Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029307.346ON43643622970.0
Kpol_530.357.346ON42540518020.0
Smik_12.2617.346ON43640917530.0
TDEL0C020207.346ON42540517480.0
Skud_12.2667.346ON43640417480.0
Suva_10.2977.346ON43640417470.0
YLR203C (MSS51)7.346ON43643817430.0
NCAS0E028807.346ON42941917000.0
SAKL0F11286g7.346ON42340416970.0
Kwal_56.246317.346ON42242216870.0
CAGL0A03927g7.346ON43742816750.0
KLTH0H01342g7.346ON42242216700.0
ZYRO0F11616g7.346ON41540716610.0
KLLA0D12430g7.346ON41840316360.0
Ecym_47277.346ON42940416170.0
KNAG0B026307.346ON43841816050.0
NDAI0E044807.346ON44340215770.0
KAFR0B008407.346ON42640215520.0
NCAS0A141207.346ON42742315380.0
TBLA0E005007.346ON43743515240.0
NDAI0A019307.346ON45041614930.0
KNAG0C037507.346ON42440214830.0
ACL152W7.346ON42840614760.0
KAFR0C032108.69ON2131114780.65
Skud_4.1672.370ON27157760.65
KLTH0G11418g8.357ON89792760.91
KLTH0H15906g2.370ON28557694.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02930
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   889   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   698   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   679   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   677   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   677   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   677   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   676   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   659   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   658   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   654   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   649   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   647   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   644   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   634   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   627   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   622   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   612   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   602   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   597   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   591   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   579   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   575   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   573   0.0  
KAFR0C03210 Chr3 (647217..653612) [6396 bp, 2131 aa] {ON} Anc_8....    35   0.65 
Skud_4.167 Chr4 complement(295745..296560) [816 bp, 271 aa] {ON}...    34   0.65 
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    34   0.91 
KLTH0H15906g Chr8 (1365702..1366559) [858 bp, 285 aa] {ON} highl...    31   4.2  

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 425/436 (97%)

Query: 1   MTVLMSSINTLRHPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENR 60
           MTVLMSSINTLRHPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGL           ENR
Sbjct: 1   MTVLMSSINTLRHPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGLDPSPSPDDPTPENR 60

Query: 61  FHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSK 120
           FHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSK
Sbjct: 61  FHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSK 120

Query: 121 RYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLA 180
           RYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLA
Sbjct: 121 RYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLA 180

Query: 181 AVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHD 240
           AVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHD
Sbjct: 181 AVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHD 240

Query: 241 RPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVK 300
           RPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVK
Sbjct: 241 RPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVK 300

Query: 301 KIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLE 360
           KIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLE
Sbjct: 301 KIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLE 360

Query: 361 TKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFN 420
           TKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFN
Sbjct: 361 TKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFN 420

Query: 421 MYVAGFRGKRYHTIKR 436
           MYVAGFRGKRYHTIKR
Sbjct: 421 MYVAGFRGKRYHTIKR 436

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/405 (78%), Positives = 363/405 (89%), Gaps = 1/405 (0%)

Query: 32  QKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKE 91
           QKRSLMGFV+NALGL           ENRFHPWDQSP  DLRERAA+IRTLAKCPVT K+
Sbjct: 20  QKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79

Query: 92  INYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQI 151
           INYTCPLSGIPTHH +EAW  DKDYH+SKRYEILKKVNIYEHDLRSGRPFPEFDFP DQ 
Sbjct: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139

Query: 152 HDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPIT 211
           +DR++NLTNWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LHQFSPYSLNPKGP+T
Sbjct: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199

Query: 212 LEGLKSLAALRYSLYPFQRKS-NISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPD 270
           LEGLKSLAALRY+LYP+Q KS N+ +   DRPMRIFILGARAEAQLPGHVWKQ Q+LFP+
Sbjct: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259

Query: 271 QTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPY 330
           Q FEIHFIG EC LN EKN+YI S+ P+VKK+D+T+KL++H DYFHV+HEAQDF PYDP+
Sbjct: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319

Query: 331 LDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEM 390
           LDVFFTFHPG+A PET+++W+G+TMKALL+TKCAIFTTGF+KQD+  D+++VK RYG E+
Sbjct: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379

Query: 391 DTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           D LMDP+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYH I+
Sbjct: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/409 (76%), Positives = 358/409 (87%), Gaps = 1/409 (0%)

Query: 28  LPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPV 87
           L    +R LMGFV+NALGL           ENRFHPWDQSPS DLRERAA+IRTLA CPV
Sbjct: 28  LSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPV 87

Query: 88  TKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFP 147
           T K+INYTCPLSGIPTHHSREAWE DK YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP
Sbjct: 88  TGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFP 147

Query: 148 LDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPK 207
            +Q +D+ VNLTNWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPK
Sbjct: 148 QNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPK 207

