTG 275
           D  +D  G
Sbjct: 236 DVAYDSIG 243

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 132/337 (39%), Gaps = 75/337 (22%)

Query: 36  EVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALY 95
           +V +K     V   +AY   G  P  L P VLG E SG V  +G++V + K+GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSEVKDFKIGDKVA--- 91

Query: 96  TAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTV- 154
                                                          ++G STF+QYT  
Sbjct: 92  -----------------------------------------------YLGGSTFAQYTKK 104

Query: 155 -----VADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGA-GTVGL 208
                + ++     D+ +    ++L+ C   T      +   + +GD + V+ A G VG 
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQC--LTAISFIDEAYKVMEGDYILVYAASGGVGS 162

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GL 267
            + Q    R A  +I V  + +K   + E GA   +N  E    +DI+ K+++ T+G G+
Sbjct: 163 ILCQLISQRKAH-VIAVASSAEKLAMAKENGAEFLINYAE----DDILEKVMQYTNGKGV 217

Query: 268 DFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG-QEIATRPFQLVTGRVWRGSAFGG 326
              FD  G  +     L A  +  G  +  G A+      A         ++ R   +G 
Sbjct: 218 HAAFDSIGK-DTFETDLAALRRK-GTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVYGY 275

Query: 327 IKGRSEMG---GLIKDY-QSGTLKVDEFITGRRPFTE 359
           +  RSE      + K + QS +LKVD  I+G  P +E
Sbjct: 276 LGTRSEWDHYCSIFKHFVQSKSLKVD--ISGIYPLSE 310

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 123/310 (39%), Gaps = 32/310 (10%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TNVKVGDHV-I 92
           ++V ++I    +C +D +  SG       P V+GHE  G V  +G    T VKVGD V +
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
               + C  C  C S     C     T  +   PDG              ++    ++ +
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG--------------YVSQGGYASH 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT--ANIQKGDTVAVFGAGTVGLSV 210
               +  ++   + +     A L CG  T +   I       +K   V + G G +GL  
Sbjct: 139 IRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIF 198

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFT 270
              AK+ GA ++  +  ++ KK+ + + GA  F+  KE  D E   +         LD  
Sbjct: 199 ---AKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYA-------STLDLV 247

Query: 271 FDCTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKG 329
             C  ++  +    L    +  G+ I I V    +E+  +PFQL +G     S  G  K 
Sbjct: 248 IVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGITIGNSQLGSRKE 306

Query: 330 RSEMGGLIKD 339
             ++  L+ D
Sbjct: 307 LIQLLQLVAD 316

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 125/321 (38%), Gaps = 34/321 (10%)

Query: 25  TEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-T 83
            E    P   H++ IKI    VC +D +  +G   +   P V+GHE  G V  IG    T
Sbjct: 24  VEFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNT 83

Query: 84  NVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYH 142
            +KVGD V +      C +C  C +     C     T  +            +DG     
Sbjct: 84  GLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTTYSQPY----------EDG----- 128

Query: 143 FMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFG 202
           ++    ++ Y  V +   V   +++     A L CG  T Y   ++           V  
Sbjct: 129 YVSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGI 188

Query: 203 AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKD----SEDIVSK 258
            G   + ++  AK+ GA ++  +  +N KK+ S + GA  ++  KE  +      D    
Sbjct: 189 GGIGHMGLL-FAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWGEKYFDTFDL 246

Query: 259 LIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRV 318
           ++       D  FD      VM  A+    K  G+ + I +    Q +  +PF L+ G  
Sbjct: 247 IVVCASSLTDVDFD------VMPKAM----KVGGRIVSISIPDEDQTLTMKPFGLL-GVS 295

Query: 319 WRGSAFGGIKGRSEMGGLIKD 339
              SA G IK   ++  L+ +
Sbjct: 296 IANSALGSIKEIEQLLKLVSE 316

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 111/281 (39%), Gaps = 39/281 (13%)

Query: 66  VLGHEGSGIVESIGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124
           V+GHE  G V ++G  VT    G+ V +      C KC  C++G    C     T     
Sbjct: 79  VVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE- 137

Query: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184
            PDG              ++    ++ +    +  +V     +  +  A L CG  T Y 
Sbjct: 138 YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVY- 182

Query: 185 AAIKTAN---IQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241
           + IK A      K   VA+ G G +G   +  +K+    ++  +  ++ KK+ + + GA 
Sbjct: 183 SPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGAD 241

