Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029207.344ON32032015770.0
Kpol_530.367.344ON3112879171e-123
SAKL0F11242g7.344ON3092908281e-110
ZYRO0F11594g7.344ON3092907791e-102
KLLA0D12474g7.344ON3122917781e-102
TDEL0C020307.344ON3112957711e-101
Smik_12.2637.344ON3182897314e-95
YLR205C (HMX1)7.344ON3172887271e-94
Ecym_47297.344ON3262947281e-94
Suva_10.2997.344ON3202887228e-94
Kwal_56.246247.344ON3072907131e-92
Skud_12.2687.344ON3182807045e-91
KLTH0H01386g7.344ON3072907001e-90
NCAS0E028907.344ON3152936853e-88
NDAI0E045007.344ON3273016673e-85
KAFR0L014707.344ON3002895966e-75
ACL154W7.344ON3192865838e-73
CAGL0A03905g7.344ON2822635546e-69
KNAG0B026407.344ON3022975495e-68
ZYRO0C08140g7.241ON52249702.6
Skud_13.3828.728ON59445703.0
TBLA0D041007.236ON55327693.9
NCAS0A134707.236ON54527684.7
SAKL0H12254g8.458ON68088685.2
SAKL0H01122g5.27ON52892676.6
NCAS0J012904.221ON107439677.0
Kpol_298.4singletonON63198668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02920
         (320 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   612   0.0  
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   357   e-123
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   323   e-110
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   304   e-102
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   304   e-102
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   301   e-101
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   286   4e-95
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   284   1e-94
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   285   1e-94
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   282   8e-94
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   279   1e-92
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   275   5e-91
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   274   1e-90
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   268   3e-88
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   261   3e-85
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   234   6e-75
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   229   8e-73
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   218   6e-69
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   216   5e-68
ZYRO0C08140g Chr3 (623406..624974) [1569 bp, 522 aa] {ON} simila...    32   2.6  
Skud_13.382 Chr13 (667165..668949) [1785 bp, 594 aa] {ON} YMR213...    32   3.0  
TBLA0D04100 Chr4 (1017819..1019480) [1662 bp, 553 aa] {ON}             31   3.9  
NCAS0A13470 Chr1 complement(2651815..2653452) [1638 bp, 545 aa] ...    31   4.7  
SAKL0H12254g Chr8 (1043145..1045187) [2043 bp, 680 aa] {ON} simi...    31   5.2  
SAKL0H01122g Chr8 complement(120648..122234) [1587 bp, 528 aa] {...    30   6.6  
NCAS0J01290 Chr10 complement(222141..225365) [3225 bp, 1074 aa] ...    30   7.0  
Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON} (12426..14...    30   8.8  

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/320 (94%), Positives = 302/320 (94%)

Query: 1   MSNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIF 60
           MSNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIF
Sbjct: 1   MSNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIF 60

Query: 61  GTIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQ 120
           GTIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQ
Sbjct: 61  GTIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQ 120

Query: 121 DVLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVL 180
           DVLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVL
Sbjct: 121 DVLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVL 180

Query: 181 KNVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQK 240
           KNVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQK
Sbjct: 181 KNVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQK 240

Query: 241 NDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQXXX 300
           NDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQ   
Sbjct: 241 NDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQIIL 300

Query: 301 XXXXXXXXXXXXXXXKWFLS 320
                          KWFLS
Sbjct: 301 LIISIINILITYTIIKWFLS 320

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 222/287 (77%), Gaps = 8/287 (2%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           IPSPTDV ALANRINFETRDFHNK+ AFM IRLALAL+HGFIYR+GLV FYHIF TIE E
Sbjct: 5   IPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETE 64

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           ID +LN  D   DS   Q K IL SFY++EFRRKD +L+DL +LYYPEF+ +R  +L+F+
Sbjct: 65  IDLVLNNQD---DS---QMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
           NS+ F  ++  +L  F  YI+    E P T++AYCHVLYLALFAGGKIMKSNV K++G+F
Sbjct: 119 NSDRFTNDS-EQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIF 177

Query: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTAD-FDSKLRFEYKKNYELSTRDELNEMQKNDIIE 245
           PKF+H+SH+E+  +G+NF++FT     +  D KLR+ YKKNYELSTRDEL E QK  +I+
Sbjct: 178 PKFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIK 237