Query: 208 GPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFL 267
           GPITLEGLKSLAALRY+LYP + +S ++    +R MRIFILGARAEAQLPGHVWKQLQFL
Sbjct: 208 GPITLEGLKSLAALRYTLYPLENRSLLT-ATKNRAMRIFILGARAEAQLPGHVWKQLQFL 266

Query: 268 FPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPY 327
           FP+Q FEIHFIG ECL   +K +Y+KS  PVV+++DET+K I+ +D+F V+HEAQDF PY
Sbjct: 267 FPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPY 326

Query: 328 DPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYG 387
           DPY+DVFFTFHPG+A+PE+   WMG+TMKALLETKCAIFTTGFNK+D+T+D+ +VK++YG
Sbjct: 327 DPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYG 386

Query: 388 KEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436
           KEMD LMDP+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYHTIKR
Sbjct: 387 KEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/405 (76%), Positives = 351/405 (86%), Gaps = 2/405 (0%)

Query: 31  SQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKK 90
           +Q+R ++GFV+NALGL           ENRFHPWDQSP  DLRERAARIRTLA+CPVT K
Sbjct: 22  NQRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGK 81

Query: 91  EINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQ 150
           EINYTCPLSGIPTHHSREAWE DK YHQSK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q
Sbjct: 82  EINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQ 141

Query: 151 IHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPI 210
             DR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP++I S+LHQFSPYSLNPKGP+
Sbjct: 142 DFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPV 201

Query: 211 TLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPD 270
           TLEGLKSLAALRY+LYP + K+  S K  DRPMRIFILGARAEAQLPGHVWKQLQ+LFP+
Sbjct: 202 TLEGLKSLAALRYTLYPLENKTISSTK--DRPMRIFILGARAEAQLPGHVWKQLQYLFPE 259

Query: 271 QTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPY 330
           Q FE+HF+G ECLLN EK++Y+ S+ PVVK++DET+  +YH+D+FHV HEAQDF PYDPY
Sbjct: 260 QMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPY 319

Query: 331 LDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEM 390
           LDVFF FHPGF APETS  W+ +TMK LLETKCAIFTTGFNK D+  DV+ VK +YGKE+
Sbjct: 320 LDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEV 379

Query: 391 DTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           D LM+P+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYH I+
Sbjct: 380 DVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/404 (75%), Positives = 356/404 (88%), Gaps = 1/404 (0%)

Query: 33  KRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEI 92
           +R LMGFV+NALGL           ENRFHPWDQSPS DLRERAA+IRTLA CPVT K+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 93  NYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIH 152
           NYTCPLSGIPTHHSREAWE DK YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 153 DRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITL 212
           D+ VNLTNWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGPITL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212

Query: 213 EGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQT 272
           EGLKSLAALRY+LYP + +S ++    +R MRIFILGARAEAQLPGHVWKQLQFLFP+Q 
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLA-TTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271

Query: 273 FEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLD 332
           FEIHF+G ECL   +K +Y+KSA PVV+++DET++ I+H+D+F V+HEAQDF PYDPY+D
Sbjct: 272 FEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMD 331

Query: 333 VFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT 392
           VFFTFHPG+A+PE+   WMG+TM+ALLETKCAIFTTGFNK+D+ +D+  VK++YGKEMD 
Sbjct: 332 VFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDI 391

Query: 393 LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436
           LMDP++N +GSTKWELNDMNPQE++QFNMY+AGFRGKRYHTIKR
Sbjct: 392 LMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/404 (76%), Positives = 354/404 (87%), Gaps = 1/404 (0%)

Query: 33  KRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEI 92
           +R LMGFV+NALGL           ENRFHPWDQSPS DLRERAA+IRTLA CPVT K+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 93  NYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIH 152
           NYTCPLSGIPTHHSREAWE DK YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 153 DRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITL 212
           D+ VNLTNWDLF YTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGPITL
Sbjct: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 213 EGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQT 272
           EGLKSLAALRY+LYP + +S ++    +R MRIFILGARAEAQLPGHVWKQLQFLFP+Q 
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLA-TTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271

Query: 273 FEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLD 332
           FEIHFIG ECL   +K +Y+KSA PVV++IDET+K  +H+D+F V+HEAQDF PYDPY+D
Sbjct: 272 FEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMD 331

Query: 333 VFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT 392
           VFFTFHPG+A+PE+   WMG+TM ALLETKCAIFTTGFNK+D+ +D+ +VK++YGKEMD 
Sbjct: 332 VFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDI 391

Query: 393 LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436
           LMDP+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYHTIKR
Sbjct: 392 LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/438 (72%), Positives = 370/438 (84%), Gaps = 5/438 (1%)