Query: 242 DFVNPKELKDSEDIVSKLIEMTDGGLDFTF----DCTGNVNVMR-NALEACHKGWGQSII 296
            FVN  E    +D+         GGL  TF     CT +   +   +L       G+ I 
Sbjct: 242 HFVNTTE----KDVW--------GGLQDTFHLILSCTISYTKLPFESLLGTLVATGKFIS 289

Query: 297 IGVAAAGQEIATRPFQLVT-GRVWRGSAFGGIKGRSEMGGL 336
           +G+ +  Q +   P QL   G  +  S  G IK   E+  L
Sbjct: 290 VGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLAL 330

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 121/306 (39%), Gaps = 28/306 (9%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TNVKVGDHV-I 92
           H++ I+++   VC +D +  SG   E   P V+GHE  GIV   G    + +KV D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                 C  C  C       C +  +T  K            +DG     ++    ++ Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSY----------RDG-----YVSQGGYADY 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQ 212
             V +   V   +S+     A L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 213 GAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFD 272
            AK+ GA ++  +   + KK  + + G   F+  KE  D         E     LD    
Sbjct: 198 LAKAMGA-EVYAISRTSSKKADAVKLGTDHFIATKEEPDWH-------EKYFDTLDLLVI 249

Query: 273 CTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRS 331
           C G++ +V  + L       G+ + I +    + +  +PF LV G     S  G +K   
Sbjct: 250 CAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKELK 308

Query: 332 EMGGLI 337
           E+  L+
Sbjct: 309 ELLELV 314

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 130/318 (40%), Gaps = 35/318 (11%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-I 92
           H+V IKI    VC +D +  +G       P V+GHE  G V  +G    + +K+G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                 C +C  C S     C     T  +            +DG     ++    ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTTYSQPY----------EDG-----YVSQGGYANY 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT--ANIQKGDTVAVFGAGTVGLSV 210
             V +  +V   K++     A L CG  T Y   I+      +K   V   G G++G  +
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSLI 198

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFT 270
              AK+ GA +  V+  ++ KK+ + + GA  ++   E    ED   K  +  D  +   
Sbjct: 199 ---AKAMGA-ETYVISRSSKKKEDAMKMGADHYIATLE---EEDWGEKYFDTFDLIVVCA 251

Query: 271 FDCTG-NVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKG 329
              TG + NVM  A+    K  G+ + I +    + +  +P+ L    +   SA G IK 
Sbjct: 252 SSLTGIDFNVMPKAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIK- 305

Query: 330 RSEMGGLIKDYQSGTLKV 347
             E+  L+K      +K+
Sbjct: 306 --ELKQLLKLVSENDIKI 321

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 102/254 (40%), Gaps = 65/254 (25%)

Query: 33  KAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVI 92
           K +E+ IK     + H D  S         FP V G E SGIV         V+ G+ V 
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIV---------VRRGEKV- 121

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                   + KF L G+  +  +                         Y  +  STF +Y
Sbjct: 122 -------DEEKFPLGGEVFIASTT------------------------YRDLRTSTFQEY 150

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTA--------NI----QKGDTVAV 200
           TV        FD  + +     +G    +G G ++ TA        N+    ++  ++ +
Sbjct: 151 TV--------FDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVI 202

Query: 201 FGAGT-VGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKL 259
           +G  T VG+ VVQ AKS G +KII +  +   + +    GAT  ++ +E   +EDIV+++
Sbjct: 203 WGGSTGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREE--KTEDIVNEI 259

Query: 260 IEMTDGGLDFTFDC 273
            ++   G+    D 
Sbjct: 260 KKICPNGVSHGVDL 273

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 86/359 (23%), Positives = 138/359 (38%), Gaps = 40/359 (11%)

Query: 17  EANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVE 76
           E NK   +    V   K H+  +KI    +CH+D   L G  P       +GHE  G + 
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQR-YAMGHEICGELV 151

Query: 77  SIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKD 136
              AD     VG+    +  A CG C  C  G  + C +     G+     G      +D
Sbjct: 152 QTYADEPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTA----NGEKACGLGQCYGIGRD 207

Query: 137 GKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPT--ALLGCGVTTGYGAAIKTANIQK 194
           G           +++Y  +    LV   K +  +P   A+    V T Y A        K
Sbjct: 208 G----------GYAEYIAIDLRHLVKVPKELVNKPEICAVATDAVLTPYHAIKNIPGFAK 257