Query: 246 VSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLT 292
            SK++FVMLEN IAE+G +NR +LM  F+ K  T++VEEWKYN  ++
Sbjct: 238 TSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSIS 284

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  323 bits (828), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 210/290 (72%), Gaps = 9/290 (3%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           IPSPTDV ALANRINF TRD HNKI A MS++LA A++HG IYRQG++AFY+IF  +E E
Sbjct: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           IDNLL    + L+   +QT+KIL  F+  EFRR + + QDL +LY  E+   R ++  FL
Sbjct: 66  IDNLLQNASTPLE---LQTQKILNQFWCEEFRRSNMIFQDLELLYSKEY-STRTELHAFL 121

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
           +         P+   F +YI  T +EKPYTI+AYCHVLYLALFAGGK+MKSN+ ++ GLF
Sbjct: 122 DDNVLP----PQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLF 177

Query: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246
           PKF H++ E++  +G+NFF F++E  AD + KLR+EYKK YEL+TR EL E QK +II+V
Sbjct: 178 PKFQHLTPEQIVRRGTNFFTFSEEG-ADAEGKLRWEYKKGYELATRKELTEEQKQEIIKV 236

Query: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296
           S  IF    +VI E+G  NR +LMG F+ K +++++EEWKY+EKL+K NK
Sbjct: 237 SSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENK 286

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  304 bits (779), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 201/290 (69%), Gaps = 8/290 (2%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           IP+PTDV ALANRINF TRD HNKI A+MS+RLA AL+HG+I+RQG++A+Y+IF  IE E
Sbjct: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           +D +   +D   +  ++Q + +L  F++N+FRR D + QDLT+LY PEF      +  FL
Sbjct: 64  LDRI---MDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFP-TESSLEQFL 119

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
            S        P L  F D I    +E+P TI+AYCHVLYLALFAGGK+M+SN+ ++ GLF
Sbjct: 120 TS---GNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF 176

Query: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246
           PKF H+S  E+  +G+NFF F++E + + ++KLR+ YK+ YEL+TRDEL E QK  II V
Sbjct: 177 PKFQHLSPRELVQRGTNFFTFSEEGS-EAENKLRWRYKRGYELATRDELTEEQKQKIISV 235

Query: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296
           S  IF      IAEIG  NR +LMG  + + +TYL EEWK+ +KL+K  K
Sbjct: 236 SSEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQK 285

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  304 bits (778), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/291 (52%), Positives = 207/291 (71%), Gaps = 9/291 (3%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           IPSPTDV ALANRINF+TRD HNKI A+MS+++A A+RHGFIYRQG+VA+Y++F  IE E
Sbjct: 9   IPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQE 68

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           ID LL    +  D    + K IL+ F+  EFRR D L+ DL VLY  E+ G+ Q + +FL
Sbjct: 69  IDRLLEHPVTVQDE---KVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQ-LQEFL 124

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
           +          +L  F D I    +++P+TI+AYCHVLYLALFAGG++MKSN+ +++GLF
Sbjct: 125 DGFQLP----AKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180

Query: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246
           PKF H+S +E+  + +NFF F++E   D +++LR++YKK YEL+TR EL E +K  IIEV
Sbjct: 181 PKFGHLSPKELVRRATNFFTFSEEGVDD-ENRLRWQYKKGYELATRTELTEAEKLRIIEV 239

Query: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQ 297
           S+ IF     V+AEIG  NR +LMG F+ K I++L EEWKY+EKLT   K+
Sbjct: 240 SQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKK 290

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  301 bits (771), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/295 (50%), Positives = 210/295 (71%), Gaps = 9/295 (3%)

Query: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61
           S  K IP+PTDV ALANRINF TRD HNK+ A+MS+RLA AL+HGFIYRQG++AFYHIF 
Sbjct: 3   SVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFD 62

Query: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121
            +E E+D LLN  D + D  + Q + +L+ F++ EFRR + + +DL VLY PE+  + + 
Sbjct: 63  AVEQELDRLLN--DPQNDE-ERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEY-SDSES 118

