Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029607.349ON65465428110.0
Kpol_530.327.349ON68442111211e-144
TDEL0C019907.349ON60639510871e-140
ZYRO0F11682g7.349ON59739110621e-136
Kwal_56.246387.349ON5273939941e-127
YDL167C (NRP1)7.349ON71940410071e-126
SAKL0F11352g7.349ON5833929911e-126
Skud_4.907.349ON7074069991e-125
ACL149W7.349ON6283889901e-125
TBLA0E020607.349ON5643939821e-125
Suva_4.797.349ON7084099931e-124
KLTH0H01276g7.349ON5574199781e-124
Smik_4.717.349ON7594059941e-124
NCAS0A141507.349ON5703989681e-122
KNAG0C037807.349ON5383909461e-120
KAFR0B008707.349ON5423969431e-119
KLLA0D12364g7.349ON6314079361e-117
NDAI0A019007.349ON5653887511e-90
CAGL0I03344g7.349ON6033206055e-69
KLLA0B08976g3.379ON30536940.008
Kpol_1039.503.379ON296165920.013
YNL110C (NOP15)2.167ON22037780.50
KNAG0I015901.357ON590127790.64
KAFR0B045402.167ON22035770.65
Ecym_54192.167ON21535760.86
Suva_14.2292.167ON22237751.2
SAKL0E10604g2.167ON22136741.5
Ecym_25418.491ON67523733.4
SAKL0H17952g8.229ON58950724.5
YAR007C (RFA1)4.120ON62175698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02960
         (654 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...  1087   0.0  
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   436   e-144
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   423   e-140
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   413   e-136
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   387   e-127
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   392   e-126
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   386   e-126
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   389   e-125
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   385   e-125
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   382   e-125
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   387   e-124
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   381   e-124
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   387   e-124
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   377   e-122
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   369   e-120
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   367   e-119
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   365   e-117
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   293   1e-90
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   237   5e-69
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    41   0.008
Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [89...    40   0.013
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    35   0.50 
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    35   0.64 
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    34   0.65 
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    34   0.86 
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    33   1.2  
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    33   1.5  
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    33   3.4  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    32   4.5  
YAR007C Chr1 complement(156754..158619) [1866 bp, 621 aa] {ON}  ...    31   8.9  

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/654 (82%), Positives = 539/654 (82%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
           DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM 180
           FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM 180

Query: 181 DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP 240
           DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP
Sbjct: 181 DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP 240

Query: 241 PDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGFAVFQ 300
           PDTTQSELESWFAQFGIKPARLWTVRNILE              PYVEEHDSISGFAVFQ
Sbjct: 241 PDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYVEEHDSISGFAVFQ 300

Query: 301 THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP 360
           THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP
Sbjct: 301 THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP 360

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAAXXXXXXXXXXXXXXXXRKYXXXXXXXXXXXX 420
           RPGDWNCMSCGFSNFQRRTSCFRCSFPAA                RKY            
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAATSNNGNGTNVNNTINTRKYNNGNNENSLNSA 420

Query: 421 XXXTMNSYSLNQYQLDNKDRISTDIHSPMDXXXXXXXXXXXXXXXAGNNILTQXXXXXXX 480
              TMNSYSLNQYQLDNKDRISTDIHSPMD               AGNNILTQ       
Sbjct: 421 NKNTMNSYSLNQYQLDNKDRISTDIHSPMDSSNYNNMGIYGGNISAGNNILTQNSNMIMN 480

Query: 481 XXXXXXXXXXXXXLTGNIGYSLNNGHTNNQYRYNHNNHLGFXXXXXXXXXXXXXXXXXXX 540
                        LTGNIGYSLNNGHTNNQYRYNHNNHLGF                   
Sbjct: 481 NVNNHNLLSNYDNLTGNIGYSLNNGHTNNQYRYNHNNHLGFQNNAYNANNNRYSNQGNGL 540

Query: 541 XXXXXXVPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGH 600
                 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGH
Sbjct: 541 NNGGSNVPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGH 600

Query: 601 SNHKSQYNDHEKMGSNNRVDXXXXXXXXXXEDLHDKNINKEYYIDNKKHNNSFV 654
           SNHKSQYNDHEKMGSNNRVD          EDLHDKNINKEYYIDNKKHNNSFV
Sbjct: 601 SNHKSQYNDHEKMGSNNRVDTPTSSSTVSSEDLHDKNINKEYYIDNKKHNNSFV 654

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  436 bits (1121), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 220/421 (52%), Positives = 276/421 (65%), Gaps = 43/421 (10%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           MYYI +ET+TLH +ETPKDHT+I  LSYQ ++ E    L     K++V ++S+ D  A  
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAE---SLECYYGKDEVKVISIDDESA-- 55

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
             ++FKD+I+Q   +++  +G++E V CSLNS WDLRVTIPRQ+ DE + LP +L+   +
Sbjct: 56  --ISFKDMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKV 113

Query: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSE------------LYKILEINQNSD----- 163
           FDLWKE+ RW   H   +   K+K  +D  E              +  EI +NSD     
Sbjct: 114 FDLWKEFNRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEV 173

Query: 164 -AKTNNEKLNDRSGNINMDRGYKKN--------------DVRSTVDVFMAIVDKCSTPED 208
            A T  E+    SGN  +      +              ++    ++   I  KC+T ED
Sbjct: 174 HANTGAEE----SGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEED 229