Query: 195 GD--TVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDS 252
                  V G G +GL+ +Q A + G S++I VD  + +   + E GA            
Sbjct: 258 TPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA------------ 304

Query: 253 EDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQ 312
           E +  +L      G+D   D  G+ + + +A+    K  G   ++G++AAG EI      
Sbjct: 305 EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAGYEIRFPALS 363

Query: 313 LVTGRVWRG--SAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHN 369
            + G+      S +G    + E+  LI        KV   +T    FT++ +  E++  
Sbjct: 364 YMLGKEISMIYSFWGTTSDQKEVLDLI-----AAGKVMPQVTSYSLFTDLPSKIEEMRE 417

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 70/347 (20%), Positives = 128/347 (36%), Gaps = 73/347 (21%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIAL 94
           +E+ IK     + + ++Y   G+ P    P VLG E SG+V + G               
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKG--------------- 102

Query: 95  YTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTV 154
                                           D  T+F   D      ++  +TF+QYT 
Sbjct: 103 --------------------------------DAVTKFDVNDK---VAYLSSNTFAQYTK 127

Query: 155 VADVSLVAFDKSVSFEPTALLGCG----VTTGYGAAIKTANIQKGDTVAVFGAGTVGLSV 210
           +++   V+     S +    L  G      T      +   ++KGD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG-GLDF 269
                 +  +  I V   ++K   + E+GA   +N       +D++++++E+T+G G++ 
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLIN----SSKDDVLARVLEITNGQGVEA 243

Query: 270 TFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTG---RVWRGSAFGG 326
            FD  G  +    +L+A  +   +  ++    A   +      ++T    ++ R S FG 
Sbjct: 244 AFDSVGK-DTFETSLKALKR---KGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLFGY 299

Query: 327 IKGRSEM----GGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHN 369
           I    E       L     SG LK+   I+   P  E N A E L +
Sbjct: 300 IATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 75/161 (46%), Gaps = 23/161 (14%)

Query: 150 SQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGA-GTVGL 208
           ++Y VV++ ++    K+V+F   A LG  +TT    A++ A ++  D V+V GA G+VG 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSED-IVSKLIEMTDG-G 266
            VVQ A+S G   +                      +P ++  +ED   S L  +T G G
Sbjct: 110 YVVQLAQSMGCRVLRAARQ-----------------SPTDVCIAEDEEFSALTSLTQGRG 152

Query: 267 LDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIA 307
           +D   D  G   +M+ A E    G   ++I   A  G E+A
Sbjct: 153 VDVVIDTVGMPALMKAAAEKLAHGGRMAVI--SARYGAELA 191

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 130/310 (41%), Gaps = 32/310 (10%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-I 92
           H+V IKI    VC +D +  +G   +   P V+GHE  G V  +G+   + ++VG  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 93  ALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQY 152
                 C +C  C S     C     T G+            +DG     ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYGQPY----------EDG-----YVSQGGYADY 138

Query: 153 TVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT--ANIQKGDTVAVFGAGTVGLSV 210
             V +  +V   +++     A L CG  T Y   ++      +K   V   G G++G  +
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGSMGTLI 198

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFT 270
              AK+ GA +  V+  ++ K++ + + GA  ++   E    E+   K  +  D  +   
Sbjct: 199 ---AKAMGA-ETYVISRSSKKREDAMKMGADHYIATLE---EENWGEKYFDTFDLIVVCA 251

Query: 271 FDCTG-NVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKG 329
              TG + +VM  A+    K  G+ + I +    + +  +P+ L    +   SA G IK 
Sbjct: 252 SSLTGIDFDVMPKAM----KVGGRIVSISIPEQHEVLTLKPYGLKAVSI-SYSALGSIKE 306

Query: 330 RSEMGGLIKD 339
             ++  L+ +
Sbjct: 307 LKQLLKLVSE 316

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 68/172 (39%), Gaps = 19/172 (11%)

Query: 17  EANKPLTVTEIVVDPPK---AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSG 73
           +++K     E VV P K     +V I+I    VC +D +   G   E   P V+GHE  G
Sbjct: 14  DSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHEIIG 73

Query: 74  IVESIGADV-TNVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTR 131
            V  +G    T +KVGD V +    + C  C  C +     C     T  +    DG   
Sbjct: 74  KVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG--- 130