Query: 1   MTVLMSSINTLRHPMSMNILNKNTLTSLPSSQ--KRSLMGFVKNALGLXXXXXXXXXXXE 58
           MTVL +     +  +  ++L K+    L  S   +R LMGFV+NALGL           E
Sbjct: 1   MTVLYAPSGATQ--LYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPE 58

Query: 59  NRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQ 118
           NRFHPWDQSPS DLRERAA+IRTLA CPVT K+INYTCPLSGIPTHHSREAWE DK YH 
Sbjct: 59  NRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHD 118

Query: 119 SKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQ 178
           SK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q +D+ VNLTNWDLFFYTR+FYSMDTEFQ
Sbjct: 119 SKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQ 178

Query: 179 LAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKL 238
           LAAVTKMLSYP+TIGS+LH+FSPYSLNPKGPITLEGLKSLAALRY+LYP + +S +    
Sbjct: 179 LAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS-LPTTT 237

Query: 239 HDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPV 298
            +R MRIFILGARAEAQLPGHVWKQLQFLFP+Q+FEIHFIG ECL   +K +Y+KS  PV
Sbjct: 238 KNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPV 297

Query: 299 VKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKAL 358
           V+++DET+K IY +++F V+HEAQDF PYDPY+DVFFTFHPG+A+PE+   WMG+TMKAL
Sbjct: 298 VQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKAL 357

Query: 359 LETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQ 418
           LETKCAIFTTGFNK+D+T+D+ +VK++YGKEMD LM+P++N +GSTKWELNDMNPQE++Q
Sbjct: 358 LETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQ 417

Query: 419 FNMYVAGFRGKRYHTIKR 436
           FNMY+AGFRGKRYHTIKR
Sbjct: 418 FNMYIAGFRGKRYHTIKR 435

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/419 (72%), Positives = 349/419 (83%), Gaps = 2/419 (0%)

Query: 18  NILNKNTLTSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAA 77
            +L +N   ++  +Q R LMGFV+NALGL           ENRFHPWDQSPSPDLRERAA
Sbjct: 13  TLLPRNAF-NVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAA 71

Query: 78  RIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRS 137
           RIRTLA+CPVT KEINYTCP+SGIPTHHSREAWE DK+YH SKRYE+LKKVNIYEHDLRS
Sbjct: 72  RIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRS 131

Query: 138 GRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILH 197
           GRPFPEFDFP DQ  DR+VN+TNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TIGS+LH
Sbjct: 132 GRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLH 191

Query: 198 QFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLP 257
           QFSPYSL PKGPI+LEGLKSLAALRY+LYP Q +  IS     RPMRIFILGARAE+QLP
Sbjct: 192 QFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVIS-TTKARPMRIFILGARAESQLP 250

Query: 258 GHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHV 317
           GHVWKQLQ+LFP+QTFEIHFIG E   + +K KYI+   P+ + +DET+KLIYH++YFH 
Sbjct: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310

Query: 318 YHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITN 377
            HEAQDF PYDPY+DVFF FHPGFA+ E  + WM DTMK LL+TKCAIFTTGF K D+  
Sbjct: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370

Query: 378 DVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436
           D+ +V+ +YGKE+D LM P KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRY TIKR
Sbjct: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/404 (73%), Positives = 344/404 (85%), Gaps = 1/404 (0%)

Query: 32  QKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKE 91
           QKR ++GFV+NALGL           +NRFHPWDQSPSPDLR RAA IR LA+CPVT KE
Sbjct: 20  QKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKE 79

Query: 92  INYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQI 151
           INYTCP SGIPTHHSREAWE D  YH +K+YEILKKVNIYEHDLRSGRPFPEFDFP DQ 
Sbjct: 80  INYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139

Query: 152 HDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPIT 211
           +DR+VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPIT
Sbjct: 140 YDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPIT 199

Query: 212 LEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQ 271
           LEGLKSLAALRY+LYP Q+   +S    DRPMRIFILGARAEAQLPGHVWKQ QFLFP+ 
Sbjct: 200 LEGLKSLAALRYTLYP-QQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEI 258

Query: 272 TFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYL 331
            FE+HFIG E   + EK +YI S+ P+V+++DET+  +YH+DYFHV+HEAQDF PYDPYL
Sbjct: 259 NFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYL 318

Query: 332 DVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMD 391
           D+FF FHPGFAAPE+++ WMG TM+ LLETKCAIFTTGFN+QD+  D+  V+ +YG EMD
Sbjct: 319 DIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMD 378

Query: 392 TLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
            LM+P++N +GSTKWELNDMNPQE++QFNMY+AGFRGKRYH I+
Sbjct: 379 MLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 353/422 (83%), Gaps = 2/422 (0%)

Query: 15  MSMNILNKNTL-TSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLR 73
           M   ILN+++L  S  S QKR +MGFV+NALGL           ENRFHPWDQSPSPDLR
Sbjct: 1   MQRYILNRSSLRNSHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLR 60