Query: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181
           + +F+  +       P+L  F D I  T ++   TI+AYCHVLYLALFAGGK+M+SN+ +
Sbjct: 119 LRNFVEHQPLA----PQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYR 174

Query: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241
           + GLFPKF++++ +E+  +G+NFF F+ E + D ++KLR++YK+ YEL+TR EL+E QK 
Sbjct: 175 HTGLFPKFEYLTPKELVIRGTNFFTFSDEGS-DAENKLRWKYKEGYELATRQELSESQKT 233

Query: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296
            I++VS  IF    +VI EIG  NR +LM  F+ K +TYL EEWKY+  L+K +K
Sbjct: 234 RILQVSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSK 288

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  286 bits (731), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 144/289 (49%), Positives = 203/289 (70%), Gaps = 9/289 (3%)

Query: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61
           SN KIIPSPTD+ ALANRINF TRD HNKI  FM I++A+A+RHGFIYRQG++A+Y++F 
Sbjct: 4   SNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFD 63

Query: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121
            IE EID LLN     +   ++QT  ILK F++ +FRR   + +DL +LY   FK   + 
Sbjct: 64  AIEQEIDRLLN---DPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKST-ES 119

Query: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181
           + +FL   TF K   P L  F + I +  +++P TI++YCHVLYLALFAGGK+++SN+ +
Sbjct: 120 LNEFL--ATFEKP--PVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYR 175

Query: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241
            +GLFP F+ +S +E+  +G+NFF F+     + +++L+ EYKKNYEL+TR EL E QK 
Sbjct: 176 RLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTE-ETRLKLEYKKNYELATRTELTEAQKL 234

Query: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK 290
            II V++ IF    N++AEIG  NR +LMG F+ K +TY+ EEW +N++
Sbjct: 235 QIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKE 283

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  284 bits (727), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 146/288 (50%), Positives = 203/288 (70%), Gaps = 9/288 (3%)

Query: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61
           S+  IIPSPTDV ALANRINF+TRD HNKI  FM I++A+A+RHGFIYRQG++A+Y++F 
Sbjct: 4   SSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFD 63

Query: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121
            IE EID LLN   +E    ++QT  ILK F++ +FRR   + +DL +LY   FK   + 
Sbjct: 64  AIEQEIDRLLNDPVTE---EELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKST-ES 119

Query: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181
           + +FL   TF K   P L  F + I +   ++P TI++YCHVLYLALFAGGK+++SN+ +
Sbjct: 120 LNEFL--ATFQKP--PLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYR 175

Query: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241
            +GLFP F+ +S +E+  +G+NFF F+     + +++L++EYKKNYEL+TR EL E QK 
Sbjct: 176 RLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTE-ETRLKWEYKKNYELATRTELTEAQKL 234

Query: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNE 289
            II V++ IF    N++AEIG  NR +LMG F+ K ITYL EEW +N+
Sbjct: 235 QIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNK 282

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  285 bits (728), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 204/294 (69%), Gaps = 9/294 (3%)

Query: 4   VKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTI 63
           V +IPSPTDV ALANRINF TRD H K  AF+  ++ALA+RHGFIYRQG++AFY+IF  +
Sbjct: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78

Query: 64  ENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVL 123
           E +ID LL T  ++    ++Q   IL+ F+  EFRR   LL+DL   Y+ E+   + ++ 
Sbjct: 79  EQQIDRLLETPSTK---EELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYP-TQNELQ 134

Query: 124 DFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNV 183
            FLN    + E  P+L  F D+I+D T E P TI+AYCHVLY ALFAGGK+M+SN+ +N+
Sbjct: 135 QFLN----DFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNI 190

Query: 184 GLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDI 243
           GLFPK   +S  E +  G+NFF F+ +D  D ++KLR++YKKNYEL+TR+ L+E QK +I
Sbjct: 191 GLFPKPKGISAAESSRNGTNFFTFS-DDGVDEENKLRWQYKKNYELATREGLDENQKLEI 249

Query: 244 IEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQ 297
           I+VS   F  + +++ EIG  N+ +LM  F+ K +T+L  EW+YN+KL+   KQ
Sbjct: 250 IDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQ 303

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  282 bits (722), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 201/288 (69%), Gaps = 9/288 (3%)