Query: 132 FHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183
                      ++G   ++ +  V +  ++   +S+     A L CG  T Y
Sbjct: 131 -----------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVY 171

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 70/154 (45%), Gaps = 25/154 (16%)

Query: 141 YHFMGCSTFSQYTVVADVSLV-----------AFDKSVSFEPTALLGCGVTTGYGAAIKT 189
           Y  +  STF +YTV  D  LV              K    E  A +G G+ T  G+AI +
Sbjct: 138 YRDLETSTFQEYTVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISS 195

Query: 190 ---------ANIQK-GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFG 239
                    A+ QK G+ V   G+ +VGL V+Q AK+    + IVV   +  K++  E G
Sbjct: 196 LVDLSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELG 255

Query: 240 ATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDC 273
           A+  ++  +    E+I+  ++     G+DF  D 
Sbjct: 256 ASCIIDRHQ--SEEEILDDILSHCPEGIDFGIDV 287

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 121/317 (38%), Gaps = 51/317 (16%)

Query: 7   PITCTAAIAYEANKPLTVTEIVVDPPKA--HEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64
           P+   AA+     + + V++ +  P +   HE+ I+   T + H D  S         FP
Sbjct: 42  PLFQQAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFP 101

Query: 65  CVLGHEGSGIVESIGADVTNVK--VGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGK 122
            + G E SGIV   GA V   +  +G  V    T             T     +     +
Sbjct: 102 WINGRESSGIVVRRGAKVDRDRFPIGAEVFLASTCYRELKTSTFQEFTVFDSRLVWRLPR 161

Query: 123 GVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTG 182
            ++PDGTTR                                 K    +  A +G  + T 
Sbjct: 162 EILPDGTTR---------------------------------KRFGLDFAAGVGVPLVTA 188

Query: 183 YGAAIKT-------ANIQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDW 234
            G+A+ +           +G ++ V+G + +VG+  +Q A++ G  K I+   +   +D+
Sbjct: 189 -GSALSSFVDFNEIGKADQGRSLVVWGGSSSVGIFTIQLARNLGIFKNIIAVSSLRYEDY 247

Query: 235 SFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWG-- 292
             E GAT  ++      SE++V K  E+   G+D+  D           LE    G G  
Sbjct: 248 LKELGATAVID--RTLPSEELVQKFQELCPTGVDYGVDVISK-KTAELVLEILKDGKGTK 304

Query: 293 QSIIIGVAAAGQEIATR 309
           +S++    A G+++  +
Sbjct: 305 KSLVCLSGAPGEDVRAK 321

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 131/321 (40%), Gaps = 46/321 (14%)

Query: 31  PPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN--VKVG 88
           P   H+V IKI    VC +D +  +G       P V+GHE  G V  +G D +N  +KVG
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLG-DKSNSGLKVG 88

Query: 89  DHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCS 147
             V +      C +C  C S     C     T  +            +DG     ++   
Sbjct: 89  QRVGVGAQVFSCLECDRCKSDNEPYCTKFVTTYSQPY----------EDG-----YISQG 133

Query: 148 TFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT--ANIQKGDTVAVFGAGT 205
            ++ Y  V +  +V   ++V     A L CG  T Y   ++      +K   V + G G+
Sbjct: 134 GYANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGS 193

Query: 206 VGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG 265
           +G  +   +K+ GA +  V+  ++ KK+ + + GA  ++               +E  D 
Sbjct: 194 MGTLI---SKAMGA-ETYVISRSSKKKEDAIKMGADHYI-------------ATLEEGDW 236

Query: 266 GLDF--TFD----CTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRV 318
           G  +  TFD    C  ++ ++  N +    K  G+ + I +    + +  +P+ L    +
Sbjct: 237 GEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI 296

Query: 319 WRGSAFGGIKGRSEMGGLIKD 339
              SA G IK   ++  L+ +
Sbjct: 297 -SYSALGSIKELKQLLALVSE 316

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 139/347 (40%), Gaps = 47/347 (13%)

Query: 4   VGKPITCTAAIAYEANKPLTVTEI-VVD-------------PPK--AHEVRIKIVKTAVC 47
           +  P+ C A    E +  +    I VVD             PP     ++ ++I    VC
Sbjct: 2   ISSPLQCNAIDFQEMDTQVKFDAIGVVDFDQWKKPEKFSYSPPLLGPEDIELEIEACGVC 61

