Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029507.348ON2161808801e-121
Kpol_530.337.348ON1951807711e-105
NCAS0A141407.348ON2241797641e-103
SAKL0F11330g7.348ON2081797501e-101
NDAI0A019107.348ON2141797382e-99
TDEL0C020007.348ON2131797322e-98
KLLA0D12386g7.348ON2111777286e-98
KAFR0B008607.348ON2281797281e-97
KLTH0H01298g7.348ON2141806992e-93
ZYRO0F11660g7.348ON1981796972e-93
TBLA0E005207.348ON2091796973e-93
CAGL0I03366g7.348ON2121796903e-92
Ecym_47257.348ON2341796848e-91
Kwal_56.246357.348ON2261796829e-91
ACL150W7.348ON2191776732e-89
Smik_4.727.348ON1971796651e-88
YDL166C (FAP7)7.348ON1971796556e-87
KNAG0C037707.348ON2231796551e-86
Suva_4.807.348ON2061796359e-84
Skud_4.917.348ON1941786225e-82
KAFR0C037902.667ON202140790.065
TPHA0H006208.101ON35246730.51
Smik_15.623.103ON32351710.88
Ecym_62781.308ON30145691.8
Kpol_467.98.101ON35943691.9
TBLA0C004808.101ON36027682.2
ZYRO0A13310gsingletonOFF51523692.3
KLTH0G12892g8.295ON492823692.3
Zrou_YGOB_A13310g8.558ON55823682.5
Skud_12.1748.295ON490723683.1
Kpol_1048.538.558ON55223673.6
Kwal_56.236388.295ON492220673.8
Kpol_1033.248.295ON491522665.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02950
         (216 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   343   e-121
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   301   e-105
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   298   e-103
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   293   e-101
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   288   2e-99
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   286   2e-98
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   285   6e-98
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   285   1e-97
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   273   2e-93
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   273   2e-93
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   273   3e-93
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   270   3e-92
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   268   8e-91
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   267   9e-91
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   263   2e-89
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   260   1e-88
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   256   6e-87
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   256   1e-86
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   249   9e-84
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   244   5e-82
KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON...    35   0.065
TPHA0H00620 Chr8 complement(124152..125210) [1059 bp, 352 aa] {O...    33   0.51 
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    32   0.88 
Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON} ...    31   1.8  
Kpol_467.9 s467 complement(23151..24230) [1080 bp, 359 aa] {ON} ...    31   1.9  
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    31   2.2  
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    31   2.3  
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    31   2.3  
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    31   2.5  
Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa]...    31   3.1  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    30   3.6  
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    30   3.8  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    30   5.8  

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  343 bits (880), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/180 (92%), Positives = 167/180 (92%)

Query: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV 60
           MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV
Sbjct: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV 60

Query: 61  XXXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI 120
                        RKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI
Sbjct: 61  DEDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI 120

Query: 121 DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN
Sbjct: 121 DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  301 bits (771), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%)

Query: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV 60
           +SRR +PNLLITGTPGCGKST+CELLQRRLSDY YYNISDFAKEH+CY+G+DE RKSHIV
Sbjct: 2   LSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIV 61

Query: 61  XXXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI 120
                        R+G  IVDWHVNDVFPERLIDLVVVLRCDNS+LYDRL +R YHDSKI
Sbjct: 62  DEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKI 121

Query: 121 DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
            EN+DAEIMGVVLQDAQESYA+EIVVELQSDTTEQM+ NVD+IVDWVELW+KQHK GVTN
Sbjct: 122 QENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTN 181

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  298 bits (764), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 156/179 (87%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRYQPNLLITGTPGCGKSTTCELLQRRL +Y YYNISDFAKEH+CYDG+D+GRKSHIV 
Sbjct: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVD 63