Query: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61
           S   IIPSPTD+ ALANRINF TRD HNKI  FM I++A+A+RHGFIYRQG++A+Y++F 
Sbjct: 6   STSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFD 65

Query: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121
            IE EID LLN   SE    ++Q   ILK F++ +FRR   + +DL +LY   FK   + 
Sbjct: 66  AIEQEIDRLLNDAVSE---KELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKST-ES 121

Query: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181
           + +FL   TF K   P L  F D I D  +++P TI++YCHVLYLALFAGGK+++SN+ +
Sbjct: 122 LNEFL--ATFEKP--PLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYR 177

Query: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241
            +GLFP F+ ++ +E+  +G+NFF F++    + +++L++EYKKNYEL+TR EL E QK 
Sbjct: 178 RLGLFPNFEKLTQKELVKKGTNFFTFSELGPTE-ETRLKWEYKKNYELATRTELTEAQKL 236

Query: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNE 289
            II V++ IF    N++AEIG  NR +LM  F+ K +TY+ EEW +++
Sbjct: 237 KIISVAEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSK 284

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  279 bits (713), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 196/290 (67%), Gaps = 9/290 (3%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           IPSPTDV ALANRINF TRD HNKI   MS++ A A++HGFIYRQGL+AF+++F  IE E
Sbjct: 4   IPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQE 63

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           ID LL    +   + ++QT+ IL  F+V+ F R   + QDL +LY  EF  + Q  L FL
Sbjct: 64  IDRLLQNAQT---AEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSL-FL 119

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
              T      PE   F D++ ++ + +P +I+A+CHVLYLALFAGG++M+S + ++ GLF
Sbjct: 120 QQNTLP----PEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLF 175

Query: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246
           PKF  ++ EEV  +G+NFF F+ +D    +++LR EYK+ YEL+TR+ L E QK +I+EV
Sbjct: 176 PKFPDLTPEEVVRKGTNFFTFS-DDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEV 234

Query: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296
           +   F     VI+EIG  NR +LMG  + K +++ ++EWK+ EKLT+  K
Sbjct: 235 AAATFEWNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQK 284

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  275 bits (704), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 139/280 (49%), Positives = 191/280 (68%), Gaps = 9/280 (3%)

Query: 6   IIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIEN 65
           IIPSPTDV ALANRINF TRD HNKI  FM IR+A+A+RHGFIYRQG++A+Y++F  IE 
Sbjct: 8   IIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQ 67

Query: 66  EIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDF 125
           EID LL+   +E    ++QT  ILK F++ +FRR   + +DL +LY   FK         
Sbjct: 68  EIDRLLHDPVTE---KELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTES----- 119

Query: 126 LNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGL 185
           LN      E  P L  F + I +  +++P TI++YCHVLYLALFAGGK+++SN+ + +GL
Sbjct: 120 LNEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGL 179

Query: 186 FPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIE 245
           FP F+ +S +E+  +G+NFF F+     + +++L+ EYKKNYEL+TR EL E QK  II 
Sbjct: 180 FPNFERLSQKELVKKGTNFFTFSDLGPTE-ETRLKLEYKKNYELATRTELTEAQKLQIIS 238

Query: 246 VSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEW 285
           V+  IF    +++AEIG  NR +LMG F+ K +TY+ EEW
Sbjct: 239 VAGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  274 bits (700), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 136/290 (46%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           IPSPTDV ALANRINF TRD HNKI   MS + A A++HGFIYRQG++AF+++F  IE E
Sbjct: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           +D L     +  +    QT+ IL  F+  EFRR   +LQDL +LY  EF  +   +  FL
Sbjct: 64  LDRLRQEAQTPEEE---QTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTS-ASLRTFL 119

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
              T      PEL  F DY+  + + +P  I+AYCHVLYLALFAGG++M+S + ++ GLF
Sbjct: 120 EETTLA----PELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLF 175

Query: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246
           PKF +++ EEV  +G+NFF F+ +     +++LR  YK+ YEL+TR  L E QK +I++V
Sbjct: 176 PKFPNLTTEEVVRRGTNFFTFS-DAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDV 234

Query: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296
           S  IF     V+ EIG  NR +LMG  + + +T+++EEW+Y++KLT+  K
Sbjct: 235 SNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQK 284