Query: 209 HESVLTHPYNSNVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNI 268
              VLT PY+SN DF+ F +E SK++YMNNLPPDTTQSELESWFAQFG KP   WTV+NI
Sbjct: 230 ITLVLTKPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNI 289

Query: 269 LEXXXXXXXXXXXXXXPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRV 328
           +E              PYVEE DSISGF  FQ+HKEATDALLLNGRSILSNMANTKQPRV
Sbjct: 290 VEETSNVNNNWSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRV 349

Query: 329 VEHIVELQPSSMVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           VEHIVE+QPSS+ +LER+Q+IS+ FPQSKNKPRPGDWNCMSCGFSNFQRRT+CFRCS+PA
Sbjct: 350 VEHIVEIQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPA 409

Query: 389 A 389
           A
Sbjct: 410 A 410

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (78%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNS 593
           VPFRAGDWKC ACSYHNFAKN+VCLRCGGPK+     D+N    +NS
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTMNNS 586

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389
           R GDW C++C + NF +   C RC  P +
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 17/34 (50%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILN 583
           R GDW C +C + NF +   C RC  P     LN
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLN 415

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  423 bits (1087), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 207/395 (52%), Positives = 272/395 (68%), Gaps = 34/395 (8%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E E  H+IE PKDH ++  LSYQ I+ E  +    D   + + ++SL    +  
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYAD---DQIPLISLDQQGS-- 55

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
             ++F++ I +F R+V   +G +E VLCSL STW +RVTIPRQ+ DEG +LPS+L+ P +
Sbjct: 56  --ISFQESIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRV 113

Query: 121 FDLWKEYQRWCNLHFSEINTMK------TKKYKDSSELYKILEINQNSDAKTNNEKLNDR 174
           FDLWKEY RWC  H  E+ T++       K+ KD +E+ K+LE++         E++ ++
Sbjct: 114 FDLWKEYDRWCANH-PEVLTLRKSCRTGIKRVKDQTEILKVLEMS--------TEEITEK 164

Query: 175 SGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKII 234
                   GY       TVD+ + + ++C+T ED   VL+ PY+S++D + F+QE SK++
Sbjct: 165 PV-----LGY-------TVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVL 212

Query: 235 YMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSIS 294
           Y+NNLPPDTTQSELESWF QFG +P   WTV+NI+E              PYVEE DSIS
Sbjct: 213 YLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSIS 272

Query: 295 GFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFP 354
           GF VFQTH+EAT+ L+LNGRSILSNMANTKQPRVVEHIVE+QPSS  +L+R QEI S FP
Sbjct: 273 GFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFP 332

Query: 355 QSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389
           QSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPAA
Sbjct: 333 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAA 367

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (83%)

Query: 548 PFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           PFRAGDWKC  C+YHNFAKN+VCLRCG  K 
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKV 506

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNS 593
           R GDW C +C + NF +   C RC  P   A+  +  + M++N 
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNG 382

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCS 385
           R GDW C +C + NF +   C RC 
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRCG 502

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  413 bits (1062), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 205/391 (52%), Positives = 260/391 (66%), Gaps = 30/391 (7%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           MYY+ +E ET H IE PKD  +I  +SYQ +N E  + + Y   +  + I+S  DS    
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQ-VHYQENQAPLHIISENDST--- 56

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
                 + +   +  + +  G+E  VLCSLNSTW LRVT+ RQ+ D+   LPS+L+ P I
Sbjct: 57  ---NLHEAVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKI 113

Query: 121 FDLWKEYQRWCNLHFSEINTMKT---KKYKDSSELYKILEINQNSDAKTNNEKLNDRSGN 177
           FDLWKEY+RWC  H  E+  ++    ++ KD +EL ++L+IN            ND S  
Sbjct: 114 FDLWKEYERWCVNH-PEVMPLRKNGGRRMKDVAELARVLDIN--------GLNFNDSSF- 163

Query: 178 INMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMN 237
                     D+  +V++ + +  +CSTPED   VLTHPY+S++D + F+QE SK++Y+N
Sbjct: 164 ----------DLSRSVEILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLN 213

Query: 238 NLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGFA 297
           NLPPDTTQSELESWF QFG +P   WTV+NI+E              PYVEE DSISGF 
Sbjct: 214 NLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFV 273

Query: 298 VFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSK 357
           VFQTH+EAT+ L LNGRSILSNMANTKQPRVVEHIVE+QPSS  +L+R QEI S FPQSK
Sbjct: 274 VFQTHEEATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSK 333

Query: 358 NKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           NKPRPGDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 334 NKPRPGDWNCPSCGFSNFQRRTACFRCSFPA 364

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (88%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           VPFRAGDWKC +C YHNFAKN+VCLRCGGPK  A+
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAV 519

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           R GDW C +C + NF +   C RC  P T A+
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAV 368

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C SC + NF +   C RC  P
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGP 514

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  387 bits (994), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/393 (50%), Positives = 249/393 (63%), Gaps = 32/393 (8%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E +  H+ ++PKD +QI +  YQ ++ E   +L    ++N  ++L  G S+   
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTE---ELKSVFQENKHIVLENGCSLQEA 57