Query: 74  ERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEH 133
           ERAA IR LAKCPVT +EINYTCP SGIPTHHSREAWE D DY QSKR EILKKVNIYEH
Sbjct: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEH 120

Query: 134 DLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIG 193
           DLRSGRPFPEFDFPLDQ  DR+VNLTNWDLFFYTR F+SMDTEFQLAAVTKMLSYP+TIG
Sbjct: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIG 180

Query: 194 SILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAE 253
           S+LHQFSPYSLNPKGPITLEGLKSLAALRY+LYP Q +   S+   + P+RIF+LGARAE
Sbjct: 181 SVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIA-KNSPLRIFVLGARAE 239

Query: 254 AQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSD 313
           AQLPGHVWKQLQF+FP+   EIHF+G E   +  K +Y+ SA P+++++DET+  +YH+D
Sbjct: 240 AQLPGHVWKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTD 299

Query: 314 YFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQ 373
           YFHV+HEAQDF PYDPY D+FF FHPGFAAPE+ + WMG TM+ALLETKCAIFTTGFN+ 
Sbjct: 300 YFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEV 359

Query: 374 DITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHT 433
           D+  D++ V A YGKE+D +MDP KN++GSTKWELND+NPQE++QFNM++AGFRGKRYH 
Sbjct: 360 DLQRDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHA 419

Query: 434 IK 435
           I+
Sbjct: 420 IE 421

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/428 (71%), Positives = 347/428 (81%), Gaps = 15/428 (3%)

Query: 22  KNTLTSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRT 81
           +NT        KR LMGFV+NALGL           +NRFHPWDQSP+ DLRERAARI+T
Sbjct: 10  QNTGKFYACVSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKT 69

Query: 82  LAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPF 141
           LAKCPVT K I YTCP+SGIPTHHSREAWE DK+YH SK+YEILKKVNIYEHDLRSGRPF
Sbjct: 70  LAKCPVTHKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPF 129

Query: 142 PEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSP 201
           PEFDFP DQ  DR VNLTNWDLF YTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LHQFSP
Sbjct: 130 PEFDFPRDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSP 189

Query: 202 YSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVW 261
           YSLNPKGPITLEGLKSLAALRY+LYP Q ++ ++    ++PMRIFILGARAEAQLPGHVW
Sbjct: 190 YSLNPKGPITLEGLKSLAALRYTLYPLQNRA-VTTTAKNKPMRIFILGARAEAQLPGHVW 248

Query: 262 KQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSA--------------IPVVKKIDETMK 307
           KQLQFLFP Q FEIHFIG E L + E+N+YI+SA              IPV K+IDETMK
Sbjct: 249 KQLQFLFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMK 308

Query: 308 LIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFT 367
             YH+DYFH  H AQDF PYDPY DVFF FHPG A+PE+ D WM DT+K LL+TKCAIFT
Sbjct: 309 FFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFT 368

Query: 368 TGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFR 427
           TGFNK+D+ +D++I++  YGKEMD LM+P+KN +GSTKWEL+D +P  ++QFNMY+AGFR
Sbjct: 369 TGFNKKDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFR 428

Query: 428 GKRYHTIK 435
           GKRYH IK
Sbjct: 429 GKRYHPIK 436

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/422 (70%), Positives = 352/422 (83%), Gaps = 2/422 (0%)

Query: 15  MSMNILNKNTLTSLPSS-QKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLR 73
           M   IL++NT+ S   + QKR +MGFV+NALGL           ENRFHPWDQSPSPDLR
Sbjct: 1   MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLR 60

Query: 74  ERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEH 133
           ERAA IR LAKCPVT +EINYTCP SGIPTH+SREAWE D +Y QSKR EILKKVNIYEH
Sbjct: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH 120

Query: 134 DLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIG 193
           DLRSGRPFPEFDFPLDQ  DR+VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIG
Sbjct: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG 180

Query: 194 SILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAE 253
           S+LHQFSPYSLNPKGP+TLEGLKSLAALRY+LYP Q +   S+   + P+RIFILGARAE
Sbjct: 181 SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSIT-KNSPLRIFILGARAE 239

Query: 254 AQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSD 313
           AQLPGHVWKQLQF+FP+   E+HF+G E   +  K +Y+ S+ P+V+++DET+  +YH+D
Sbjct: 240 AQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTD 299

Query: 314 YFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQ 373
           YFHV+HEAQDF PYDPY D+FF FHPGFAAPE+ + WMG TM+ALLETKCA+FTTGFN+ 
Sbjct: 300 YFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNEL 359

Query: 374 DITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHT 433
           D+  DV  V  ++GKE+D LM+P+ N++GSTKWELNDMNPQE++QFNM++AGFRGKRYH 
Sbjct: 360 DLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHA 419