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  268 bits (685), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 198/293 (67%), Gaps = 8/293 (2%)

Query: 6   IIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIEN 65
           IIPSPTD KALANRINF+TRD HNKI   MSI+LA+ALRHGFIYRQG++ +Y+IF  +E 
Sbjct: 8   IIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVEE 67

Query: 66  EIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDF 125
           EI  L     S   S +++   +L   ++ EF R +NLL+DL +LY+ E+   ++ +  F
Sbjct: 68  EIIKLTT---SPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYP-TKEALQLF 123

Query: 126 LNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGL 185
           L  ET   E  P L+ F  YI  +  E P +I AYCHVLYLALFAGGKI++S + KN+G 
Sbjct: 124 L--ETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGF 181

Query: 186 FPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIE 245
            P F+H+S +EV  +G+NFF+F  +   + ++KL+ E+KKNYEL+TR+ LNE +K+ IIE
Sbjct: 182 LPNFNHLSSKEVFEKGTNFFKFGSDGVIE-ETKLKLEFKKNYELNTRESLNEKEKSIIIE 240

Query: 246 VSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK-LTKTNKQ 297
            SK IF      + E+G+ N+ +LM     K +TYL+EEWK+N+  L+K  K 
Sbjct: 241 TSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKH 293

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  261 bits (667), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 202/301 (67%), Gaps = 11/301 (3%)

Query: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61
           S V IIPSPTD +ALANRINF TRD HNKI   M+++LA+ALRHG IYRQG++ +Y+IF 
Sbjct: 4   STVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQ 63

Query: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121
            +E+EI+ LL + +++    Q +T  +L   ++ EF R D L +DL +LY   F+ N QD
Sbjct: 64  AVESEINYLL-SFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQ-NDQD 121

Query: 122 VLDFLNSE--TFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNV 179
           +L+F+N E    ++    +L  F ++I  + +  P  I+AYCHVLYLALFAGGKI+KS +
Sbjct: 122 LLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKI 181

Query: 180 LKNVGLFPKFDHMSHEEVTNQGSNFFRFTQE-------DTADFDSKLRFEYKKNYELSTR 232
            KN+G  P F+H+S +E+ N  +NFF+FT+        ++   ++KL+ ++K+N+EL+TR
Sbjct: 182 YKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTR 241

Query: 233 DELNEMQKNDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLT 292
             LNE +K  IIE++K IF      + E+G +N+ +LM  F+ K I YL EEWK+N+ + 
Sbjct: 242 SNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIK 301

Query: 293 K 293
           K
Sbjct: 302 K 302

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  234 bits (596), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 126/289 (43%), Positives = 189/289 (65%), Gaps = 22/289 (7%)

Query: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66
           +PSPTD  ALANRINF TRD HN I   MSI+   ALRH FIY+  L+++Y++F T+E+E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126
           ID +++   S +        +IL+ F+ ++FRRKD +L+DL  L   + + + Q    +L
Sbjct: 65  IDFIISNDRSHIG-------EILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQ----WL 113

Query: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186
           +S        PEL  F ++IK    E P  ++AYCHVLYLALFAGG+IM++++ KN+  F
Sbjct: 114 SSR-------PELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFF 166

Query: 187 --PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDII 244
             PKFD MSH +V    +NFF+F ++  +  ++KL+ EYK+NY++ T+ +LNE +K +II
Sbjct: 167 FMPKFDKMSHTDVIMNATNFFKFDKDIVS--ENKLKSEYKRNYDILTKAKLNEDEKLEII 224

Query: 245 EVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTK 293
           ++S+ IF    N++ EIG  N+ +LM  F  K +TY+VEEWK+ +   K
Sbjct: 225 DISREIFKFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIK 273

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  229 bits (583), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 178/286 (62%), Gaps = 10/286 (3%)

Query: 5   KIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIE 64
            ++P PTD  ALANRINF TR+ H+K  AF+S + A+ALRH  IYRQGL+A Y+IF ++E
Sbjct: 16  PVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVE 75

Query: 65  NEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLD 124
             ID LL    +  D  +I   +IL++F+  EF R   L+QD  V Y  E+  + Q +  
Sbjct: 76  QHIDRLLRA-PATADEARI--GEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQ-LHQ 131