Query: 48  HTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVK--VGDHV-IALYTAECGKCKF 104
            +D +++SG       P  +GHE  G + ++GA V   K  +GD V +   T  CG C  
Sbjct: 62  GSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQVNKEKFHLGDRVGVGAQTNSCGDCTR 121

Query: 105 CLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFD 164
           C   +   C     T       D    F  + G    H    S F     + D    A D
Sbjct: 122 CSRDRQQNCKKSVLTY---TCVDERNGFETQGGYA-SHIRANSGF--VFKIPD----ALD 171

Query: 165 KSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIV 224
            +V+    A L CG  TG+   + T  +++G  + V G G +G   +  AK+ GA ++  
Sbjct: 172 SAVA----APLLCGGITGFRPLL-TGGVKEGSKLGVVGIGGIGHMSILFAKALGA-EVTA 225

Query: 225 VDLNNDKKDWSFEFGATDFV--NPKELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRN 282
           +  +N K D + + GA  F+  + ++ +D+      LI MT            N+  + +
Sbjct: 226 ISRSNRKFDDAKKLGADHFLAMSDEKSRDAHAESLDLIVMTASSFS-----ESNIEELLS 280

Query: 283 ALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW-RGSAFGGIK 328
            L A     G+ I I      +++A  PF ++       GSA G  K
Sbjct: 281 LLVAG----GKFIFITAPPIQEKMALTPFTMLLNEYQVSGSAIGSPK 323

>Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]
           {ON} YCR105W - Hypothetical ORF [contig 261] FULL
          Length = 364

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 124/304 (40%), Gaps = 29/304 (9%)

Query: 31  PPK--AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVK-- 86
           PP     ++ ++I    VC +D +++SG       P  +GHE  G + ++GA V   K  
Sbjct: 28  PPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQVNKEKFH 87

Query: 87  VGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMG 145
           +GD V +   T  CG C  C   +   C     T       D    F  + G    H   
Sbjct: 88  LGDRVGVGAQTNSCGGCTRCSRDRQQNCKKSVLTY---TCVDERNGFETQGGYA-SHIRA 143

Query: 146 CSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGT 205
            S F     + D    A D +V+    A L CG  TG+   + T  +++G  V V G G 
Sbjct: 144 NSEF--VFKIPD----ALDSAVA----APLLCGGITGFRPLL-TGGVKEGSKVGVVGIGG 192

Query: 206 VGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDG 265
           +G   +  AK+ GA ++  +  +N K D + + GA  F+   + K  E     L  +   
Sbjct: 193 IGHMSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFLAMSDEKSREAHAESLDLIVMT 251

Query: 266 GLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW-RGSAF 324
              F+     N+  + + L A     G+ I I      +++A  PF ++       GSA 
Sbjct: 252 ASSFS---ESNIEELLSLLVAG----GKFIFITAPPIQEKMALTPFTMLLNEYQVSGSAI 304

Query: 325 GGIK 328
           G  K
Sbjct: 305 GSPK 308

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 109/292 (37%), Gaps = 35/292 (11%)

Query: 35  HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPC----------VLGHEGSGIVESIGADVTN 84
           H++ I++    +C ++ +SL          C          V+GHE  G V  +G  VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 85  VKVGDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHF 143
            K+G  V +    + C +C  C S     C     T      PDG    +   G    H 
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYCSR-YPDG----YVSQGGYASHV 152

Query: 144 MGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGA 203
                F  + +  DV   AF         A L CG  T Y    +     +   V + G 
Sbjct: 153 RAHEQFC-FPIPDDVP-SAF--------VAPLMCGGLTVYSPIKRNIEGVEKPKVGIIGI 202

Query: 204 GTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMT 263
           G +G   +  AK+ GA ++     +N KKD + + GA  FV   E    E+  S+L +  
Sbjct: 203 GGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATGE---EENWSSRLAD-- 256

Query: 264 DGGLDFTFDCTGNVNVMR-NALEACHKGWGQSIIIGVAAAGQEIATRPFQLV 314
                   +C  +   +  NA  +  K   Q + +G+   G+     PF  +
Sbjct: 257 --NFHLVLNCASSTTSLDLNAFVSILKVNCQLVSVGLPEKGETFDLSPFTFI 306

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 84/353 (23%), Positives = 140/353 (39%), Gaps = 38/353 (10%)

Query: 26  EIVVDPPKAHE--VRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVT 83
           +I  DP K  +  V IKI    VC +D +  S          V+GHE  G V  +G    
Sbjct: 23  KISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKCK 82