Query: 434 IK 435
           I+
Sbjct: 420 IE 421

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/407 (72%), Positives = 342/407 (84%), Gaps = 2/407 (0%)

Query: 29  PSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVT 88
           P +Q+R+++GFV+NALGL           ENRFH WDQSP+ DLRERAARIR LA+CPVT
Sbjct: 10  PITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVT 69

Query: 89  KKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPL 148
            KEINYTCPLSGIPTHHS+EAWE DK YH+SK++E+LKKVNIYEHDLRSGRPFPEFDFP 
Sbjct: 70  GKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQ 129

Query: 149 DQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKG 208
           D   DR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L+QFSPYSLNPKG
Sbjct: 130 DLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKG 189

Query: 209 PITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLF 268
           PITLEGLKSLAALRY+LYPF+ K+  + K  DRPMR+FILGARAEA LPGHVWKQLQFLF
Sbjct: 190 PITLEGLKSLAALRYTLYPFENKTVAATK--DRPMRLFILGARAEALLPGHVWKQLQFLF 247

Query: 269 PDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYD 328
           P+  FE+HFIG ECL+N EK++Y+ S  PVVK+IDET+  +YH+DYFHVYH+AQDF PYD
Sbjct: 248 PETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYD 307

Query: 329 PYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGK 388
           PYLD FF FHPGF APE++ LW+  T+  LLETKCAIF TG NK  +  D+  V  ++ K
Sbjct: 308 PYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSK 367

Query: 389 EMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           E+D LM+P KN YGSTKWELND+NPQE++QFNMY+AGFRGKRYH I+
Sbjct: 368 EIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/403 (71%), Positives = 340/403 (84%), Gaps = 3/403 (0%)

Query: 34  RSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93
           R +MGFV+NALGL           ENRFHPWDQSPSPDLRERAARI+ +A CPVT K+I 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153
           +TCPLSGIPTHHSREAWE D +YH+SKRYE+LKKVNIYEHDLRSGRPFPEFDFP DQ +D
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213
           R+VN++NWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LHQ+SPYSLNPKGPITLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273
           GLKSLAALRY+LYP Q  S       D P+RIFILG RAEAQLPGHVWKQLQ+L PD + 
Sbjct: 197 GLKSLAALRYTLYPEQ--SGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSI 254

Query: 274 EIHFIGTECLLNNEKNKYIKSAIP-VVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLD 332
           E+HF+G E   + EK  Y++S+   +VK+IDE M+L YH+D+FHV+HEAQDF PYDPY D
Sbjct: 255 ELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYND 314

Query: 333 VFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT 392
           VFF FHPGFAAPET + WMGDTMKAL++TKCA+FTTGF+K+D+  D+ IV+ +YG E+D 
Sbjct: 315 VFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDM 374

Query: 393 LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           LM+P+ N +GSTKWELND NP E++QFNMY+AGFRGKRYH I+
Sbjct: 375 LMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/404 (70%), Positives = 342/404 (84%), Gaps = 2/404 (0%)

Query: 32  QKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKE 91
           Q+R +MGFV+NALGL           +NRFHPWDQSPSP+LRERAARI+ LAKCPVT K 
Sbjct: 27  QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKN 86

Query: 92  INYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQI 151
           I ++C  SGIPTHHS EAW+ D +YH+SKRY +LKKVNIYEHDLRSGRPF EFDFP  Q 
Sbjct: 87  IQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQD 146

Query: 152 HDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPIT 211
           +DR+VN+ NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TIGSILHQ+SPYSLNPKGPIT
Sbjct: 147 YDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPIT 206

Query: 212 LEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQ 271
           LEGLKSLAALRY+LYP Q +   S++  D+P+R+FILGARAEAQLPGHVWKQLQ+LFP+ 
Sbjct: 207 LEGLKSLAALRYTLYPEQNRRVRSIQ--DKPLRVFILGARAEAQLPGHVWKQLQYLFPES 264

Query: 272 TFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYL 331
             E+HF+G E   + EK +Y+ S+IPVVK+ID+TMK+ YH+DYFHV+HEAQDF PYDPY 
Sbjct: 265 LIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYN 324

Query: 332 DVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMD 391
           D+FF FHPGF +PET D WM  T++ALL+TKCAIFTTGFNK+D+ +D++ VK +YG E+D
Sbjct: 325 DIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELD 384

Query: 392 TLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
            L+DP KN +GSTKWELND+NP E++QFNMY+AGFRGKRYH I+
Sbjct: 385 MLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/418 (68%), Positives = 338/418 (80%), Gaps = 7/418 (1%)

Query: 26  TSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKC 85
           + LP   +R LMGFV+NALGL           ENRFHPWDQSP   LRERAARI+TLAKC
Sbjct: 21  SGLPCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKC 80