Query: 125 FLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVG 184
           FL+S     E  P L      I+     +P+TI+A+CHVLYLALFAGG++M+S + + +G
Sbjct: 132 FLDS----YELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLG 187

Query: 185 LFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDII 244
           L P+   +S  E   +G++FF F     A  ++K R  YK+ YEL+TR  L+E +K D+I
Sbjct: 188 LLPRAAGLSARETQLRGTHFFTFGA--GAGEENKARVAYKRAYELATRTALSEAEKADVI 245

Query: 245 EVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK 290
           + ++  F  ++ V+AE+  +NR +L+G  + + +T+L EEW+Y  K
Sbjct: 246 DAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTK 291

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  218 bits (554), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 173/263 (65%), Gaps = 14/263 (5%)

Query: 35  MSIRLALALRHGFIYRQGLVAFYHIFGTIENEIDNLLN-------TLDSELDSVQIQTKK 87
           MS+R A+ALRHG +YRQG++AFY++F  IE EID LL+       T  +++   ++   K
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 88  ILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFLNSETFNKENYPELNFFTDYIK 147
           I+K F++ EFRR + L +DL +LY PE+  + +     L++   + +  P+L  F D + 
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTE-----LDAMLVDHQLPPQLQGFVDMVH 115

Query: 148 DTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLFPKFDHMSHEEVTNQGSNFFRF 207
            T ++ P T++AYCHV+YLALFAGGK+M+S + +N GLFPKF+H+S +E+  +G+NFF F
Sbjct: 116 ATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTF 175

Query: 208 TQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVMLENVIAEIGAKNRT 267
           + +   D +++L+++YKKNYEL+TR+ L E  K +II+V+K IF    ++I EIG  N+ 
Sbjct: 176 S-DAGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKE 234

Query: 268 KLMGGFTLKTITYLVEEWKYNEK 290
            L     L  + Y+ EE K+  K
Sbjct: 235 ALTNN-KLDLLQYVFEELKFYNK 256

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  216 bits (549), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 168/297 (56%), Gaps = 27/297 (9%)

Query: 4   VKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTI 63
           +  IPSPTD  ALANRINF TRD HN++    S++  +ALRH FIY   L  FY +FGT+
Sbjct: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61

Query: 64  ENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVL 123
           E  ID L+ +   +          IL  FYV EFRR D + +DL       F G    V 
Sbjct: 62  EQRIDELIASEGGD------GVGAILGEFYVPEFRRADKIKRDLV------FLGEWDTV- 108

Query: 124 DFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNV 183
                E+      P+L  F  Y++      P T++A CHVLYLALFAGG++ KS++ KN+
Sbjct: 109 -----ESGQWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNL 163

Query: 184 GLFPKF-------DHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELN 236
           G  P F       + MS   + +  +NFF+F +  T + ++KLR+ YK+NYEL+TRD L 
Sbjct: 164 GFLPNFRDKNGPGEEMSDHTLVSNATNFFQFAE--TIEDENKLRWTYKRNYELATRDTLT 221

Query: 237 EMQKNDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTK 293
           E QK  +I  S+++F     VI EI  +N  +LM   + K +TY +EEWK+N+   +
Sbjct: 222 EDQKLAVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278

>ZYRO0C08140g Chr3 (623406..624974) [1569 bp, 522 aa] {ON} similar
           to uniprot|P40039 Saccharomyces cerevisiae YER060W FCY2
           Purine-cytosine permease and similar to uniprot|P17064
           Saccharomyces cerevisiae YER056C
          Length = 522

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query: 15  ALANRINFETRDFHN----KIGAFMSIRLALALRHGFIYRQGLVAFYHI 59
           A+A    ++ R F N     IG +++I +A+AL   FIYR+G  + Y++
Sbjct: 398 AIACAAAYKFRTFMNYFMDSIGYYLAIYVAMALSEHFIYRRGRFSSYNV 446

>Skud_13.382 Chr13 (667165..668949) [1785 bp, 594 aa] {ON} YMR213W
           (REAL)
          Length = 594

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 107 LTVLYYPEFKGNRQDVLD----FLNSETFNKENYPELNFFTDYIK 147
            T L  PEFKGN   ++D     L +   NKE++ E     D++K
Sbjct: 438 CTALPIPEFKGNPHSIIDDKYNLLVANAINKESHMEPQGIADFLK 482