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
                KDI E            ++ VLCSLNSTW  RVTIPRQ+ DE  ILP  L+ P +
Sbjct: 58  VSQLEKDIGEHL---------KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRV 108

Query: 121 FDLWKEYQRWC-----NLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRS 175
           FDLWKEY RWC      L     N+M  KK KD +EL  +LE++  +   T         
Sbjct: 109 FDLWKEYDRWCVNHPETLALRRSNSMG-KKVKDVAELRSVLELDSATQDSTPG------- 160

Query: 176 GNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIY 235
                    + + +  T+ +   +  KC T ED   VLTHPY+S +D + F+QE SK++Y
Sbjct: 161 -------AAEPDALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLY 213

Query: 236 MNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISG 295
           MNNLPPDTTQSELESWF QFG +P   WTV+NI+E               YVE  DSISG
Sbjct: 214 MNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISG 273

Query: 296 FAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQ 355
           F VFQ+H+EAT+AL LNGRSILSN+ANTKQPRV+EHIVE+QPSS  +L+R QEI S FPQ
Sbjct: 274 FVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQ 333

Query: 356 SKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           SKNKPRPGDWNC SCGFSNFQRRTSCFRCSFP+
Sbjct: 334 SKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPS 366

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           VPFRAGDWKC+ C+YHNFAKN+VCLRCGGPK+
Sbjct: 452 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 483

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           R GDW C +C + NF +   C RC  P T
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPST 367

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RC  P
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGP 481

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  392 bits (1007), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 193/404 (47%), Positives = 259/404 (64%), Gaps = 38/404 (9%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E +  H  +TPKD  +I ++++Q++N E    L      N     SL     NG
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAE---TLVCHYGTN-----SLPSIEVNG 52

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
              + +  + Q  +++   IGN++ VL SL STW +RVT+PRQ+ D+G IL S+L+ P +
Sbjct: 53  TTKSLESAMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKV 112

Query: 121 FDLWKEYQRWC----------------NLHFSEINTMKTKKYKDSSELYKILEINQNSDA 164
           FDLWKE+ RWC                N +   I+    K  KD  E+ +ILE++  ++ 
Sbjct: 113 FDLWKEFDRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEE 172

Query: 165 KTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQ 224
             +  ++                 ++ T D+ + +  KC++PED ESVLT PY+S+ D +
Sbjct: 173 AGSVPEIYSL--------------LKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIR 218

Query: 225 TFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXX 284
            F+QE SKI+YMNNLPPDTTQSELESWF Q+G++P   WTV+NI+E              
Sbjct: 219 AFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNS 278

Query: 285 PYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILE 344
           PYVE+ DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++ELQPSS  +L+
Sbjct: 279 PYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLD 338

Query: 345 RIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           + QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 339 KAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPA 382

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           +PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576
           R GDW C +C + NF +   C RC  P
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RC  P
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  386 bits (991), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/392 (49%), Positives = 245/392 (62%), Gaps = 38/392 (9%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           MYY+ +E ET+H  E PKDHT++  + YQ I+ +  + +         +I+ +G      
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVF-----EQPIIVEVGPGQLRE 55

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
            +     ++       + T  N E  L SL+STW +RVTIPRQ+ DEG ILP +L+ P +
Sbjct: 56  QVAQLDQLVTS-----KITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKV 110

Query: 121 FDLWKEYQRWCNLHFSEINTMK----TKKYKDSSELYKILEINQNSDAKTNNEKLNDRSG 176
           FDLWKEY RWC  H   +   K     KK +D  EL ++LE    +              
Sbjct: 111 FDLWKEYDRWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQT-------------- 156

Query: 177 NINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYM 236
              +D+         T+ +   +  KC  PED   VLTHPY+S +D +TF+QE SK++YM
Sbjct: 157 -FPLDQ---------TIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYM 206

Query: 237 NNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGF 296
           NNLPPDTTQSELESWF QFG +P   WTV+N++E               YVEE DSISGF
Sbjct: 207 NNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGF 266

Query: 297 AVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQS 356
            VFQTH+EAT+AL LNGRSILSNMANTKQPRVVEH+VELQPSS  +L+R  E+ S FPQS
Sbjct: 267 VVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQS 326

Query: 357 KNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           KNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 327 KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPA 358

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 3/59 (5%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT---QAILNDMNKSMSHNSGQKYNGHSN 602
           VPFRAGDWKC +C+YHNFAKN+VCLRCGGPKT     + N  N  +    G   NG ++
Sbjct: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAS 555

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKS 588
           R GDW C +C + NF +   C RC  P T A+  ++NKS
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAV--NVNKS 367

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C+SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  389 bits (999), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 194/406 (47%), Positives = 260/406 (64%), Gaps = 40/406 (9%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E +  +  ++PKD  +I S++YQ+++ E      YD+        SL     +G
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAE-TLICHYDID-------SLPKIEVDG 52

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
           +  + +  + Q  +++   IGN+E VL SL STW +RVT+ RQ+ D+G IL S+L+ P +
Sbjct: 53  EAKSLESAMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRL 112

Query: 121 FDLWKEYQRWC------------------NLHFSEINTMKTKKYKDSSELYKILEINQNS 162
           FDLWKE+ RWC                  N      N    K  KD +E+ +ILE++  S
Sbjct: 113 FDLWKEFDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPS 172