Query: 84  -NVKVGDHV-IALYTAECGKCKFCLSGKTNLCGSV-RATQGKGVMPDGTTRFHDKDGKPI 140
             +KVGD V +      C  CK C S     C S  R     G   DG            
Sbjct: 83  LGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDG------------ 130

Query: 141 YHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAV 200
             ++    ++ +    +  +     ++  E  A L CG  T +   ++      G  V V
Sbjct: 131 --YVSQGGYASHVRTHEHFVFKIPDNIPTELAAPLLCGGVTVFSPLLRNG-CGPGKKVGV 187

Query: 201 FGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLI 260
            G G +G   +  AK+ GA ++  +  ++ KK+ S + GA  ++  +E KD     +   
Sbjct: 188 VGIGGIGHMGILFAKAMGA-EVYAISRSSSKKEDSLKLGADYYIATQEEKDWATTYADT- 245

Query: 261 EMTDGGLDFTFDCTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW 319
                 LD    C  ++ ++  + L A     G+ + I +  A Q++  +PF L+ G   
Sbjct: 246 ------LDLIVLCASSLSDINIDDLVATMTIGGKIVSIAIPDASQQLTLKPFGLL-GVYI 298

Query: 320 RGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE--INAAFEDLHNG 370
             SA G  K   ++  L+ +      K+  ++    P +E  +N  FE +  G
Sbjct: 299 SNSALGSRKEIIQLLDLVSEK-----KIKPWVQ-TVPISEAGVNEVFERMEKG 345

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 74/345 (21%), Positives = 134/345 (38%), Gaps = 36/345 (10%)

Query: 31  PPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TNVKVGD 89
           P   ++V I+I    VC +D +  +G   +   P V+GHE  G V  +G    T VK+GD
Sbjct: 30  PFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKCHTGVKIGD 89

Query: 90  HV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCST 148
            V +      C KC  C S     C     T  +            +DG     ++    
Sbjct: 90  RVGVGAQVYSCLKCDRCKSDNEPYCPKFVTTYSQPY----------EDG-----YVSQGG 134

Query: 149 FSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGL 208
           ++ +    +  ++   +++     A L CG  T Y    +           V   G   +
Sbjct: 135 YASHIRCHEHFVIPIPENIPTHLAAPLLCGGITVYSPLSRNGCGPGKKVGIVGIGGIGHM 194

Query: 209 SVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLD 268
            ++  AK+ GA ++  +  ++ KK+ + + GA  F+  KE    E+   K  +      D
Sbjct: 195 GLI-FAKAMGA-EVYAISRSSAKKEDASKLGADHFIATKE---EENWSQKYFDT----FD 245

Query: 269 FTFDCTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGI 327
               C  ++ +V  + +    K  G+ + I V    + +  +P  L+   +    +  G+
Sbjct: 246 LVVVCASSLTDVDFDKMSRVMKIGGKIVSISVPEQSERLVLKPLGLLGVSI----SNSGL 301

Query: 328 KGRSEMGGLIKDYQSGTLK--VDEFITGRRPFTEINAAFEDLHNG 370
             R E+  L++      LK  V+    G +   E   AFE +  G
Sbjct: 302 GSRKEIIQLLQLVSEKNLKIWVETLPVGEKGVRE---AFERMDKG 343

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 31  PPK--AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVK-- 86
           PP     ++ ++I    VC +D ++++G       P  +GHE  G + ++G  V   K  
Sbjct: 28  PPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQVNKEKFH 87

Query: 87  VGDHV-IALYTAECGKCKFCLSGKTNLC 113
           +GD V +      CGKC  C  G+   C
Sbjct: 88  LGDRVGVGAQIDSCGKCTRCSRGRQQNC 115

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 74/351 (21%), Positives = 143/351 (40%), Gaps = 48/351 (13%)

Query: 31  PPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGD 89
           P   H++ IKI    VC +D +  +G       P V+GHE  G V  +G    + +KVG 
Sbjct: 30  PFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQ 89

Query: 90  HV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCST 148
            V +      C +C  C +     C     T  +            +DG     ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPY----------EDG-----YVSQGG 134

Query: 149 FSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT--ANIQKGDTVAVFGAGTV 206
           ++ Y  V +  +V   +++     A L CG  T Y   ++      +K   V + G G++
Sbjct: 135 YANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 207 GLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGG 266
           G  +   +K+ GA +  V+  ++ K++ + + GA  ++               +E  D G
Sbjct: 195 GTLI---SKAMGA-ETYVISRSSRKREDAMKMGADHYI-------------ATLEEGDWG 237