Query: 86  PVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFD 145
           PVT   + YTCPLSGIPTHHSREAWE D  YH +KRYE LKKVNIYEHDLRSGRPFPEFD
Sbjct: 81  PVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFD 140

Query: 146 FPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLN 205
           FP +Q +D+VVN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L QFSPYSLN
Sbjct: 141 FPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLN 200

Query: 206 PKGPITLEGLKSLAALRYSLYP-----FQRKSNISL--KLHDRPMRIFILGARAEAQLPG 258
           PKGPITLEGLKSLAA+RY+LY        R   ++    L +RPMR+F+LGARAEAQLPG
Sbjct: 201 PKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPG 260

Query: 259 HVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVY 318
           HVWKQL +LFP+Q+FE+ FIG E   +  + +Y++S  PVV+K+DET+K I+++DYFHV 
Sbjct: 261 HVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVL 320

Query: 319 HEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITND 378
           HE+QDF PYDPY D FFTFHPGFA+PE  D W+ +T+ ALL+TKCAIFTTGF++ D+ ND
Sbjct: 321 HESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMND 380

Query: 379 VEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436
           V ++  ++G EMD LM+P KN +GSTKWELND+NP E++QFNMY+AGFRGKRYHTIKR
Sbjct: 381 VALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/402 (69%), Positives = 337/402 (83%), Gaps = 1/402 (0%)

Query: 34  RSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93
           RSLMGFV+NALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVT KEIN
Sbjct: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101

Query: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153
           YTCP+SGIPTHHS+ AWE D++YH +K YEILKKVNIYEHDLRSGRPFPEF FP DQ  D
Sbjct: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161

Query: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213
           R++N+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYP+TIGSILHQFSPYSL PKGPITLE
Sbjct: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221

Query: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273
           GLKS+AALRY+LYPF  KS ++L   +RPMRIF+LGARAEAQLPGH+WKQLQ+LFP+Q F
Sbjct: 222 GLKSMAALRYTLYPFHNKSFMTLT-KNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKF 280

Query: 274 EIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDV 333
           E+ FIG E   + EK +Y+K   P+++ ID+T+KL + ++YFH  HE+QD  PYDPY+DV
Sbjct: 281 ELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDV 340

Query: 334 FFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTL 393
           FF FHPGF+A ET++ WM DTMK+LLET+CAIF TGF++ D+ ND+ I+  +Y  ++D L
Sbjct: 341 FFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDIL 400

Query: 394 MDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           M P+KN +GSTKWELND+NPQ+++QFNMY+AGFRGKRY T++
Sbjct: 401 MKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/402 (69%), Positives = 332/402 (82%), Gaps = 1/402 (0%)

Query: 34  RSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93
           R+L+GFV+NALGL            NRF+PWDQSPSP+LRERAA+I+ +A+CP+T KEIN
Sbjct: 25  RTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEIN 84

Query: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153
           YTCP+SGIPTHHSREAWE D+ YH++K  +ILKKVNIYEHDLRSGR FPEFDFP DQ  D
Sbjct: 85  YTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFD 144

Query: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213
           R VNL NWDL+FYTR+FYSMDTEFQLA VTKMLSYP+TI S+LHQ+SPYSL P GPITLE
Sbjct: 145 RAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLE 204

Query: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273
           GLKS+AALRYSLYP Q KS+ S+    RPMRIFILGARAE+QLPGHVWKQ Q+LFP QTF
Sbjct: 205 GLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTF 264

Query: 274 EIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDV 333
           EI FIG EC L    N  +  A  +VK+ID+T+ L+YH   FH  H+AQDF PYDPY DV
Sbjct: 265 EIIFIGPECQLREPSNS-VGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYNDV 323

Query: 334 FFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTL 393
           FF FHPGFA+PET +LWM DT+KALL+TKCA+F TGF+K+D++NDV+++   YG ++DTL
Sbjct: 324 FFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDTL 383

Query: 394 MDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           M P+KN +GSTKWELND+NPQE++QFNMY++ FRGKRYH I+
Sbjct: 384 MTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIE 425

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/423 (65%), Positives = 338/423 (79%), Gaps = 11/423 (2%)

Query: 13  HPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDL 72
           HP+S+  ++         S  R+L+GFVKNALG+            NRF+PWD+SPSP +
Sbjct: 15  HPVSLFAIDSRI------SSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAI 68

Query: 73  RERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYE 132
           RERAARI+  AKCPVT KEI +TCPLSGIPTH+S+EAWE D +YH++K YE L+KVNIYE
Sbjct: 69  RERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYE 128

Query: 133 HDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTI 192
           HDLRSGRPFPEFDFP +Q  D  VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSYP+TI
Sbjct: 129 HDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITI 188