Query: 163 DAKTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVD 222
           +      +              +++ +R T D+ + +  KCS+PED +SVLT PY+S  D
Sbjct: 173 EGADFIPE--------------EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTD 218

Query: 223 FQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXX 282
            +TF+QE SK++YMNNLPPDTTQSELESWF Q+G++P   WTV+NI+E            
Sbjct: 219 IRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLN 278

Query: 283 XXPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVI 342
             PYVEE DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++ELQPSS  +
Sbjct: 279 NSPYVEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGV 338

Query: 343 LERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           L++ QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 339 LDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPA 384

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           +PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           R GDW C +C + NF +   C RC  P    I
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389
           R GDW C +C + NF +   C RC  P +
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  385 bits (990), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 248/388 (63%), Gaps = 34/388 (8%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           MYY+  E +  HK +TPKDH ++  + YQLI+      L  D +  ++ +   G  MA G
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR--EIEVGGGGVQMATG 58

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
                     Q    +++   +E  VLCSL+STW LRVT+PRQ++DEG +LP FL    +
Sbjct: 59  ----------QLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKV 108

Query: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM 180
           FDLWKE  RWC  H SE       K  D +EL+++L+++         E+L        +
Sbjct: 109 FDLWKECDRWCANHVSERACNAGAK-GDVAELFRVLDLD---------EQL--------V 150

Query: 181 DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP 240
              Y +   R    V + + +KC+T ED   VLTHPY+S  D  +FIQE S+++YMNNLP
Sbjct: 151 SHAYIQQATR----VLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLP 206

Query: 241 PDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGFAVFQ 300
           PDTTQSELESWF QFG +P   WTV+N++E               YVEEHDSISGF VFQ
Sbjct: 207 PDTTQSELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQ 266

Query: 301 THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP 360
           +H+ A++AL LNGRSILSNMANTKQPRVVEH+VEL+PSS  +L+  QEI S FPQSKNKP
Sbjct: 267 SHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKP 326

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           RPGDWNC SCGFSNFQRR +CFRCSFPA
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPA 354

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPK------TQAILNDMNKS 588
           VPFRAGDWKC  CSYHNFAKNIVCLRCG PK      TQA L  ++ S
Sbjct: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSS 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           R GDW C +C + NF + I C RC  P T A+
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 356 SKNKP-RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           S N P R GDW C++C + NF +   C RC  P
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNP 530

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  382 bits (982), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 247/393 (62%), Gaps = 43/393 (10%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLIN-----VEYKEDLSYDVKKNDVVILSLGD 55
           MYY  +E +T H  E PKDHT+I+++SYQ IN       + +D    +   D   L L +
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDD---KIPNIDCTTLPLSE 57

Query: 56  SMANGDIMTFKDIIEQFSRNVEKTIGN-EEKVLCSLNSTWDLRVTIPRQSNDEGIILPSF 114
           S+A               +++E  + N E+ VLCSLNSTWDLRVTI RQ+ DE   LP+F
Sbjct: 58  SIA------------LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTF 105

Query: 115 LKLPIIFDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDR 174
            K P IFDLWKE+ RWC  H   + T   +K KD  +L  +L I        + E L+  
Sbjct: 106 FKYPRIFDLWKEFDRWCVNHKELVQTRDPRKLKDLKQLATLLHI-------PSVETLSS- 157

Query: 175 SGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKII 234
                         +     V + + +KC+T +D E VLT PY+S +D+  FI+ +S ++
Sbjct: 158 --------------ISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVL 203

Query: 235 YMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSIS 294
           YMNNLPPDTTQSELE+WF QFG++P   WTV+NILE              PYVEE DSIS
Sbjct: 204 YMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSIS 263

Query: 295 GFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFP 354
           GF VF THKEA D L LNG SILSN+ANTKQPRVVEH+VE+QPSS  ++ERIQ I + FP
Sbjct: 264 GFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFP 323

Query: 355 QSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           QSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFP
Sbjct: 324 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (87%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           VPFRAGDWKC  C YHNFAKNIVCLRC GPK+
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           R GDW C +C + NF +   C RC  P+ QA+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389
           R GDW C++CG+ NF +   C RCS P +
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  387 bits (993), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/409 (46%), Positives = 263/409 (64%), Gaps = 47/409 (11%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E +  H  ++PKD  +IV+++YQ+++ E       +     + +        +G
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDV--------DG 52

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
           +  + +  + Q  ++++  IGN++ VL SL STW +RVT+PRQ+ D+G IL S+L+ P +
Sbjct: 53  EKKSLESAMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRL 112

Query: 121 FDLWKEYQRWCNLHFSEINTMK------------------TKKYKDSSELYKILEIN--- 159
           FDLWKE++RWC ++  EI  ++                   K  KD +E+ +ILEI    
Sbjct: 113 FDLWKEFERWC-INHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTV 171

Query: 160 QNSDAKTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNS 219
           +  D   +N  L  R                 T+DV + +  KCS+ ED +SVLT PY+S
Sbjct: 172 EEDDFALDNHSLLQR-----------------TIDVLLQLHKKCSSAEDMKSVLTQPYDS 214

Query: 220 NVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXX 279
           + D ++F+QE SK++YMNNLPPDTTQSELESWF Q+G +P   WTV+NI+E         
Sbjct: 215 HTDIRSFLQERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNW 274