Query: 267 LDF--TFD----CTGNV-NVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVW 319
             +  TFD    C  ++ ++  N +    K  G+ + I +    + ++ +P+ L    + 
Sbjct: 238 EKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI- 296

Query: 320 RGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNG 370
             SA G IK  +++  L+ + +   + V+    G      ++ AFE +  G
Sbjct: 297 SYSALGSIKELNQLLKLVSE-KDIKIWVETLPVGE---AGVHEAFERMEKG 343

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 85/214 (39%), Gaps = 19/214 (8%)

Query: 33  KAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TNVKVGDHV 91
           K  +V I+I    VC +D +  SG   E     V+GHE  G V  +G +  T +K+GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 92  -IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFS 150
            +    A C  C+ C       C     T  +   PDG              ++    ++
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYA 136

Query: 151 QYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSV 210
            +  V +  ++   + +     A L CG  T Y   ++           V   G   + +
Sbjct: 137 SHIRVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGI 196

Query: 211 VQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           +  AK+ GA ++     + +K++ S + GA  ++
Sbjct: 197 L-FAKAMGA-EVYAFSRHENKREDSMKLGADHYI 228

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 92/232 (39%), Gaps = 30/232 (12%)

Query: 32  PKA---HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TNVKV 87
           PKA   H+V I+I    VC +D ++ +    E     V+GHE  G +  +G +  + +K+
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 88  GDHV-IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGC 146
           GD V +   +  C +C  C       C    +T           R +D DG     ++  
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVSTY---------NRPYD-DG-----YISQ 138

Query: 147 STFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKT---ANIQKGDTV-AVFG 202
             ++ +  + +   +     +  E  A L CG  T +   ++     N +   +V  V G
Sbjct: 139 GGYASHVRLHEHFAIPVPDEIPSELAAPLMCGGITVFSPLLRNGCGPNKKLASSVLVVLG 198

Query: 203 AGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSED 254
                L    GA+    S+       N K++ S   GA  ++   E KD E+
Sbjct: 199 IWAYCLLRQVGAEVYAFSR------TNSKREDSVNLGADHYIATMEEKDWEE 244

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 33.1 bits (74), Expect = 0.33,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 36  EVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTN-VKVGDHV-IA 93
           +V IK+    VC +D +  +G       P V GHE  G +  +G+  ++ +KV   V + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 94  LYTAECGKCKFCLSGKTNLC 113
             T  C KC  C  G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 13/98 (13%)

Query: 30  DPPK--AHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPC----------VLGHEGSGIVES 77
           +P K  AH+V I++    +C ++ +SL          C          V+GHE  G V +
Sbjct: 29  EPKKFDAHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVA 88

Query: 78  IGADVTNVKVGDHV-IALYTAECGKCKFCLSGKTNLCG 114
           +G  V+  KVGD + +    + C  C  C       C 
Sbjct: 89  VGDKVSLCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 186 AIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244
           A++   ++ GD V V     +GL V    +  G  K++++    D K  S +FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMS-TQDSKKQSEQFGGTGFI 68

>Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)
          Length = 212

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 193 QKGDTVAVFGAGT-VGLSVVQGAKS-RGASKIIVVDLNNDKKDWSFEFGATDFVNPKELK 250
           Q+   V ++G  T VG  V+Q AK   G +KIIVV     +K    E+GA       EL 
Sbjct: 9   QRDHPVLIWGGATAVGQHVIQLAKKLNGFTKIIVVASQKHEKQLK-EYGAD------ELF 61

Query: 251 DSEDI-VSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSII 296
           D  D  V + I+     + +  DC  NV+ ++   +        +II
Sbjct: 62  DYHDADVVEQIKKKYKNIPYLVDCVANVDTLQQVYKCAADELDATII 108

>YCR102C Chr3 complement(304361..305467) [1107 bp, 368 aa] {ON}
           Putative protein of unknown function, involved in copper
           metabolism; similar to C. carbonum toxD gene; member of
           the quinone oxidoreductase family
          Length = 368

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 14/119 (11%)