Query: 193 GSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARA 252
           GSIL+++SPY+L PKGP+TLEGLKSLAALRY+L     ++N       RPMRIFILGARA
Sbjct: 189 GSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL-----RNNAFATTKTRPMRIFILGARA 243

Query: 253 EAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHS 312
           E+QLP H+WKQLQFLFP Q FEI+FIG EC L  + + Y+ S   +VK++DE++ L Y+ 
Sbjct: 244 ESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYP 303

Query: 313 DYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNK 372
           DYF  +H+AQDF PYDPY D+FFTFHPGFA+PE+S  WMGDTMKALL+TKCAIFTTGF++
Sbjct: 304 DYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQ 363

Query: 373 QDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYH 432
            DI  D+  V+  YG+E+D LM+PIKN +GSTKWELND+NPQ+++QFNMY+AGFRGKRYH
Sbjct: 364 DDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYH 423

Query: 433 TIK 435
           T+K
Sbjct: 424 TVK 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/435 (62%), Positives = 339/435 (77%), Gaps = 12/435 (2%)

Query: 10  TLRHPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPS 69
           TL +  +  IL+KN + +  +  KR+LMGFV++ LGL           ENRFHPW+ SP 
Sbjct: 2   TLLYNTTKPILSKNII-ACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPC 60

Query: 70  PDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVN 129
            DLRERAARI+T+AKCPV+  +INYTCP+SGIPTHHSR+ WE D +YH++   +ILKKVN
Sbjct: 61  DDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVN 120

Query: 130 IYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYP 189
           IYEHDLRSGRPFPEFDFP +Q +D V+NL NWDL+FYTRNF+SMDTEFQLAAVTKMLSYP
Sbjct: 121 IYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYP 180

Query: 190 MTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSL---------YPFQRKSNISLKLHD 240
           MTI S+LHQFSPYSL PKGP+TLEGLKSLAALRY+L               + I+    +
Sbjct: 181 MTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKN 240

Query: 241 RPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVK 300
           RPMRIFILGARAEAQLP HVWKQLQ+LFP+  FEIHFIG E LL+ +K+ Y+ S  P+ K
Sbjct: 241 RPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITK 300

Query: 301 KIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLE 360
           +ID++M L+YH+DYFHVYH+AQDF PYDPY D+FF FHPG AA  T + W+ +TM+ LL+
Sbjct: 301 RIDDSMSLVYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLD 358

Query: 361 TKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFN 420
           +KC IF TGF+++DIT D+ ++   + K+MD LM P+KN +GSTKWELND NPQE++QFN
Sbjct: 359 SKCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFN 418

Query: 421 MYVAGFRGKRYHTIK 435
           MY+AG+RGKRYH  +
Sbjct: 419 MYIAGYRGKRYHATE 433

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/416 (64%), Positives = 322/416 (77%), Gaps = 19/416 (4%)

Query: 34  RSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93
           R  +GFVKNALG+           ENRFHPWDQSPSPDLRERAARIR LAKCPVT KEIN
Sbjct: 39  RHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEIN 98

Query: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153
           YTCP+SGIPTHHS+EAWE D +YHQ+K Y+ILKKVN++EHDLRSGR FPEF+FP  Q HD
Sbjct: 99  YTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHD 158

Query: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213
             V++ NWD+FFYTR F SMD+EFQLA VTKMLSYP+TI SILH++ PY+L P GPITLE
Sbjct: 159 CAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLE 218

Query: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273
           GLKS+AAL+YSL     + N      +RPMRIFILGARAE+QLP H+WKQ  +LFP Q F
Sbjct: 219 GLKSIAALKYSL-----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNF 273

Query: 274 EIHFIGTECLL--------NNEKNKYIKSAIP------VVKKIDETMKLIYHSDYFHVYH 319
           EI+FIG EC +          E N     ++       +VK+IDE + L+YH+D+FH  H
Sbjct: 274 EINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLH 333

Query: 320 EAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDV 379
            A+DF PYD Y DVFFTFHPGFA+PE +  WMG+TMKALL+TKCAIFTTGFNKQD+  D+
Sbjct: 334 NARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDI 393

Query: 380 EIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           +IV+  YGKE+D LM P KN +GSTKWELNDM+PQE++Q+NMY+AGFRGKRYH +K
Sbjct: 394 DIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/402 (65%), Positives = 319/402 (79%), Gaps = 7/402 (1%)

Query: 34  RSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93
           R++MG+V+NA GL            NRFHPW++SP  DLR+RAARI+TLA+CPVT K IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153
           YTCP+SGIPTHHSR+AWE D DYH++K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213
           R VNL NWDLF YTR FYSMDTEF LA VTKMLSYP+TI S+LH+FSPY L P+GP+TLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273
           GLKS+AALRY+LYP   K+++S   ++ PMRIFI+G RAE+QLPGHVWKQLQ+LF ++ F
Sbjct: 209 GLKSIAALRYTLYPKLGKTSLS---NNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIF 265