Query: 280 XXXXXPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSS 339
                PYVE+ DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++ELQPSS
Sbjct: 275 SLNNSPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSS 334

Query: 340 MVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
             +L++ QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 335 TGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPA 383

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           +PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576
           R GDW C +C + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RC  P
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP 589

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/419 (47%), Positives = 260/419 (62%), Gaps = 43/419 (10%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E E  H+ ++PKD +QI   +YQ ++ E  E +    ++N  V L        G
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPV---FEENKHVEL--------G 49

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
           +  T +D + Q  +++ +    ++ VLCSLNSTW  RVTIPRQ+ DE  ILP  L+ P +
Sbjct: 50  NGCTLQDAVAQLEKDISEH-AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKV 108

Query: 121 FDLWKEYQRWCNLHFSEINTMKT----KKYKDSSELYKIL-----EINQNSDAKTNN--E 169
           FDLWKEY RWC  H  E + M+     K+ KD +E+  +L     E   + DA  N   +
Sbjct: 109 FDLWKEYDRWCMNH-PETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQ 167

Query: 170 KLNDRSGNINMDRGY-------------------KKNDVRSTVDVFMAIVDKCSTPEDHE 210
              ++SG   +  G                    + + +   V +   +  KC T +D  
Sbjct: 168 SKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKS 227

Query: 211 SVLTHPYNSNVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILE 270
            VLTHPY+S +D + F+QE SK++YMNNLPPDTTQSELESWF QFG +P   WTV+NI+E
Sbjct: 228 LVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVE 287

Query: 271 XXXXXXXXXXXXXXPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVE 330
                          YVE  DSISGF VFQ+H+EAT+AL LNGRSILSN+ANTKQPRV+E
Sbjct: 288 ETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIE 347

Query: 331 HIVELQPSSMVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389
           HIVE+QPSS  +L+R QEI S FPQSKNKPRPGDWNC SCGFSNFQRRTSCFRCSFPAA
Sbjct: 348 HIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAA 406

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           VPFRAGDWKC+ C+YHNFAKN+VCLRCGGPK+
Sbjct: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576
           R GDW C +C + NF +   C RC  P
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFP 404

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RC  P
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGP 517

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  387 bits (994), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 262/405 (64%), Gaps = 39/405 (9%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E +  H   +PKD  +IV+++YQ ++ E    L+   + N     SL +   + 
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAE---TLACHYENN-----SLPNIEVDR 52

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
           +  + +  + Q  + ++  +GN+E VL SL STW +RVT+PRQ+ D+G IL S+L+ P +
Sbjct: 53  ETRSLETAMIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKL 112

Query: 121 FDLWKEYQRWCNLHFSEINTMKT-----------------KKYKDSSELYKILEINQNSD 163
           FDLWKE+ RWC  H   +  MKT                 K  KD  E+ +ILEI+ +++
Sbjct: 113 FDLWKEFDRWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTE 172

Query: 164 AKTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDF 223
                         +++   Y    +R T D+ + +  KC + ED + VLT PY+S+ D 
Sbjct: 173 EA------------VSVPEEYSL--LRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDI 218

Query: 224 QTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXX 283
           +TF+QE SK++YMNNLPPDTTQSELESWF Q+G++P   WTV+NI+E             
Sbjct: 219 RTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNN 278

Query: 284 XPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVIL 343
            PYVE+ DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++ELQPSS  +L
Sbjct: 279 SPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVL 338

Query: 344 ERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           ++ QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 339 DKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPA 383

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           +PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 649

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           R GDW C +C + NF +   C RC  P    I
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 387

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RC  P
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGP 647

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  377 bits (968), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 192/398 (48%), Positives = 254/398 (63%), Gaps = 34/398 (8%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E ET H++ETPKDH++I   SYQ IN E  +    + K  D+        MAN 
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDI------PDMANA 54

Query: 61  DIMTFKDIIEQFSRNVEKTIGN-EEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPI 119
               FKD I Q   +++  I +  + VLCSL S WD+RVT+PRQ++D G ILPS+LK P 
Sbjct: 55  ----FKDTISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPR 110

Query: 120 IFDLWKEYQRWCNLHFSEINTMKT-------KKYKDSSELYKILEINQNSDAKTNNEKLN 172
           +F+LWKE+ +WC  H   I   K+       K   D S++  ILEI              
Sbjct: 111 VFNLWKEFDKWCGNHPEVIPMRKSNLRVKSPKTAGDISDIVNILEI-------------- 156

Query: 173 DRSGNINMDRGYKKN--DVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQET 230
           D S  + +     +    ++ + ++   +  KC+T +D + VLT PY+S  D +TF+QE 
Sbjct: 157 DTSLQVPLSTSNPQTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQER 216

Query: 231 SKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEH 290
           S+++YMNNLP DTTQSELESWF QFG +P   WT +N +E              P V+E 
Sbjct: 217 SRVLYMNNLPSDTTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQ 276

Query: 291 DSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEIS 350
           D ++GF VFQ+H+EAT+AL+LNGRSILSN+ANTKQPRVVEHIVE+QPSS  +L+  Q+I 
Sbjct: 277 DCVAGFVVFQSHEEATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDIL 336