Query: 171 PTALLGCGVTTGYGAAI----KTANIQKGDTVAVFGAGT-VGLSVVQGA-KSRGASKIIV 224
           P +L   G+   Y   +    + +  Q+   + ++G  T VG S++Q A K  G +KIIV
Sbjct: 139 PVSLTTAGLVLTYNLGLNLKWEPSTPQRNGPILLWGGATAVGQSLIQLANKLNGFTKIIV 198

Query: 225 VDLNNDKKDWSFEFGATDFVNPKELKDSEDI-VSKLIEMTDGGLDFTFDCTGNVNVMRN 282
           V     +K    E+GA       +L D  DI V + I+     + +  DC  N N ++ 
Sbjct: 199 VASRKHEKLLK-EYGA------DQLFDYHDIDVVEQIKHKYNNISYLVDCVANQNTLQQ 250

>TDEL0A06330 Chr1 (1108746..1110917) [2172 bp, 723 aa] {ON}
           Anc_8.688 YPL164C
          Length = 723

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 10/71 (14%)

Query: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKA----------HEVRIKIVKTAVCHTD 50
           + +VG+P TC A I  +   PL   +++ DP K           H + +K+V++ + H  
Sbjct: 307 VKSVGRPYTCHALIIIDIRCPLVTDDLMQDPSKKILLSSQADVIHPLILKVVESFLSHQG 366

Query: 51  AYSLSGVDPEG 61
               S V  +G
Sbjct: 367 YVPFSHVTADG 377

>YLR460C Chr12 complement(1059757..1060887) [1131 bp, 376 aa] {ON}
           Member of the quinone oxidoreductase family,
           up-regulated in response to the fungicide mancozeb;
           possibly up-regulated by iodine
          Length = 376

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 52/119 (43%), Gaps = 14/119 (11%)

Query: 171 PTALLGCGVTTGYGAAI-----KTANIQKGDTVAVFGAGTVGLSVVQGA-KSRGASKIIV 224
           P +L   G+   Y   +      +   +KG  +   GA  VG S++Q A K  G +KIIV
Sbjct: 147 PVSLTTAGLVLTYNLGLDLKWEPSTPQRKGPILLWGGATAVGQSLIQLANKLNGFTKIIV 206

Query: 225 VDLNNDKKDWSFEFGATDFVNPKELKDSEDI-VSKLIEMTDGGLDFTFDCTGNVNVMRN 282
           V     +K    E+GA       EL D  DI V + I+     + +  DC  N + ++ 
Sbjct: 207 VASRKHEKLLK-EYGAD------ELFDYHDIDVVEQIKHKYNNISYLVDCVANQDTLQQ 258

>KLTH0F01056g Chr6 complement(80904..83219) [2316 bp, 771 aa] {ON}
           similar to uniprot|P25574 Saccharomyces cerevisiae
           YCL045C
          Length = 771

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 221 KIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCT 274
           KI V+D+ + ++ W++E G  D +N + L+   ++V      T  G   TFD T
Sbjct: 339 KIAVLDVRDGRQLWNYESGLKDILNIEALRSDTEVVI----FTKSGPSLTFDIT 388

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 31  PPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADV-TNVKVGD 89
           P  +H+V I+I    VC +D +  +    E     V+GHE  G V  +G +  T +K+GD
Sbjct: 30  PFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGRVVKVGPECNTGLKLGD 89

Query: 90  HV-IALYTAECGKCKFCLSGKTNLC 113
            V +      C +C  C       C
Sbjct: 90  RVGVGAQVFSCLECDRCKEDNEPYC 114

>Kpol_1032.71 s1032 (157929..159017) [1089 bp, 362 aa] {ON}
          (157929..159017) [1089 nt, 363 aa]
          Length = 362

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 21 PLTVTEIVVDPPKAH---EVRIKIVKTAVCHTD--AYSLSGVDPEGLFPCVLGHEGSGIV 75
          PLT+T   +D  + +   E+ +++   A+   D   ++LS     G    VLG + SG+V
Sbjct: 15 PLTITSEEIDLDRCYKDSEIVVEVHAAALNPIDILLHALSYPSISGRKKKVLGKDYSGVV 74

Query: 76 ESIGADVTNVKVGDHVIALY 95
             G  V   KVGD V  +Y
Sbjct: 75 VKAGKSVKGFKVGDLVNGMY 94

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,437,782
Number of extensions: 1600798
Number of successful extensions: 4190
Number of sequences better than 10.0: 197
Number of HSP's gapped: 4038
Number of HSP's successfully gapped: 213
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)