>TBLA0D04100 Chr4 (1017819..1019480) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 26  DFHNKIGAFMSIRLALALRHGFIYRQG 52
            F + IG ++SI +A+AL   FIYR+G
Sbjct: 445 SFMDSIGYYLSIYIAIALSEHFIYRRG 471

>NCAS0A13470 Chr1 complement(2651815..2653452) [1638 bp, 545 aa]
           {ON} 
          Length = 545

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 26  DFHNKIGAFMSIRLALALRHGFIYRQG 52
           +F N IG +++I +A++L   FIYR+G
Sbjct: 437 NFMNSIGYYLAIYIAISLSEHFIYRKG 463

>SAKL0H12254g Chr8 (1043145..1045187) [2043 bp, 680 aa] {ON} similar
           to uniprot|Q12424 Saccharomyces cerevisiae YDL206W
           Hypothetical ORF
          Length = 680

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 10/88 (11%)

Query: 157 IIAYCHVLYLALFAGGKIMKSNVLKNVGLFPKFDHMSHEEVTNQGSNF----FRF---TQ 209
           +  YC  +Y  LF GG    +  L +    P  D +  +E  N   NF     RF   T+
Sbjct: 189 VTTYCSYVYYLLFYGGM---TAALGSPLDTPSIDSLVEDEQGNPNENFDINISRFMNSTK 245

Query: 210 EDTADFDSKLRFEYKKNYELSTRDELNE 237
           E  A+   K+R   + NY    R  LN+
Sbjct: 246 ERRANIRKKIRTYLRSNYRGWMRLTLND 273

>SAKL0H01122g Chr8 complement(120648..122234) [1587 bp, 528 aa] {ON}
           highly similar to gnl|GLV|KLLA0A09977g Kluyveromyces
           lactis KLLA0A09977g and similar to YMR297W
           uniprot|P00729 Saccharomyces cerevisiae YMR297W PRC1
           Vacuolar carboxypeptidase Y (proteinase C) involved in
           protein degradation in the vacuole and required for full
           protein degradation during sporulation
          Length = 528

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 101 DNLLQDLTVLYYPEFK-------GNRQ--DVLDFLNSETFNKENYPELNFFTDYIKDTTK 151
           D L Q L VL Y   K       GN+   DVL +  +E F K+         D++  +T 
Sbjct: 429 DLLNQGLPVLIYAGDKDFICNWLGNQAWTDVLPWKYAEEFAKQP------IRDWVSSSTS 482

Query: 152 EKPYTIIAYCHVLYLALFAGGKIMKSNVLKNV 183
           +K   +  Y H  +L ++ GG ++  +V +N 
Sbjct: 483 DKAGEVKNYKHFTFLRVYGGGHMVPYDVPENA 514

>NCAS0J01290 Chr10 complement(222141..225365) [3225 bp, 1074 aa]
           {ON} Anc_4.221 YGR071C
          Length = 1074

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 55  AFYHIFGTIENEIDNLLNTLDSELDSVQIQTKKILKSFY 93
           A   +FG+IENE+D+L+NT  S ++S  +Q   +   ++
Sbjct: 580 AITPLFGSIENEVDDLMNT--STINSEPVQENSLPNDYF 616

>Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON}
           (12426..14321) [1896 nt, 632 aa]
          Length = 631

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 9/98 (9%)

Query: 205 FRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVM---------LE 255
           F F + +  +   +    +++ Y LST   +N++QKN     SKNI            + 
Sbjct: 32  FPFLESNGGEVVERANVAFREAYSLSTFHVINKLQKNSQEPHSKNILFPKLANKFPEDMT 91

Query: 256 NVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTK 293
           NVI    A+  +K     T+  + YL+     N+++TK
Sbjct: 92  NVIENWEAEETSKEQKCRTMIELMYLITPTWTNDEITK 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,924,536
Number of extensions: 1597383
Number of successful extensions: 6040
Number of sequences better than 10.0: 64
Number of HSP's gapped: 6219
Number of HSP's successfully gapped: 64
Length of query: 320
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 210
Effective length of database: 40,868,139
Effective search space: 8582309190
Effective search space used: 8582309190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)