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+GK I+DWHVNDVFPERLIDLV VLRCDNSVLYDRL  R YHD+KI+
Sbjct: 64  EDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           ENMDAEIMGVVLQDA ESYA+EIVVELQSDTTEQMD NVD+IVDW ++W++QH++GVTN
Sbjct: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  293 bits (750), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/179 (76%), Positives = 152/179 (84%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           ++R +PN+L+TGTPGCGKSTTCELL RRLSDYTYYNISDFA+EH CYDG+DE RKSHIV 
Sbjct: 3   TKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       RKGK IVDWHVNDVFPERLIDLVVVLRCDNS+LYDRL  RGYHDSKI+
Sbjct: 63  EDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKIE 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVV+QDA ESYAQEIVVELQSDT E MD NVD+IV+W E+W+ QH NGVTN
Sbjct: 123 ENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  288 bits (738), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 136/179 (75%), Positives = 153/179 (85%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRY+PNLLITGTPG GKSTTCELLQRRL +Y YYNISDFAKE++CY+G+D+GRKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       RKGK IVDWHVND+FPERLIDLVVVLRCDNS+LYDRL  RGYHDSKI 
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVVLQDA ESY QEIVVELQSD TEQM+ NV++IV+W ++W+ QHKNGVTN
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTN 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  286 bits (732), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 134/179 (74%), Positives = 152/179 (84%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
            RR++PNLLITGTPGCGKSTTCELLQRRL DY YYNISDFAKEH+C+DG+DE RKS+IV 
Sbjct: 3   PRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+G  IVDWHVNDVFPERLIDLVVVLRCDN++LYDRLKSR YHD+KI 
Sbjct: 63  EDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKIQ 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVVLQDA +SY QEIVVELQSD+TEQM+ NVD+IV W +LW+KQHK+G TN
Sbjct: 123 ENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTN 181

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  285 bits (728), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 129/177 (72%), Positives = 153/177 (86%)

Query: 4   RYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVXXX 63
           R++PN++++GTPGCGKSTTCELL RRL +YTYYNISDFAKEH+CYDG+D+ RKS+IV   
Sbjct: 5   RFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNIVDDD 64

Query: 64  XXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKIDEN 123
                     RKG CI+DWHVNDVFPERL+DLVVVLRCDN +LYDRL  RGYH++KI+EN
Sbjct: 65  KLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAKIEEN 124

Query: 124 MDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           MDAEIMGVVLQDA +SYAQEIVVELQSDTTE+MD+NVD+I+ W E+W+KQHK GVTN
Sbjct: 125 MDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVTN 181

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  285 bits (728), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 151/179 (84%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRY PNLL+TGTPGCGKSTTCELL RRL DYTY+NIS+FA++H CYDG+DE RKSHIV 
Sbjct: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVD 67

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+GK I+DWHVNDVFPERLIDLVVVLRCDNS+L+DRL  RGYH+SKI 
Sbjct: 68  DDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVVLQDA +SY QEIVVELQS++TE+MD NV++IV W E+W+ QHKNGVTN
Sbjct: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  273 bits (699), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 147/180 (81%)

Query: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV 60
           +S R+ PN+L+TGTPGCGK++TCELLQRRL D  YYNISDFA++H CYDG+DE RKSHIV
Sbjct: 2   LSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIV 61

Query: 61  XXXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI 120
                        RKG  IVDWHVND+FPERLIDLVVVLR DN+VLYDRLKSRGYH++KI
Sbjct: 62  DEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKI 121

Query: 121 DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
            EN+DAEIMGVV+QDAQ+SY +EIVVELQSDT +QMDENVD+I  W   W++Q+  GVTN
Sbjct: 122 QENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTN 181

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  273 bits (697), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRY PN+LITGTPG GKSTT ELLQRRLSD+ YYNISDFA+E++C+DG+DEGRKSHIV 
Sbjct: 3   SRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       RKG  I+DWHVNDVFPERLIDLVVVLRC+NS+L+ RLK RGYH +KID
Sbjct: 63  EDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKID 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVV+QDA +SY +EIVVEL SD+TEQM+ NVD+IV WVELW  QH +GVTN
Sbjct: 123 ENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  273 bits (697), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 130/179 (72%), Positives = 147/179 (82%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRY PNLLI+GTPG GKS+TCELL+R L DY Y NISDFAKE NCYDGFD+GRKSHIV 
Sbjct: 3   SRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+G  IVDWHVNDVFPERLIDLVV+LR DNSVLYDRL++R YHD+K+ 
Sbjct: 63  EDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKVQ 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVVLQDA +SYAQEIV+ELQS+ TE+M  NVD+IV WVELW KQH +GVTN
Sbjct: 123 ENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  270 bits (690), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRR+ PN+++TGTPGCGKSTTCELLQRRL  Y YYNIS+FA+EH CYDG+DEGRKSHIV 
Sbjct: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                        +GK I+DWHVNDVFPERLIDLVVVLR +N  LYDRLK+RGYHDSKI+
Sbjct: 63  EDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVVLQDAQESY  EIVVELQS+TTE M+ NVD+I  WV+ W+++HK+GV++
Sbjct: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSS 181

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  268 bits (684), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 125/179 (69%), Positives = 143/179 (79%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           S R +PN+++TGTPGCGK+TTCELLQRRL D  YYNISDFAKEH+CY+G+DEGRKSHIV 
Sbjct: 17  STRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIVD 76