Query: 274 EIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDV 333
           EIHFIG EC L   KN    ++ P++KK+D+T+ LIYH  YFH  H++ D  PY+PY DV
Sbjct: 266 EIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDV 321

Query: 334 FFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTL 393
           FF FHPGFA P+T  LW+ +T+  LLETKCAIF TGFN+ DITNDV ++   Y  E+D L
Sbjct: 322 FFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVL 381

Query: 394 MDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           M PIKN +GS KWELND+NPQE++QFNMY+AGFRGKRYH IK
Sbjct: 382 MKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/406 (67%), Positives = 326/406 (80%), Gaps = 3/406 (0%)

Query: 30  SSQKRSLMGFVKNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLAKCPVTK 89
             Q+R +MGFV+NALGL           ENRFH W+QSPSPDLRERAARIR LA+CPVT 
Sbjct: 25  CGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTG 84

Query: 90  KEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLD 149
           K+I Y+C  SGIPTHHSREAWE D++YH+SKR+  L+KVN+YEHDLRSGRPF EFDFP +
Sbjct: 85  KDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQE 144

Query: 150 QIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGP 209
           Q  DR+VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYP+TIGS+LHQFSPY+L P+GP
Sbjct: 145 QGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGP 204

Query: 210 ITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFP 269
           ITLEGLKSLAALRY+LYP   +S  +  +  +PMRIFILGARAEAQLPGHVWKQLQ+LFP
Sbjct: 205 ITLEGLKSLAALRYTLYP---ESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFP 261

Query: 270 DQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDP 329
               EIHFIG E L + ++ +Y+ S+ PV K++D T+KL++H+DY HV+HEAQDF PYDP
Sbjct: 262 GSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDP 321

Query: 330 YLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKE 389
           Y DVFF FHPGFA+ E    WM  T+ ALLETKCAIF TGF++ D+  D E ++A +  E
Sbjct: 322 YNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAE 381

Query: 390 MDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435
           MD LM P KN +GSTKWELNDMNP E++QFNMY+AGFRGKRYH I+
Sbjct: 382 MDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>KAFR0C03210 Chr3 (647217..653612) [6396 bp, 2131 aa] {ON} Anc_8.69
            YFL007W
          Length = 2131

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 13/114 (11%)

Query: 96   CP--LSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPE-----FDFPL 148
            CP  +  I    ++   ++D   HQ+ R  +L+ +++   D R+  P        FD P 
Sbjct: 1727 CPPFIEIISNISNQSDLKSDSVNHQASRLLMLRNLSV-SQDFRTYHPMEIAEHLIFDHPY 1785

Query: 149  DQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPY 202
            DQ+ D    L N  +   T ++ S++T  +L      LS    +G+IL + +PY
Sbjct: 1786 DQMRDATAKLFN--ILVQTESYLSVETPEELLL---SLSRESDLGNILKRVAPY 1834

>Skud_4.167 Chr4 complement(295745..296560) [816 bp, 271 aa] {ON}
           YDL087C (REAL)
          Length = 271

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 131 YEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNF-YSMDTEFQLAAVTKML 186
           YE D++ G+ FPEF+     I  R VN  N  +    +N  ++ +   ++  VT+ L
Sbjct: 91  YERDVKQGKAFPEFEREYRTILARFVNECNGQIALALQNLKHTAEERMKIQQVTEEL 147

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 182 VTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRK---SNISLKL 238
           V +++S    + SIL + +    NP+ P T+  L +L  ++ S++P   +    +   +L
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 239 HDRPMRIFILGARAEAQLPGHVWKQLQFLFPD 270
             + + IF L A+ E  + G+    L+    D
Sbjct: 721 SRKNLEIFTLLAKMETSILGNYLSDLKVTLRD 752

>KLTH0H15906g Chr8 (1365702..1366559) [858 bp, 285 aa] {ON} highly
           similar to uniprot|Q07508 Saccharomyces cerevisiae
           YDL087C LUC7 Essential protein associated with the U1
           snRNP complex splicing factor involved in recognition of
           5' splice site
          Length = 285

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 131 YEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNF-YSMDTEFQLAAVTKML 186
           YE +L +GR FP+FD     I  + VN  N  +    +N  ++ + + ++  VTK L
Sbjct: 75  YERELSNGRDFPDFDREYFSILSKFVNDCNGQIAVALKNLEHTPEEQEKIKNVTKEL 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,829,808
Number of extensions: 2115350
Number of successful extensions: 5314
Number of sequences better than 10.0: 29
Number of HSP's gapped: 5397
Number of HSP's successfully gapped: 29
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)