Query: 351 SQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           S FPQSKNKPRPGDW+C SCGFSNFQRRT+CFRCSFPA
Sbjct: 337 SAFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPA 374

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 6/59 (10%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGHSNHKS 605
           VPFRAGDWKC +C+YHNFAKN+VCLRC  PK         +S + N G +    ++H S
Sbjct: 473 VPFRAGDWKCPSCTYHNFAKNVVCLRCRIPKIS------QQSHNGNEGNQSTTFTSHGS 525

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576
           R GDW C +C + NF +   C RC  P
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFP 373

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C SC + NF +   C RC  P
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIP 502

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  369 bits (946), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 182/390 (46%), Positives = 253/390 (64%), Gaps = 24/390 (6%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E ++    ++ KD T++  L YQ+I+ +  E     +  N++  L++  S    
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLE--KRKINGNEIRQLAVEGS---- 54

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
                +D +  F + +   I  EE VLCS+ STW+LRV +PR++NDE + LP+ LK PI+
Sbjct: 55  ---NLQDTVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIV 111

Query: 121 FDLWKEYQRWCNLHFSEINTMK--TKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNI 178
            DLWKE+ RWC  H   + ++K   +K K+   ++++L + Q         +LN+ S N 
Sbjct: 112 LDLWKEFDRWCTNHPDALQSVKGYNRKCKNLPMVHQVLGVEQ---------RLNE-SVNA 161

Query: 179 NMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNN 238
           N   GY + +V  T D+ + +  KCS+ +D  +VLT PYNS +D++TF +E S ++Y+NN
Sbjct: 162 N---GYTRKEVGITSDILLQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNN 218

Query: 239 LPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGFAV 298
           LPPDTTQ ELE+WF QFG +P   WT +NI+E               YVEE DS+SGFA 
Sbjct: 219 LPPDTTQGELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFAT 278

Query: 299 FQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKN 358
           FQT +EA +AL L+GRSILSN+ANTKQPR+VEH+VE+ PSS  IL   +EI S FPQSKN
Sbjct: 279 FQTFEEAFNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKN 338

Query: 359 KPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           KPRPGDWNC SCGFSNFQRRT+CFRCSFP 
Sbjct: 339 KPRPGDWNCPSCGFSNFQRRTACFRCSFPV 368

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578
           +PFRAGDWKC+AC+YHNFAKNI+CLRC GPKT
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILN 583
           R GDW C +C + NF +   C RC  P   A+ N
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFPVPSAVQN 374

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RCS P
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGP 471

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  367 bits (943), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/396 (47%), Positives = 259/396 (65%), Gaps = 22/396 (5%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E +TLH++ETPKDHT+I  +++QL+N     ++    K + +VI    +S    
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVP--TKVDQIVIDEQAES---- 54

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
               FK   E+ + ++     +   +LCSL STWD+RVT+ RQ+ D G+ +P FL+ P I
Sbjct: 55  ----FKAAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKI 110

Query: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSS-------ELYKILEINQNSDAKTNNEKLND 173
           FDL KEYQRWC L+  E+ + K K   D +            L      +   N ++ ND
Sbjct: 111 FDLMKEYQRWC-LNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEEND 169

Query: 174 RSGNINMDRGYK-KNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSK 232
             G I+ D+ +K + D+  +  V + ++ +C+T +D ++VLT PY+S+ D ++F+QE S+
Sbjct: 170 --GAID-DKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSR 226

Query: 233 IIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDS 292
           ++YMNNLP DTTQSELESWF QFG +P   WT +N++               PYVEE DS
Sbjct: 227 VLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDS 286

Query: 293 ISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQ 352
           I GF VFQTH+EA + L LNGR+ILSN+ANTKQPRVVEH+VE+QPSS  +L++  EI S 
Sbjct: 287 IPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSS 346

Query: 353 FPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           FPQSKNKPRPGDW+C SCGFSNFQRRT+CFRCSFPA
Sbjct: 347 FPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPA 382

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581
           +PFRAGDW C++C+YHNFAKN++CLRCGGPKT  I
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 18/61 (29%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGHSNHKSQYND 609
           R GDW C +C + NF +   C RC  P                     NGH N KSQ N 
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPS------------------NGHINIKSQNNS 396

Query: 610 H 610
           H
Sbjct: 397 H 397

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDWNC SC + NF +   C RC  P
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGP 484

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  365 bits (936), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/407 (44%), Positives = 253/407 (62%), Gaps = 32/407 (7%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+  E ET++  E PKDHT I S++YQ+I+VE  + +  + +++ +            
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSI-----------D 49

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
              + K+ I+     V + +  EE VLCSLNSTWDLRVT+ RQ+ DE  +LPSFL+ P +
Sbjct: 50  ATHSLKNTIQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKV 109

Query: 121 FDLWKEYQRWCNLHFSE-----------INTMKTKKYKDSSELYKILE-----INQNSDA 164
           FDLW+E  RW   H  +           +    T   ++  +L K ++     +N + D 
Sbjct: 110 FDLWREVDRWYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDN 169

Query: 165 KTNNEKLNDRSGNINMDRGYKKN--DVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVD 222
           K+  ++   R   +N+D+   +    ++    V   +   C++  D   VLTHP++S +D
Sbjct: 170 KSTTDQ---RMEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLD 226