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       RKG  I+DWHVNDVFPERLIDLVVVLRCDNS LYDRL  RGYHD+KI+
Sbjct: 77  EDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKIE 136

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVVLQDA +SY  +IVVELQS+T  QM+ENV +IV W   W+ QH  GVTN
Sbjct: 137 ENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  267 bits (682), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 142/179 (79%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           S R  PN+L+TGTPGCGK++TCELLQRRL    YYNISDFAKE+ CYDG+DE RKSHIV 
Sbjct: 3   STRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R G  IVDWHVNDVFPERLIDLVVVLR DNS L+DRL  RGYH++KI 
Sbjct: 63  EDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAKIQ 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVV+ DA++SYAQEIVVELQSDTTEQMDENVD+IV W + W +QH  GVTN
Sbjct: 123 ENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVTN 181

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  263 bits (673), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%)

Query: 4   RYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVXXX 63
           R +PN+L++GTPGCGKSTTCELLQR L DY Y+NISDFA+EHNCYDG+DE RKSHIV   
Sbjct: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVDED 64

Query: 64  XXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKIDEN 123
                     R+G  IVDWHVND+FPERLIDLVVVLRCDN++L+DRL+ RGYH SKI+EN
Sbjct: 65  RLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124

Query: 124 MDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           +DAEIMGVVLQDA +SY +EIVVELQSD TEQM +NVD+I  W   W+ +H +GV+N
Sbjct: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSN 181

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  260 bits (665), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 143/179 (79%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRY PN+++TGTPGCGKS+ CELL+ +L DY YYNISDFAK+H+C++G+DEGRKSHIV 
Sbjct: 3   SRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+G  IVDWHVND+FPERLIDLVVVLRCDNS LY RL +RGYHDSKI+
Sbjct: 63  EDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKIE 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVV QDA ESY   IVVELQSDT E M+ NV +I+ W ++W++QH  GVTN
Sbjct: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  256 bits (655), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 143/179 (79%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           +RRY PN+++TGTPGCGKS+TCE L+ +L DY YYNISDFAK+++C++G+DEGRKSHIV 
Sbjct: 3   ARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+G  IVDWHVNDVFPERLIDLVVVLRCDNS LY RL +RGYHDSKI+
Sbjct: 63  EDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIE 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVV QDA ESY   IVVELQSDT E M  NV +IV W ++W++QH +GVTN
Sbjct: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  256 bits (655), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 137/179 (76%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRR  PN+L+TGTPG GKSTTCELL R L DYTYYNISDFA ++ CYDG+DE RKSHIV 
Sbjct: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVD 63

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                         G  I+DWHVNDVFPERLIDLV VLRCD+SVL+DRL  R YH SKID
Sbjct: 64  EDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           ENMDAEIMGVVLQDA +SY ++IVVELQSD TEQM  NVD++V W  +W +QH  GVTN
Sbjct: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  249 bits (635), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 116/179 (64%), Positives = 141/179 (78%)

Query: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVX 61
           SRRY PN+++TGTPGCGKS+TCELL+  L  Y YYNISDFAK+++C++G+DEGRKSHIV 
Sbjct: 3   SRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIVD 62

Query: 62  XXXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121
                       R+G  I+DWHVNDVFPERLIDLVVVLRCDNS LY RL +RGYHDSKI+
Sbjct: 63  EDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKIE 122

Query: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           EN+DAEIMGVV QDA +SY   IVVELQSDT + +  NV +I+ W ++W++QH  GVTN
Sbjct: 123 ENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  244 bits (622), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 138/178 (77%)

Query: 3   RRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVXX 62
           RR+ PN+++TGTPGCGKS+TCELL+  L  Y YYNISDFAK+++C++ +DE RKSHIV  
Sbjct: 4   RRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHIVDE 63

Query: 63  XXXXXXXXXXXRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKIDE 122
                      R+G  I+DWHVNDVFPERLIDLVVVLRCDNS LY RL +RGYHDSKI+E
Sbjct: 64  DKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIEE 123

Query: 123 NMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180
           N+DAEIMGVV QDA +SY   IVVELQ DT E M  NV +IV W ++W++QH +GVTN
Sbjct: 124 NLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVTN 181

>KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON}
           Anc_2.667 YKL024C possible ribosomal frameshifting
          Length = 202

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 57/140 (40%), Gaps = 25/140 (17%)

Query: 9   LLITGTPGCGKSTTCELLQRRLSDYTYYNIS--DFAKEHNCYDGFDEGR--KSHIVXXXX 64
           + + G PG GK T C  L   + DY + ++S  D  +     +G + G   K++I     
Sbjct: 15  IFVLGGPGAGKGTQCAKL---VKDYGFVHLSAGDLLRAEQDREGSEFGSLIKNYIKEGLI 71

Query: 65  XXXXXXXXXRKGKCIVDW------HVNDVFPERL------------IDLVVVLRCDNSVL 106
                     K   + ++      ++ D FP ++               V+   C  +V+
Sbjct: 72  VPQEITIQLLKNAILENYEKGSTKYLVDGFPRKMDQAITFEQVIVKAKFVLFFDCSETVM 131

Query: 107 YDRLKSRGYHDSKIDENMDA 126
            +RL  RG    +ID+N+++
Sbjct: 132 LERLLERGKSSGRIDDNIES 151

>TPHA0H00620 Chr8 complement(124152..125210) [1059 bp, 352 aa]
          {ON} Anc_8.101 YFR007W
          Length = 352

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 1  MSRRYQPNLLITGTPGCGKSTTCELLQRRL-SDYTYYNISDFAKEH 45
          M++ Y+  +L+ G PG GKST  + L   + + YT Y +S+F  +H
Sbjct: 19 MAKNYRVIVLLVGPPGSGKSTVAQSLCDAINAKYTSY-LSNFTGKH 63

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 7  PNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYD--GFDEGR 55
          P+++I+G PG GK+T+   L   L  ++Y   +D   E N  D  G D  R
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGHSY---ADGVLELNASDDRGIDVVR 90

>Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AEL156W
          Length = 301

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEH 45
           + ++ +P LL+T T G       +L      D++YY +S F  EH
Sbjct: 246 LEKQLKPELLLTATAGTSWEGMVDLHMEDGFDHSYYFVSSFVPEH 290

>Kpol_467.9 s467 complement(23151..24230) [1080 bp, 359 aa] {ON}
          complement(23151..24230) [1080 nt, 360 aa]
          Length = 359

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 4/43 (9%)

Query: 3  RRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEH 45
          + Y+ +L+I G PG GKST    L  RL+   +    ++ KEH
Sbjct: 21 KNYRISLVIVGPPGSGKSTIANELCERLNSMFH----EYLKEH 59

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 5  YQPNLLITGTPGCGKSTTCELLQRRLS 31
          Y  N++I G PG GKST  E L   L+
Sbjct: 23 YTINIIIVGPPGSGKSTIAEKLSANLN 49

>ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]
           {OFF} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 515

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 9   LLITGTPGCGKSTTCELLQRRLS 31
           LL+ G PG GK+T C+ L ++LS
Sbjct: 307 LLVQGPPGTGKTTICKALCQKLS 329

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 9    LLITGTPGCGKSTTCELLQRRLS 31
            +L+ G  GCGK+T C+L+ + LS
Sbjct: 1369 VLLVGETGCGKTTVCQLIAKYLS 1391

>Zrou_YGOB_A13310g Chr1
           complement(1049931..1050068,1050140..1051678) [1677 bp,
           558 aa] {ON} ANNOTATED BY YGOB -
          Length = 558

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 9   LLITGTPGCGKSTTCELLQRRLS 31
           LL+ G PG GK+T C+ L ++LS
Sbjct: 307 LLVQGPPGTGKTTICKALCQKLS 329

>Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa] {ON}
            YLR106C (REAL)
          Length = 4907

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 9    LLITGTPGCGKSTTCELLQRRLS 31
            +L+ G  GCGK+T C+LL + +S
Sbjct: 1363 VLLVGETGCGKTTICQLLAQFMS 1385

>Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON}
           (151366..153024) [1659 nt, 553 aa]
          Length = 552

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 9   LLITGTPGCGKSTTCELLQRRLS 31
           LL+ G PG GK+T C+ L ++LS
Sbjct: 304 LLVHGPPGTGKTTVCKALCQKLS 326

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 9    LLITGTPGCGKSTTCELLQR 28
            +L+ G  GCGK+T C+L+ R
Sbjct: 1366 ILLVGETGCGKTTVCQLIAR 1385

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 9    LLITGTPGCGKSTTCELLQRRL 30
            +L+ G  GCGK+T C++L   L
Sbjct: 1362 ILLVGETGCGKTTVCQILAEHL 1383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,831,870
Number of extensions: 743093
Number of successful extensions: 3560
Number of sequences better than 10.0: 41
Number of HSP's gapped: 3601
Number of HSP's successfully gapped: 41
Length of query: 216
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 111
Effective length of database: 41,441,469
Effective search space: 4600003059
Effective search space used: 4600003059
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)