Query: 223 FQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXX 282
            + F+ E S ++YMNNLPPDTTQSELESWFAQFG +P   WTV+N++E            
Sbjct: 227 IKNFLLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTN 286

Query: 283 XXPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVI 342
              YV+E DSISGF V+Q H+EA D+L LNGRSILSNM+NTKQPRVVEH+VE+QPSS  +
Sbjct: 287 NNLYVDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSV 346

Query: 343 LERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389
           L+R QEI + FPQSKNKPRPGDW C SC FSNFQRRT+CFRCSFP +
Sbjct: 347 LDRAQEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMS 393

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 37/47 (78%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNS 593
           VPFRAGDWKC+ C+YHNFAKN+VCLRCGGPKT  +  + N +   N+
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSANSNNATVTNA 551

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAIL----NDMNKSMSHNSGQKYNGHSNHKS 605
           R GDW C +CS+ NF +   C RC  P + A+     N+ NK+  H  G K    +   +
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVH--GYKARTSTPQTA 422

Query: 606 QYND 609
            YND
Sbjct: 423 DYND 426

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C +C + NF +   C RC  P
Sbjct: 508 RAGDWKCANCTYHNFAKNVVCLRCGGP 534

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  293 bits (751), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 159/388 (40%), Positives = 232/388 (59%), Gaps = 35/388 (9%)

Query: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60
           M+Y+ +E E+ H+  T KD T+I++LSYQ++N++   D +   + N V  +++ +   N 
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNID---DSTLLAQTNPVASIAISNDSEN- 56

Query: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120
               F+D + Q   +++ TIG  E V+C+LNS  +LRVT+ RQ+ D G+ LP +L+ P +
Sbjct: 57  ----FQDALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKL 112

Query: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM 180
           FDLW E++++C  H       +    KD + L  IL +  N          N  +  I++
Sbjct: 113 FDLWVEFKKFCANHPELDLNEEMVTSKDVAILTDILGLQSN----------NTENYTIDI 162

Query: 181 DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP 240
                      + DV +++  KCS+ ED + VLT PY+  +D +TF +E +++I+++NLP
Sbjct: 163 -----------STDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLP 211

Query: 241 PDTTQSELESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGFAVFQ 300
           PD TQ+ELE+WFA    KP   WT +   E               YV    SI GF +FQ
Sbjct: 212 PDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQ 265

Query: 301 THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP 360
           TH+EA  +LLLNG+SI S+  + KQ   VEHI+E+ PSS  +L+  Q+I   FPQSKNKP
Sbjct: 266 THEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKP 325

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPA 388
           R GDWNC SCGFSNFQRRT+CFRCSFPA
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFPA 353

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 30/38 (78%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILND 584
           VPFRAGDWKC +C+YHNFAKNI CLRCG PK   I  D
Sbjct: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIHQD 483

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576
           R GDW C +C + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C SC + NF +  +C RC  P
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDP 475

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  237 bits (605), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 188/320 (58%), Gaps = 19/320 (5%)

Query: 71  QFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPIIFDLWKEYQRW 130
           Q   +VEK     E V C+LN +W ++V +   +ND G+ LP +L+ P+ FD+WKEY  W
Sbjct: 76  QSGSDVEK-----EFVFCTLNPSWSVKVGLVSSANDLGVELPEYLRYPVFFDIWKEYSIW 130

Query: 131 CNLHFSEINTMKTKKYKDSSELY--KILEINQNSDAKTNNEKLNDRSGNINMDRGYKKND 188
              H     + +T+   +S + +  KI E+ +  D  T  ++L  +    N D  +   D
Sbjct: 131 KKNHSDSSESPQTQANGESIDSFAGKIEELVRTLDVSTEYDELKQK----NDDPTF---D 183

Query: 189 VRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLPPDTTQSEL 248
           VR    V  A+  KC TP D  +VLT PY+  +D++ FI+E SKI+Y++N+P +  Q++L
Sbjct: 184 VRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQSKILYISNIPSELNQTDL 243

Query: 249 ESWFAQFGIKPARLWTVRNILEXXXXXXXXXXXXXXPYVEEHDSISGFAVFQTHKEATDA 308
           E WF Q G+     WT++NI +                +   DS+ GFA+FQ+H +A  A
Sbjct: 244 EGWFQQKGVASVGFWTLKNISDDATLASQRNHGK---MLSIPDSMFGFAIFQSHNDAEYA 300

Query: 309 LLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKPRPGDWNCM 368
           L L+G   +  +   K  + +E ++++QPSSM +LE++Q+     PQ+KNKPRPGDWNC 
Sbjct: 301 LNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLILLPQNKNKPRPGDWNCP 358

Query: 369 SCGFSNFQRRTSCFRCSFPA 388
           SCGFSNFQRRT+CFRC+FP 
Sbjct: 359 SCGFSNFQRRTACFRCAFPV 378

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/40 (77%), Positives = 32/40 (80%)

Query: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMN 586
           VPFRAGDWKC  C YHNFAKNIVCLRCGGPKT+    D N
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKN 571

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNK-SMSHNSGQKYNGHSNHKSQ 606
           R GDW C +C + NF +   C RC  P    +  +  K  M+  +    +G++N+ ++
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGKLPMTSVTNNMVSGYTNYNTR 408

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387
           R GDW C  C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 233 IIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNI 268
           ++ + NLP D TQ ELE  F   G K  RL +VRN+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [891
           bp, 296 aa] {ON}
           complement(146455..147322,147425..147447) [891 nt, 297
           aa]
          Length = 296

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 25/165 (15%)

Query: 124 WKEYQRWCNLHFSEINTMK---------TKKYKDSSELYKILEINQN-SDAKTNNEKLND 173
           WK   R   + F++ +++           KK   S  L KIL+ ++N    K  N KL  
Sbjct: 102 WKVGGRVVKMDFAKKDSLIGLHLRSNTILKKALKSRRLSKILQYDENLKHEKKLNRKLR- 160

Query: 174 RSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQE---- 229
           R   I   +G ++ ++   V+       K     + +   T    + +DF+T I +    
Sbjct: 161 RLRQILRKKGLEEAEISKIVENVKEEQIKLKGEVESKPAST----AELDFETKITKKELI 216

Query: 230 ------TSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNI 268
                  + I+ + NLP  TT+ +L+  FAQ G+K  RL +VRN+
Sbjct: 217 DLSVNPANNILLVQNLPNGTTEVQLKELFAQTGLKEVRLVSVRNL 261

>YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}
           NOP15Constituent of 66S pre-ribosomal particles,
           involved in 60S ribosomal subunit biogenesis; localizes
           to both nucleolus and cytoplasm
          Length = 220

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 227 IQETSKIIYMNNLPPDTTQSELESWFAQFG-IKPARL 262
           ++E S IIY++ LP    + EL  +FAQFG +K  RL
Sbjct: 86  LEEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRL 122

>KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {ON}
           Anc_1.357 YHR015W
          Length = 590

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 36/127 (28%)

Query: 234 IYMNNLPPDTTQSELESWFAQFGIKPAR-LWTVRNILEXXXXXXXXXXXXXXPYVEEHDS 292
           +++ NLP D T  EL  +F+QFG  P + ++T R                      +H S
Sbjct: 295 VFVKNLPVDVTTDELLDYFSQFG--PVKSVYTSR--------------------TTQHTS 332

Query: 293 ISGFAVFQTHKEATDAL------LLNGRSILSNMA--NTKQPRVVEHIVELQPSSMVILE 344
              F  ++  K+A   L         GR++    A   +K+P   E ++ L+P+  V+LE
Sbjct: 333 EWAFITYKWQKDAQKLLDDFPTVEFRGRTVTVARAKLKSKEP---EKLISLKPT--VVLE 387

Query: 345 RIQEISS 351
            I  I +
Sbjct: 388 NIGSICT 394

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 229 ETSKIIYMNNLPPDTTQSELESWFAQFG-IKPARL 262
           E S IIY++ LP    + EL  +F+QFG +K ARL
Sbjct: 88  EYSSIIYVSRLPNGFHEKELSKYFSQFGDLKEARL 122

>Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to
           Ashbya gossypii AFL224W
          Length = 215

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 229 ETSKIIYMNNLPPDTTQSELESWFAQFG-IKPARL 262
           E S IIY++ LP    + EL  +F+QFG +K  RL
Sbjct: 84  ELSSIIYISRLPKGFHERELSKYFSQFGDLKQVRL 118

>Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {ON}
           YNL110C (REAL)
          Length = 222

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 227 IQETSKIIYMNNLPPDTTQSELESWFAQFG-IKPARL 262
           + E S IIY++ LP    + EL  +FAQFG ++  RL
Sbjct: 88  LDEYSAIIYVSRLPHGFHEKELSKYFAQFGDLREVRL 124

>SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 221

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 228 QETSKIIYMNNLPPDTTQSELESWFAQFG-IKPARL 262
           +E S IIY++ LP    + EL  +F+QFG +K  RL
Sbjct: 88  KEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRL 123

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 234 IYMNNLPPDTTQSELESWFAQFG 256
           +++ N+P D TQ  LE  FAQFG
Sbjct: 284 VFIRNVPYDATQESLEEHFAQFG 306

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 210 ESVLTHPYNSNVDFQTFIQETSKI---IYMNNLPPDTTQSELESWFAQFG 256
           + V   P+ S  D Q+ ++E       IY+ N+  +TTQ E E+ F QFG
Sbjct: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>YAR007C Chr1 complement(156754..158619) [1866 bp, 621 aa] {ON}
           RFA1Subunit of heterotrimeric Replication Protein A
           (RPA), which is a highly conserved single-stranded DNA
           binding protein involved in DNA replication, repair, and
           recombination
          Length = 621

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 4/75 (5%)

Query: 159 NQNSDAKTNNEKLNDRSGNINM----DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLT 214
           NQ  D K  N    D SG I      D   K N++     V+     K    +   + LT
Sbjct: 214 NQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLT 273

Query: 215 HPYNSNVDFQTFIQE 229
           HPY  N+D  T I+E
Sbjct: 274 HPYELNLDRDTVIEE 288

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,140,367
Number of extensions: 2743520
Number of successful extensions: 16393
Number of sequences better than 10.0: 87
Number of HSP's gapped: 16785
Number of HSP's successfully gapped: 141
Length of query: 654
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 538
Effective length of database: 40,180,143
Effective search space: 21616916934
Effective search space used: 21616916934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)